NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F033032

Metagenome Family F033032

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033032
Family Type Metagenome
Number of Sequences 178
Average Sequence Length 44 residues
Representative Sequence NWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR
Number of Associated Samples 124
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 6.78 %
% of genes near scaffold ends (potentially truncated) 90.45 %
% of genes from short scaffolds (< 2000 bps) 89.33 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (75.843 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(18.539 % of family members)
Environment Ontology (ENVO) Unclassified
(61.236 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.180 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 39.71%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF00145DNA_methylase 1.12
PF09723Zn-ribbon_8 1.12
PF00497SBP_bac_3 0.56
PF05869Dam 0.56
PF01844HNH 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.12


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.31 %
UnclassifiedrootN/A1.69 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000525|JGI1221J11331_1019983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1606Open in IMG/M
3300004123|Ga0066181_10109555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales766Open in IMG/M
3300004282|Ga0066599_101500812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales518Open in IMG/M
3300004448|Ga0065861_1104316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300004457|Ga0066224_1008927All Organisms → Viruses → Predicted Viral3666Open in IMG/M
3300004461|Ga0066223_1196473All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300004481|Ga0069718_15844300All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage803Open in IMG/M
3300005527|Ga0068876_10251367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1014Open in IMG/M
3300005527|Ga0068876_10629482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300005527|Ga0068876_10783744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300005581|Ga0049081_10193452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300005662|Ga0078894_10899802All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005805|Ga0079957_1042596All Organisms → Viruses → Predicted Viral2862Open in IMG/M
3300006484|Ga0070744_10083143All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage928Open in IMG/M
3300006639|Ga0079301_1061326All Organisms → Viruses → Predicted Viral1199Open in IMG/M
3300006639|Ga0079301_1237474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300006802|Ga0070749_10492268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300006802|Ga0070749_10799141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300006803|Ga0075467_10541213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage597Open in IMG/M
3300006803|Ga0075467_10661876All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300006805|Ga0075464_10141977All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1406Open in IMG/M
3300006805|Ga0075464_10936506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300006805|Ga0075464_10948212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300006805|Ga0075464_10985811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300006863|Ga0075459_1086137All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300006875|Ga0075473_10129391All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300006875|Ga0075473_10254619All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300006920|Ga0070748_1280910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300006920|Ga0070748_1290299All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300006920|Ga0070748_1304240Not Available566Open in IMG/M
3300007363|Ga0075458_10078668All Organisms → Viruses → Predicted Viral1029Open in IMG/M
3300007708|Ga0102859_1062213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1046Open in IMG/M
3300007860|Ga0105735_1117279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300007974|Ga0105747_1238999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300008108|Ga0114341_10150336All Organisms → Viruses → Predicted Viral1354Open in IMG/M
3300008108|Ga0114341_10465386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300008110|Ga0114343_1042504All Organisms → Viruses → Predicted Viral1807Open in IMG/M
3300008111|Ga0114344_1137460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage849Open in IMG/M
3300008111|Ga0114344_1160214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage758Open in IMG/M
3300008261|Ga0114336_1214909All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage796Open in IMG/M
3300008266|Ga0114363_1050069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2020Open in IMG/M
3300008266|Ga0114363_1173095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage693Open in IMG/M
3300008266|Ga0114363_1206127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage598Open in IMG/M
3300008266|Ga0114363_1250897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300008267|Ga0114364_1150992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300008448|Ga0114876_1127923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage962Open in IMG/M
3300008450|Ga0114880_1029347All Organisms → Viruses → Predicted Viral2468Open in IMG/M
3300008450|Ga0114880_1240038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage574Open in IMG/M
3300008450|Ga0114880_1264404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300009009|Ga0105105_10758821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300009068|Ga0114973_10276371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales900Open in IMG/M
3300009081|Ga0105098_10206297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
3300009081|Ga0105098_10261648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300009081|Ga0105098_10403904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300009082|Ga0105099_10142996All Organisms → Viruses → Predicted Viral1343Open in IMG/M
3300009151|Ga0114962_10524798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300009155|Ga0114968_10260807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300009155|Ga0114968_10755959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300009158|Ga0114977_10055850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2439Open in IMG/M
3300009158|Ga0114977_10457921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300009159|Ga0114978_10224906All Organisms → Viruses → Predicted Viral1176Open in IMG/M
3300009160|Ga0114981_10769841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300009161|Ga0114966_10612442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage606Open in IMG/M
3300009164|Ga0114975_10051815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2418Open in IMG/M
3300009164|Ga0114975_10160503All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300009164|Ga0114975_10414093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300009164|Ga0114975_10520386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage640Open in IMG/M
3300009165|Ga0105102_10486632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300009170|Ga0105096_10287719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage838Open in IMG/M
3300009170|Ga0105096_10477056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300009180|Ga0114979_10471507All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage728Open in IMG/M
3300009180|Ga0114979_10815626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300009182|Ga0114959_10501321All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300009183|Ga0114974_10593521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage611Open in IMG/M
3300009183|Ga0114974_10643983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage580Open in IMG/M
3300009183|Ga0114974_10712158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300009184|Ga0114976_10079175All Organisms → Viruses → Predicted Viral1897Open in IMG/M
3300009184|Ga0114976_10323285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300009184|Ga0114976_10575866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300009185|Ga0114971_10076196All Organisms → Viruses → Predicted Viral2071Open in IMG/M
3300009194|Ga0114983_1142401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage513Open in IMG/M
3300009466|Ga0126448_1059633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage872Open in IMG/M
3300010885|Ga0133913_10627101All Organisms → Viruses → Predicted Viral2820Open in IMG/M
3300010970|Ga0137575_10003921All Organisms → Viruses → Predicted Viral2806Open in IMG/M
3300011010|Ga0139557_1012910All Organisms → Viruses → Predicted Viral1607Open in IMG/M
3300012663|Ga0157203_1033087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300012665|Ga0157210_1016731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1215Open in IMG/M
3300012665|Ga0157210_1026222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage925Open in IMG/M
3300013004|Ga0164293_10657025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300013004|Ga0164293_11060935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300013372|Ga0177922_10820980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300014811|Ga0119960_1021359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage838Open in IMG/M
3300017722|Ga0181347_1066682All Organisms → Viruses → Predicted Viral1066Open in IMG/M
3300017736|Ga0181365_1170090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300017754|Ga0181344_1111834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300017766|Ga0181343_1126396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage717Open in IMG/M
3300017766|Ga0181343_1156638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage634Open in IMG/M
3300017774|Ga0181358_1010404All Organisms → Viruses → Predicted Viral3823Open in IMG/M
3300017774|Ga0181358_1258158All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300017777|Ga0181357_1336178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300017778|Ga0181349_1051382All Organisms → Viruses → Predicted Viral1616Open in IMG/M
3300017778|Ga0181349_1178619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300017778|Ga0181349_1296664All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300017780|Ga0181346_1269058All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300017780|Ga0181346_1271487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage585Open in IMG/M
3300017784|Ga0181348_1180879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300017785|Ga0181355_1200566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300017785|Ga0181355_1265275All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300017785|Ga0181355_1394446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300020205|Ga0211731_11544609Not Available1143Open in IMG/M
3300020537|Ga0208722_1022918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage952Open in IMG/M
3300020550|Ga0208600_1052383All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300021438|Ga0213920_1010179All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2813Open in IMG/M
3300021952|Ga0213921_1003813All Organisms → Viruses → Predicted Viral3227Open in IMG/M
3300021956|Ga0213922_1115333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300021963|Ga0222712_10261210All Organisms → Viruses → Predicted Viral1103Open in IMG/M
3300022747|Ga0228703_1134140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage545Open in IMG/M
3300024346|Ga0244775_10693675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300024348|Ga0244776_10696310All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300024348|Ga0244776_10740322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage602Open in IMG/M
3300025436|Ga0208103_1030959All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage736Open in IMG/M
3300025635|Ga0208147_1071349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300025889|Ga0208644_1149976All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1070Open in IMG/M
3300025889|Ga0208644_1385681All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300025896|Ga0208916_10416964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300027212|Ga0208554_1003366All Organisms → Viruses → Predicted Viral2554Open in IMG/M
3300027396|Ga0255146_1055349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300027631|Ga0208133_1079970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300027726|Ga0209285_10166457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300027734|Ga0209087_1028652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2679Open in IMG/M
3300027734|Ga0209087_1049107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1935Open in IMG/M
3300027741|Ga0209085_1288629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300027759|Ga0209296_1286809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage660Open in IMG/M
3300027759|Ga0209296_1342532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300027764|Ga0209134_10329583All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300027769|Ga0209770_10167667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300027782|Ga0209500_10152121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1088Open in IMG/M
3300027785|Ga0209246_10328774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300027808|Ga0209354_10210256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → Caryophyllales → Amaranthaceae → Bosea787Open in IMG/M
3300027900|Ga0209253_10352506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1129Open in IMG/M
3300027969|Ga0209191_1162464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage904Open in IMG/M
3300027971|Ga0209401_1331457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300027976|Ga0209702_10167202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage958Open in IMG/M
(restricted) 3300028114|Ga0247835_1074023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1402Open in IMG/M
(restricted) 3300028559|Ga0247831_1227889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
(restricted) 3300028569|Ga0247843_1144952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage984Open in IMG/M
(restricted) 3300028571|Ga0247844_1077701All Organisms → Viruses → Predicted Viral1655Open in IMG/M
3300031758|Ga0315907_10132084All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2124Open in IMG/M
3300031857|Ga0315909_10245910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1377Open in IMG/M
3300031857|Ga0315909_10351290All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300032116|Ga0315903_10071430All Organisms → Viruses → Predicted Viral3421Open in IMG/M
3300032116|Ga0315903_11040889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300033816|Ga0334980_0177997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage861Open in IMG/M
3300033981|Ga0334982_0206345All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300033994|Ga0334996_0111596All Organisms → Viruses → Predicted Viral1577Open in IMG/M
3300033994|Ga0334996_0461445All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300034012|Ga0334986_0594384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300034020|Ga0335002_0493108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300034061|Ga0334987_0078271All Organisms → Viruses → Predicted Viral2617Open in IMG/M
3300034061|Ga0334987_0644518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300034062|Ga0334995_0048339All Organisms → Viruses → Predicted Viral3495Open in IMG/M
3300034062|Ga0334995_0747356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300034066|Ga0335019_0867166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300034092|Ga0335010_0634545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300034095|Ga0335022_0608201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300034101|Ga0335027_0654782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300034101|Ga0335027_0711782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300034105|Ga0335035_0243932All Organisms → Viruses → Predicted Viral1085Open in IMG/M
3300034105|Ga0335035_0619751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300034106|Ga0335036_0773442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300034118|Ga0335053_0637175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300034120|Ga0335056_0451870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300034122|Ga0335060_0210471All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300034122|Ga0335060_0433303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300034200|Ga0335065_0640851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M
3300034200|Ga0335065_0777020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300034284|Ga0335013_0781676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake18.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater17.42%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake14.61%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.67%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton6.18%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.06%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater2.25%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.69%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.69%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.69%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.69%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.12%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.12%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.12%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.56%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.56%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.56%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.56%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.56%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.56%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.56%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline0.56%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000525Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micronEnvironmentalOpen in IMG/M
3300004123Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009194Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RTEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010970Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016EnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020537Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020550Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021438Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MGEnvironmentalOpen in IMG/M
3300021952Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MGEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025436Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027396Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8hEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027741Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1221J11331_101998343300000525HypersalineMNSQQAAYMKGSMNWQQAFAIMYVHAKTVQVDIINIEKNGTFIVSGKVYGRPRK*
Ga0066181_1010955533300004123Freshwater LakeGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0066599_10150081213300004282FreshwaterNWQQAFAIMYVQGSTVQVDLINIEKNGTFIVQGKVYGRPRR*
Ga0065861_110431613300004448MarineWQQAFAIMYVHGPSVQVDLINIEKNGTFIVQGKVYGRPRR*
Ga0066224_100892713300004457MarineQASYTKGTANWQQAFAIMYVKGSNVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0066223_119647333300004461MarineRQASYTKGTANWQQAFAIMYVHNSSVQVDLINIEKNGTFIVQGKVYGRPR*
Ga0069718_1584430043300004481SedimentNWQQAFAIIYVNKNKVQVDLINIEKDGTFIVAGKSYGRAR*
Ga0068876_1025136743300005527Freshwater LakeSMPNWQQAFAIVTEVGKNVQVDLIYVEKDGTFLVHGKRYGRPR*
Ga0068876_1062948213300005527Freshwater LakeQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR*
Ga0068876_1078374423300005527Freshwater LakeYTKGSANWQQAFAIMYVEGKNVQVDLIYLEKDGTFVVSGKRYGRPR*
Ga0049081_1019345233300005581Freshwater LenticANWQQAFAIMYVDGKNVQVDLIYFEKDGTFVVSGKRYGRPR*
Ga0078894_1089980213300005662Freshwater LakeANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR*
Ga0079957_1042596103300005805LakeHLMSLKEALYTRGTANWQQAFQIMTEDAKGVQIDMINIEKDGTFIVHGKRYGRVR*
Ga0070744_1008314313300006484EstuarineGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRPRH*
Ga0079301_106132643300006639Deep SubsurfaceYTKGSANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRAR*
Ga0079301_123747413300006639Deep SubsurfaceYTKGTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRPRNR*
Ga0070749_1049226833300006802AqueousQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0070749_1079914113300006802AqueousVANWQQAFAIIYVNKTKVQVDLIHIEKDGTFIVSGKSYGRPR*
Ga0075467_1054121323300006803AqueousAIMYVHGSNVQVDLINIEKNGTFIVQGKVYGRPR*
Ga0075467_1066187633300006803AqueousFAIMYVKGKNVQVDLIYIEKNGTFIVNGKVYGRPR*
Ga0075464_1014197713300006805AqueousFAIMYINKNKVQVDLINIEKDGTFIVAGKSYGRAR*
Ga0075464_1093650613300006805AqueousQASYTKGSANWQQCFAIMYVHGKNVQTDLIYIEKNGTFIVQGKVYGRPR*
Ga0075464_1094821213300006805AqueousAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRAR*
Ga0075464_1098581113300006805AqueousQASYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0075459_108613713300006863AqueousASYTKGTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRKRK*
Ga0075473_1012939113300006875AqueousTLHGVEVGNLMSFQAAKYTKGSAQWQQAFAIMYVQGSSVQVDLINIEKNGTFIVQGKVYGRPRR*
Ga0075473_1025461913300006875AqueousGTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRPRNR*
Ga0070748_128091033300006920AqueousVANWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR*
Ga0070748_129029933300006920AqueousQQAFAIMYVHGSTVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0070748_130424023300006920AqueousFAIMYVKGRNVQVDLIYIEKDGTFTVQGKVYGRTRK*
Ga0075458_1007866813300007363AqueousMDFKQAAYTKGVANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKTYGRAR*
Ga0102859_106221313300007708EstuarineQAFSIIYVKGKNVQIDLIYIEKNGTFIVNGKVYGRVR*
Ga0105735_111727933300007860Estuary WaterANWQQAFAIMYVEGKNVQVDIIYLEKDGTFLVAGKRYGRSR*
Ga0105747_123899913300007974Estuary WaterGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRPR*
Ga0114341_1015033653300008108Freshwater, PlanktonANWQQAFAIMYVTGKNVQVDLIYIEKDGTFVVAGKRYGRPR*
Ga0114341_1046538633300008108Freshwater, PlanktonFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR*
Ga0114343_104250413300008110Freshwater, PlanktonAYTKGTANWQQAFAIMYVHGKNVQVDLIYIEKNGTFIVNGKVYGRPR*
Ga0114344_113746053300008111Freshwater, PlanktonFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRAR*
Ga0114344_116021433300008111Freshwater, PlanktonYTKGSANWQSAFAIMYVDGKNVQVDIIYIEKDGTFVVSGKRYGRPR*
Ga0114336_121490933300008261Freshwater, PlanktonDFKQAAYTKGTANWQQAFAIMYVHNKNVQVDLIYIEKNGTFIVNGKVYGRPR*
Ga0114363_105006953300008266Freshwater, PlanktonTKGTANWQQAFAIMYVQGPTVQVDLINIEKNGTFIVQGKVYGRPRK*
Ga0114363_117309533300008266Freshwater, PlanktonSYTKGTANWQQAFAIMYVDKKNVQVDLIYIEKDGTFVVSGKRYGRSR*
Ga0114363_120612733300008266Freshwater, PlanktonKGSANWQQAFAIMYVEGKNVQVDLIYLEKDGTFQVSGKRYGRPR*
Ga0114363_125089723300008266Freshwater, PlanktonANWQQAFAIIYVNKSKVQVDIIHIEKDGTFIVAGKSYGRAR*
Ga0114364_115099213300008267Freshwater, PlanktonAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0114876_112792313300008448Freshwater LakeAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0114880_102934713300008450Freshwater LakeGSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFVVAGKRYGRAR*
Ga0114880_124003833300008450Freshwater LakeYTKGSANWQAAFAIMYVDGKNVQVDLIYIEKDGTFLVSGKRYGRPR*
Ga0114880_126440413300008450Freshwater LakeGSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFVVAGKRYGRPR*
Ga0105105_1075882123300009009Freshwater SedimentQAFAIIYVNKTKVQVDLINIEKDGTFIVAGKSYGRAR*
Ga0114973_1027637113300009068Freshwater LakeFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR*
Ga0105098_1020629713300009081Freshwater SedimentWQQAFAIIYVNKSKVQVDLIHIEKDGTFIVSGKSYGRPR*
Ga0105098_1026164813300009081Freshwater SedimentFAIMYVKASNVQVDIINIEKNGNFIVQGKVYGRAR*
Ga0105098_1040390423300009081Freshwater SedimentNWQQAFAIMYVDGKNVQVDLIYLEKDGTFVVAGKRYGRPR*
Ga0105099_1014299613300009082Freshwater SedimentQQAFAIMYVKGKNVQVDLIYIEKNGTFIVNGKVYGRPR*
Ga0114962_1052479813300009151Freshwater LakeFAIMYVHGSTVQVDIINIERNGTFIVQGKVYGRVR*
Ga0114968_1026080713300009155Freshwater LakeNWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR*
Ga0114968_1075595913300009155Freshwater LakeRQAGYVKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0114977_1005585073300009158Freshwater LakeFAIVTEIGKNVQVDLIYVEKDGTFLVHGKRYGRPR*
Ga0114977_1045792113300009158Freshwater LakeFKQARYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRFR*
Ga0114978_1022490633300009159Freshwater LakeAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR*
Ga0114981_1076984113300009160Freshwater LakeNLQQAYAILYDKCSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0114966_1061244213300009161Freshwater LakeMPNWQQAFAIVTEIGKNVQVDLIYVEKDGTFIVSGKRYGRSR*
Ga0114975_1005181583300009164Freshwater LakeEVGNLMSFSAAKYTKGSAQWQQAFAIMYVHNSTVQVDIINIEKNGTFIVAGKVYGRPRR*
Ga0114975_1016050313300009164Freshwater LakeKSAHYTRGTANWQQSISIVTEDAKGVQIDLIYIEKDGTFLVHGKRYGRPR*
Ga0114975_1039839213300009164Freshwater LakeKYVSSPNWQQAFAIVTEHNKNVQVDLIYVEKDGTFLVYGKRYGRAR*
Ga0114975_1041409323300009164Freshwater LakeFAIVTEHNKNVQVDLIYVEKDGTFMVHGKRYGRAR*
Ga0114975_1052038613300009164Freshwater LakeANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0105102_1048663213300009165Freshwater SedimentQQAFAIMYVDGKNVQVDLIYLEKDGTFVVAGKRYGRPR*
Ga0105096_1028771943300009170Freshwater SedimentQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR*
Ga0105096_1047705623300009170Freshwater SedimentQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR*
Ga0114979_1047150733300009180Freshwater LakePNWQQAFAIVKEHGKNVQVDLTHVEKDGTFIVDGKDYGRVR*
Ga0114979_1081562623300009180Freshwater LakeSYTKGTANWQQAFAIMYVKGNNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0114959_1050132133300009182Freshwater LakeWQQAFAIMYVHGSTVQVDIINIEKNGTFIVQGKVYGRIR*
Ga0114974_1059352113300009183Freshwater LakeQARYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0114974_1064398313300009183Freshwater LakeNWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGKAR*
Ga0114974_1071215813300009183Freshwater LakeASYTKGTANWQQAFAIMYVKGNNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0114976_1007917563300009184Freshwater LakeWQQAFAIVTEIGKNVQVDLIYVEKDGTFVVSGKRYGRAR*
Ga0114976_1032328533300009184Freshwater LakeAKYVSTPNWQQAFAIVKEHGKNVQVDLIYVEKDGTFIVDGKVYGRVR*
Ga0114976_1057586613300009184Freshwater LakeQAFAIMYVKGSNVQVDIINIEKNGTFIVQGKVYGRVR*
Ga0114971_1007619613300009185Freshwater LakeANWQQAFAIIYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0114983_114240133300009194Deep SubsurfaceYTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0126448_105963343300009466Meromictic PondTKGVANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRSR*
Ga0133913_1062710183300010885Freshwater LakeMQTTKAGYTHGVMNWQQAFAIMYVHGKNVQVDLIHIEKNGTFIVNGKVHGRVR*
Ga0137575_1000392113300010970Pond Fresh WaterKGVANWQQAFAIMYINKNKVQVDLINIEKDGTFIVAGKSYGRAR*
Ga0139557_101291043300011010FreshwaterAYTKGSANWQQAFAIMYVEGKNVQVDIIYFEKDGTFLVSGKRYGRPR*
Ga0157203_103308723300012663FreshwaterQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR*
Ga0157210_101673143300012665FreshwaterFRQAGYVKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR*
Ga0157210_102622213300012665FreshwaterAKYVSMPNWQQAFAIVTEIGKNVQVDLIYVEKDGTFIVSGKRYGRSR*
Ga0164293_1065702513300013004FreshwaterRQASYTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRIR*
Ga0164293_1106093523300013004FreshwaterYTKGTANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRPR*
Ga0177922_1082098013300013372FreshwaterFKQAAYTKGTANWQQAFAIMYIHNKNVQVDLIYIEKNGTFIVGGKVYGRPR*
Ga0119960_102135913300014811AquaticFPSHDRGSKVQVDLINIEKDGTFIVAGKTYGRAR*
Ga0181347_106668253300017722Freshwater LakeFSKASYTKGSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFLVSGKRYGRPR
Ga0181365_117009033300017736Freshwater LakeWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0181344_111183413300017754Freshwater LakeNWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR
Ga0181343_112639613300017766Freshwater LakeANWQQAFAIIYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR
Ga0181343_115663813300017766Freshwater LakeDFSKASYTKGSANWQQAFAIMYVDGKNVQVDLIYLEKDGTFLVSGKRYGRPR
Ga0181358_1010404123300017774Freshwater LakeSSDLGGIAIVTENGKNVQVDLIYAEKDGTFQVHGRRYGRSR
Ga0181358_125815813300017774Freshwater LakeSANWQQAFAIMYVEGKNVQVDIIYFEKDGTFLVSGKRYGRPR
Ga0181357_133617813300017777Freshwater LakeKASYTKGSANWQQAFAIMYVEGKNVQVDLIYFEKDGTFLVSGKRYGRPR
Ga0181349_105138213300017778Freshwater LakeTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0181349_117861913300017778Freshwater LakeNWQQAFAIMYVDGKNVQVDLIYLEKDGTFLVSGKRYGRPR
Ga0181349_129666413300017778Freshwater LakeRGSAQWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0181346_126905813300017780Freshwater LakeRYTRGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0181346_127148713300017780Freshwater LakeHGVEVGNLMSFSAAKYMRGSAQWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRV
Ga0181348_118087933300017784Freshwater LakeTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0181355_120056623300017785Freshwater LakeMDFKQAHYTKGSANWQQAFAIIYVNKSKVQVDLINIDKDGTFIVSGKSYGRPR
Ga0181355_126527513300017785Freshwater LakeKASYTKGSANWQQAFAVMYVDGKNVQVDLIYIEKDGTFVVSGKRYGRPR
Ga0181355_139444623300017785Freshwater LakeARYTRGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0211731_1154460913300020205FreshwaterYMKGYANWQTGFAVMYVDGNHVSVDLIYMEKDASFIVAGKRYG
Ga0208722_102291833300020537FreshwaterASYTKGSANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVSGKSYGRPR
Ga0208600_105238323300020550FreshwaterGVANWQQAFAIMYVHGNKVQVDLIHIEKDGTFIVAGKSYGRPR
Ga0213920_101017913300021438FreshwaterGVMNWQQAFAVMYVHGKNVQVDLIHIEKNGTFIVQGKVHGRVR
Ga0213921_100381313300021952FreshwaterFAIMYVHEKNVQVDLIHIEKDGTFIVSGKRYGRHR
Ga0213922_111533313300021956FreshwaterWQQCFAIMYVHNKNVQVDLIYIEKNGTFVVNGKVYGRVR
Ga0222712_1026121033300021963Estuarine WaterAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRAR
Ga0228703_113414013300022747FreshwaterFAIMYVKGKNVQTDLIYIEKNGTFIVNGKVYGRVR
Ga0244775_1069367543300024346EstuarineWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR
Ga0244776_1069631033300024348EstuarineQAFSIIYVKGKNVQIDLIYIEKNGTFIVNGKVYGRVR
Ga0244776_1074032233300024348EstuarineGTANWQQAFAIMYVKGKNVQVDLIYIEKDGTFTVQGKVYGRPRNR
Ga0208103_103095913300025436FreshwaterFRQASYTKGTANWQQAFAIMYVHGSSVQVDIINIEKNGTFIVQGKVYGRVR
Ga0208147_107134913300025635AqueousQAAYTKGVANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKTYGRAR
Ga0208644_114997613300025889AqueousANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR
Ga0208644_138568113300025889AqueousASYTKGTANWQQAFAIMYVKSSNVQVDIIHIEKNGTFIVQGKVYGRVR
Ga0208916_1041696433300025896AqueousASYTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR
Ga0208554_1003366103300027212EstuarineAIMYVHNKNVQVDLIYIEKDGTFTVQGKVYGRKRK
Ga0255146_105534933300027396FreshwaterYTRGTANWQQAFAIMYVHGSTIQVDIINIEKNGTFIVQGKIYGRAR
Ga0208133_107997033300027631EstuarineNWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR
Ga0209285_1016645713300027726Freshwater SedimentAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR
Ga0209087_102865213300027734Freshwater LakeQAFAIMYVKGSNVQVDIINIEKNGTFIVQGKVYGRVR
Ga0209087_104910753300027734Freshwater LakeDFKQAHYTKGSANWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR
Ga0209085_128862913300027741Freshwater LakeLMDFRQASYTKGTANWQQAFSIMYVQGNNVQVDIINIEKNGTFIVQGKVHGRVR
Ga0209296_128680933300027759Freshwater LakeHYTKGSANWQQAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR
Ga0209296_134253223300027759Freshwater LakeQAKYVSTPNWQQAFAIVKEHGKNVQVDLIYVEKDGTFIVDGKVYGRVR
Ga0209134_1032958313300027764Freshwater LakeYTHGVMNWQQAFSIIYVKGKNVQVDLIYIEKNGTFIVNGKVYGRPR
Ga0209770_1016766713300027769Freshwater LakeNWQQAFAIMYVHGKNVHVDLIYIEKNGTFIVGGKVYGRPR
Ga0209500_1015212153300027782Freshwater LakeQASYTKGTANWQQAFAIMYVKGNNVQVDIIHIEKNGTFIVQGKVYGRVR
Ga0209246_1032877413300027785Freshwater LakeQAFATIETDGKRVNVQLIYIEKDGTFLVSGRRYGKPR
Ga0209354_1021025633300027808Freshwater LakeQAFAIIYVNKSKVQVDLIHIEKDGTFIVSGKSYGRAR
Ga0209253_1035250613300027900Freshwater Lake SedimentAFAIVTENGKNVQVDLIYIEKDGTFQVHGRRYGRSR
Ga0209191_116246433300027969Freshwater LakeAIMYVKNRNVQVDLIYIEKDGTFTVQGKVYGRARK
Ga0209401_133145713300027971Freshwater LakeYTKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR
Ga0209702_1016720213300027976FreshwaterNLMDSKQAHYMKGSMNWQQAFAIMYTHGKKVQVDIINIEKDGTFIVAGKIYGRAR
(restricted) Ga0247835_107402333300028114FreshwaterYTKGSANWQQAFAIMYVEGKNVQVDLIYLEKDGTFLVSGKRYGRPR
(restricted) Ga0247831_122788913300028559FreshwaterAFAIMYVHGSKVQVDLINIEKDGTFIVSGKSYGRPR
(restricted) Ga0247843_114495233300028569FreshwaterSYTKGSANWQQAFAIMYVDGKNVQVDLIYLEKDGTFVVSGKRYGRPR
(restricted) Ga0247844_107770113300028571FreshwaterQASYTKGTANWQQAFAIMYVKGSSVQVDLINIEKNGTFIVNGKVYGRVR
Ga0315907_1013208473300031758FreshwaterKGTANWQQAFAIMYVKGSNVQVDIIHIEKNGTFIVQGKVYGRVR
Ga0315909_1024591013300031857FreshwaterFAIVKEHGKNVQVDLIYVEKDGTFIVDGKVYGRVR
Ga0315909_1035129013300031857FreshwaterTKGSANWQQAFAIMYVDGKNVQVDIIYLEKDGTFLVSGKRYGRPR
Ga0315903_1007143093300032116FreshwaterKAGYVKGTANWQSGFAIMYVDGKNVQVDLIYLEKDGTFVVAGKRYGRPR
Ga0315903_1104088913300032116FreshwaterAHYTKGSANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR
Ga0334980_0177997_45_2063300033816FreshwaterMDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKGYGRAR
Ga0334982_0206345_826_9543300033981FreshwaterVANWQQAFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR
Ga0334996_0111596_1442_15763300033994FreshwaterKGSANWQQAFAIMYVDGKNVQVDLIYIEKDGTFVVAGKRYGRSR
Ga0334996_0461445_67_2283300033994FreshwaterMDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKTYGRPR
Ga0334986_0594384_2_1213300034012FreshwaterWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVAGKRYGRPR
Ga0335002_0493108_548_6553300034020FreshwaterFAIIYVNKAKVQVDLIHIEKDGTFIVAGKSYGRPR
Ga0334987_0078271_2275_24363300034061FreshwaterMDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKTYGRAR
Ga0334987_0644518_181_3453300034061FreshwaterMDFKQASYTKGTANWQQAFAIMYVQNSTVQVDLINIEKNGTFIVQGKVYGRPRK
Ga0334995_0048339_3189_33503300034062FreshwaterMDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKTYGRGR
Ga0334995_0747356_217_3783300034062FreshwaterMDFSKAGYTKGSANWQQAFAIMYVDGKNVQVDLIYFEKDGTFVVAGKRYGRSR
Ga0335019_0867166_3_1643300034066FreshwaterDFLPGSYYKGTANWQQAFAIMYVQASSVQVDLINIEKNGTFIVQGKVYGRPRK
Ga0335010_0634545_1_1563300034092FreshwaterFKQAAYMKGVGNWQQAFAIIYINKAKVQVDLIHIEKDGTFIVSGKSYGRPR
Ga0335022_0608201_31_1923300034095FreshwaterMNFKQAGYTKGTANWQQAFATIETDGKRVNVQLIYIEKDGTFLVSGRRYGKPR
Ga0335027_0654782_2_1453300034101FreshwaterSYTKGSANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR
Ga0335027_0711782_143_3043300034101FreshwaterMDFSKASYTKGSANWQSGFAIMYVEGKNVQVDLIYLEKDGTFVVAGKRYGRPR
Ga0335035_0243932_888_10493300034105FreshwaterMDFKQAAYMKGVGNWQQAFAIIYINKAKVQVDLIHIEKDGTFIVSGKSYGRPR
Ga0335035_0619751_98_2353300034105FreshwaterMDFKQAAYTKGVANWQQAFAIIYVNKAKVQVDLINIEKDGTFIVA
Ga0335036_0773442_2_1093300034106FreshwaterFAIMYIHGKNVQVDLIYIEKNGTFIVQGKVYGRPR
Ga0335053_0637175_3_1283300034118FreshwaterANWQQAFAIMYVEGKNVQVDLIYIEKDGTFVVSGKRYGRPR
Ga0335056_0451870_2_1603300034120FreshwaterDFKQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKSYGRAR
Ga0335060_0210471_951_11003300034122FreshwaterQAAYTKGVANWQQAFAIMYVHGNKVQVDLINIEKDGTFIVSGKSYGRAR
Ga0335060_0433303_554_6823300034122FreshwaterVANWQQAFAIIYVNKAKVQVDLINIEKDGTFIVAGKSYGRPR
Ga0335065_0640851_1_1203300034200FreshwaterWQQAFAIMYVDGKNVQVDLIYIEKDGTFVVSGKRYGRPR
Ga0335065_0777020_140_3043300034200FreshwaterMDFKQASYTKGTANWQQAFAIMYVHASTVQVDLINIEKNGTFIVQGKVYGRPRK
Ga0335013_0781676_2_1093300034284FreshwaterFAIMYVEGKNVQVDLIYLEKDGTFVVSGKRYGRPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.