NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033050

Metagenome / Metatranscriptome Family F033050

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033050
Family Type Metagenome / Metatranscriptome
Number of Sequences 178
Average Sequence Length 49 residues
Representative Sequence VKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQL
Number of Associated Samples 151
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.30 %
% of genes near scaffold ends (potentially truncated) 51.12 %
% of genes from short scaffolds (< 2000 bps) 63.48 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.640 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(20.225 % of family members)
Environment Ontology (ENVO) Unclassified
(50.562 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.764 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.02%    β-sheet: 36.17%    Coil/Unstructured: 46.81%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 178 Family Scaffolds
PF05164ZapA 32.58
PF018125-FTHF_cyc-lig 28.09
PF05195AMP_N 15.73
PF00585Thr_dehydrat_C 4.49
PF06441EHN 3.93
PF02545Maf 3.93
PF01494FAD_binding_3 2.81
PF00106adh_short 1.12
PF00255GSHPx 1.12
PF14236DUF4338 0.56
PF027373HCDH_N 0.56
PF00830Ribosomal_L28 0.56
PF00903Glyoxalase 0.56
PF08850DUF1820 0.56
PF00561Abhydrolase_1 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 178 Family Scaffolds
COG3027Cell division protein ZapA, inhibits GTPase activity of FtsZCell cycle control, cell division, chromosome partitioning [D] 32.58
COG02125-formyltetrahydrofolate cyclo-ligaseCoenzyme transport and metabolism [H] 28.09
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 15.73
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 5.62
COG1171Threonine deaminaseAmino acid transport and metabolism [E] 4.49
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 3.93
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 3.93
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 2.81
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 2.81
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 2.81
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 1.12
COG0227Ribosomal protein L28Translation, ribosomal structure and biogenesis [J] 0.56
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.56
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.56
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.56
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.56
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.56
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.56
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.56
COG4517Uncharacterized conserved protein, DUF1820 domainFunction unknown [S] 0.56

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.64 %
UnclassifiedrootN/A12.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559017|JCVI_READ_838855Not Available984Open in IMG/M
3300000117|DelMOWin2010_c10000732All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria20963Open in IMG/M
3300000117|DelMOWin2010_c10040058All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2174Open in IMG/M
3300000149|LPaug09P1610mDRAFT_c1003569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2426Open in IMG/M
3300001960|GOS2230_1032042All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1663Open in IMG/M
3300001963|GOS2229_1065392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E4933Open in IMG/M
3300001967|GOS2242_1090086All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1746Open in IMG/M
3300001974|GOS2246_10081213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1708Open in IMG/M
3300002040|GOScombined01_102560970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1840Open in IMG/M
3300002524|JGI24927J35514_1017927All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E545Open in IMG/M
3300003185|JGI26064J46334_1005198All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E2911Open in IMG/M
3300003264|JGI26119J46589_1042257Not Available544Open in IMG/M
3300003427|JGI26084J50262_1001104All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria15294Open in IMG/M
3300003474|NAP4_1029935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1027Open in IMG/M
3300003477|nap3_10071917All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria799Open in IMG/M
3300003477|nap3_10164584Not Available541Open in IMG/M
3300004097|Ga0055584_101283257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria763Open in IMG/M
3300004279|Ga0066605_10003158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A10173Open in IMG/M
3300005239|Ga0073579_1091822All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2916Open in IMG/M
3300005239|Ga0073579_1189471All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A35735Open in IMG/M
3300005400|Ga0066867_10009345All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4277Open in IMG/M
3300005404|Ga0066856_10088296All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1354Open in IMG/M
3300005404|Ga0066856_10230830All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E802Open in IMG/M
3300005427|Ga0066851_10079833All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300005432|Ga0066845_10111537All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300005432|Ga0066845_10312771All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria607Open in IMG/M
3300005432|Ga0066845_10320532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria599Open in IMG/M
3300005523|Ga0066865_10185238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria778Open in IMG/M
3300005593|Ga0066837_10177210All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria767Open in IMG/M
3300005611|Ga0074647_1000289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria31956Open in IMG/M
3300005748|Ga0076925_1023182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A13821Open in IMG/M
3300006024|Ga0066371_10271017All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria531Open in IMG/M
3300006025|Ga0075474_10202946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria607Open in IMG/M
3300006403|Ga0075514_1956053All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300006561|Ga0101389_1009059Not Available503Open in IMG/M
3300006615|Ga0101438_107470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2465Open in IMG/M
3300006621|Ga0101441_103664All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2959Open in IMG/M
3300006637|Ga0075461_10188492All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria621Open in IMG/M
3300006867|Ga0075476_10064561All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1455Open in IMG/M
3300006869|Ga0075477_10010929All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4286Open in IMG/M
3300007236|Ga0075463_10004498All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4694Open in IMG/M
3300007623|Ga0102948_1004080All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A5457Open in IMG/M
3300007715|Ga0102827_1003487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3720Open in IMG/M
3300008253|Ga0105349_10277225Not Available697Open in IMG/M
3300009001|Ga0102963_1026054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2451Open in IMG/M
3300009074|Ga0115549_1151684All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster753Open in IMG/M
3300009104|Ga0117902_1401060All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1216Open in IMG/M
3300009124|Ga0118687_10267020Not Available638Open in IMG/M
3300009132|Ga0118730_1207029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1141Open in IMG/M
3300009132|Ga0118730_1351014All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster685Open in IMG/M
3300009132|Ga0118730_1357517All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster666Open in IMG/M
3300009339|Ga0117928_1161048All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster685Open in IMG/M
3300009496|Ga0115570_10079572All Organisms → cellular organisms → Bacteria1647Open in IMG/M
3300009550|Ga0115013_10798235All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E652Open in IMG/M
3300009703|Ga0114933_10069455All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2527Open in IMG/M
3300009790|Ga0115012_10014582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4844Open in IMG/M
3300009790|Ga0115012_10437961All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1010Open in IMG/M
3300009790|Ga0115012_12061041Not Available507Open in IMG/M
3300012919|Ga0160422_10231707All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1124Open in IMG/M
3300012954|Ga0163111_11303739All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A712Open in IMG/M
3300012954|Ga0163111_11315981All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A709Open in IMG/M
3300012954|Ga0163111_11949752All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A590Open in IMG/M
3300012954|Ga0163111_12659958All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E511Open in IMG/M
3300013116|Ga0171646_1177895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A690Open in IMG/M
3300016727|Ga0182051_1285336All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria902Open in IMG/M
3300016731|Ga0182094_1405209Not Available678Open in IMG/M
3300016737|Ga0182047_1022541All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1104Open in IMG/M
3300016749|Ga0182053_1016116All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2181Open in IMG/M
3300016749|Ga0182053_1321413All Organisms → cellular organisms → Bacteria1970Open in IMG/M
3300017709|Ga0181387_1009386All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1900Open in IMG/M
3300017724|Ga0181388_1000969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A9120Open in IMG/M
3300017726|Ga0181381_1003305All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4225Open in IMG/M
3300017732|Ga0181415_1068284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E804Open in IMG/M
3300017740|Ga0181418_1067907All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E876Open in IMG/M
3300017749|Ga0181392_1174149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A626Open in IMG/M
3300017768|Ga0187220_1147488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E711Open in IMG/M
3300017818|Ga0181565_10016532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A5503Open in IMG/M
3300017824|Ga0181552_10097814All Organisms → cellular organisms → Bacteria1632Open in IMG/M
3300017824|Ga0181552_10316151All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria766Open in IMG/M
3300017824|Ga0181552_10483290Not Available585Open in IMG/M
3300017950|Ga0181607_10006032All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria10188Open in IMG/M
3300017950|Ga0181607_10043920All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3088Open in IMG/M
3300017952|Ga0181583_10000557All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A27229Open in IMG/M
3300017956|Ga0181580_10759924All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E613Open in IMG/M
3300018041|Ga0181601_10122895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1635Open in IMG/M
3300018048|Ga0181606_10022544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4682Open in IMG/M
3300018048|Ga0181606_10436598All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A694Open in IMG/M
3300018049|Ga0181572_10393349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A867Open in IMG/M
3300018415|Ga0181559_10682739Not Available551Open in IMG/M
3300018876|Ga0181564_10002566All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A15761Open in IMG/M
3300019459|Ga0181562_10071685All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2043Open in IMG/M
3300019765|Ga0194024_1051228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria915Open in IMG/M
3300020165|Ga0206125_10274295Not Available637Open in IMG/M
3300020174|Ga0181603_10074488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1651Open in IMG/M
3300020177|Ga0181596_10018248All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A5075Open in IMG/M
3300020178|Ga0181599_1010123All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A6392Open in IMG/M
3300020178|Ga0181599_1046310All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2208Open in IMG/M
3300020188|Ga0181605_10448115Not Available500Open in IMG/M
3300020189|Ga0181578_10194632All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1017Open in IMG/M
3300020191|Ga0181604_10013468All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5813Open in IMG/M
3300020194|Ga0181597_10032979All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A3528Open in IMG/M
3300020238|Ga0211492_1022687All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300020247|Ga0211654_1064473Not Available549Open in IMG/M
3300020276|Ga0211509_1000630All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria7760Open in IMG/M
3300020305|Ga0211513_1072091Not Available513Open in IMG/M
3300020314|Ga0211522_1001978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A5894Open in IMG/M
3300020319|Ga0211517_1053812All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A792Open in IMG/M
3300020343|Ga0211626_1027191All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1561Open in IMG/M
3300020366|Ga0211489_10177662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria595Open in IMG/M
3300020385|Ga0211677_10118334All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1145Open in IMG/M
3300020406|Ga0211668_10367626Not Available542Open in IMG/M
3300020438|Ga0211576_10144386All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300020451|Ga0211473_10354816All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A751Open in IMG/M
3300020452|Ga0211545_10106121All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300020453|Ga0211550_10158038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1067Open in IMG/M
3300020454|Ga0211548_10572039Not Available553Open in IMG/M
3300020470|Ga0211543_10020398All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A3721Open in IMG/M
3300020472|Ga0211579_10031131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A3405Open in IMG/M
3300020475|Ga0211541_10193889All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300021087|Ga0206683_10115270All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300021087|Ga0206683_10311483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A802Open in IMG/M
3300021089|Ga0206679_10026901All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A3638Open in IMG/M
3300021371|Ga0213863_10018284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4093Open in IMG/M
3300021375|Ga0213869_10256197All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria763Open in IMG/M
3300021379|Ga0213864_10005591All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A5508Open in IMG/M
3300021958|Ga0222718_10007850All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria8273Open in IMG/M
3300021959|Ga0222716_10265558All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300021959|Ga0222716_10653842Not Available565Open in IMG/M
3300021961|Ga0222714_10343098All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria805Open in IMG/M
3300022900|Ga0255771_1059601All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2040Open in IMG/M
3300022905|Ga0255756_1007136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A9855Open in IMG/M
3300022909|Ga0255755_1092531All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300022928|Ga0255758_10026216All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3766Open in IMG/M
(restricted) 3300022933|Ga0233427_10019421All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B4242Open in IMG/M
3300023105|Ga0255782_10005086All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria9384Open in IMG/M
(restricted) 3300023109|Ga0233432_10020640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4811Open in IMG/M
3300023180|Ga0255768_10042104All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A3472Open in IMG/M
3300023709|Ga0232122_1002522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4803Open in IMG/M
3300023709|Ga0232122_1009301All Organisms → cellular organisms → Bacteria2658Open in IMG/M
3300024314|Ga0228657_1116783All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E522Open in IMG/M
3300024326|Ga0228652_1148657Not Available501Open in IMG/M
3300024420|Ga0228632_1009694All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2164Open in IMG/M
3300025630|Ga0208004_1007738All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3703Open in IMG/M
3300025673|Ga0209494_1169694Not Available617Open in IMG/M
3300025696|Ga0209532_1093714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1047Open in IMG/M
3300025809|Ga0209199_1222145All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A639Open in IMG/M
3300025897|Ga0209425_10095608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1779Open in IMG/M
3300026123|Ga0209955_1003370All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4466Open in IMG/M
3300026200|Ga0208894_1000869All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A19418Open in IMG/M
3300026258|Ga0208130_1027022All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1965Open in IMG/M
3300026260|Ga0208408_1003670All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A7795Open in IMG/M
3300026266|Ga0208410_1022595All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1999Open in IMG/M
3300026266|Ga0208410_1074472All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria889Open in IMG/M
3300026268|Ga0208641_1023119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2117Open in IMG/M
3300026491|Ga0228641_1010073All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2667Open in IMG/M
3300026495|Ga0247571_1149854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E550Open in IMG/M
3300027553|Ga0208947_1012425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2546Open in IMG/M
3300027572|Ga0208964_1043117All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1082Open in IMG/M
3300027702|Ga0209036_1006196All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A4658Open in IMG/M
3300027709|Ga0209228_1030155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1999Open in IMG/M
3300027774|Ga0209433_10317421All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A582Open in IMG/M
3300027859|Ga0209503_10699309Not Available507Open in IMG/M
3300028111|Ga0233397_1076022All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E889Open in IMG/M
3300028124|Ga0228621_1057254All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E575Open in IMG/M
3300028133|Ga0228609_1128680All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E634Open in IMG/M
3300028137|Ga0256412_1318186All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E572Open in IMG/M
3300028197|Ga0257110_1029970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A2418Open in IMG/M
3300028273|Ga0228640_1077318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A649Open in IMG/M
3300031766|Ga0315322_10046373All Organisms → cellular organisms → Bacteria3201Open in IMG/M
3300031766|Ga0315322_10562194All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E736Open in IMG/M
3300031775|Ga0315326_10422028All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria864Open in IMG/M
3300031775|Ga0315326_10709302All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E632Open in IMG/M
3300031851|Ga0315320_10185760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1539Open in IMG/M
3300031886|Ga0315318_10435984All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A749Open in IMG/M
3300032073|Ga0315315_10222605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E1760Open in IMG/M
3300032073|Ga0315315_10231500Not Available1724Open in IMG/M
3300032073|Ga0315315_10524502All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1096Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh20.22%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine14.04%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.67%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.30%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater6.74%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.93%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.37%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.25%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.69%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.69%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.69%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.69%
EstuarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine1.69%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.12%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water1.12%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm1.12%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water1.12%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.56%
Environmental And Host-AssociatedEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated0.56%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.56%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.56%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.56%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.56%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.56%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.56%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment0.56%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.56%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559017Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573)EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000149Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10mEnvironmentalOpen in IMG/M
3300001960Marine microbial communities from South of Charleston, South Carolina, USA - GS014EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300001967Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027EnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300002524Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35EnvironmentalOpen in IMG/M
3300003185Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LVEnvironmentalOpen in IMG/M
3300003264Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10EnvironmentalOpen in IMG/M
3300003427Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNAEnvironmentalOpen in IMG/M
3300003474Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4EnvironmentalOpen in IMG/M
3300003477Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005400Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261EnvironmentalOpen in IMG/M
3300005404Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205EnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005593Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86EnvironmentalOpen in IMG/M
3300005611Saline surface water microbial communities from Etoliko Lagoon, GreeceEnvironmentalOpen in IMG/M
3300005748Seawater microbial communities from Vineyard Sound, MA, USA - control T7EnvironmentalOpen in IMG/M
3300006024Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_BEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006561Marine microbial communities from the Black Sea in Odessa region - Od_1EnvironmentalOpen in IMG/M
3300006615Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ04 time pointEnvironmentalOpen in IMG/M
3300006621Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time pointEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007623Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MGEnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300008253Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson CanyonEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009104Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2umEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009132Combined Assembly of Gp0139359, Gp0139510EnvironmentalOpen in IMG/M
3300009339Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013116Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020174Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020188Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020189Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020238Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556004-ERR599068)EnvironmentalOpen in IMG/M
3300020247Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962)EnvironmentalOpen in IMG/M
3300020276Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858)EnvironmentalOpen in IMG/M
3300020305Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX556024-ERR599003)EnvironmentalOpen in IMG/M
3300020314Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556135-ERR598974)EnvironmentalOpen in IMG/M
3300020319Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073)EnvironmentalOpen in IMG/M
3300020343Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174)EnvironmentalOpen in IMG/M
3300020366Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020406Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024314Seawater microbial communities from Monterey Bay, California, United States - 70DEnvironmentalOpen in IMG/M
3300024326Seawater microbial communities from Monterey Bay, California, United States - 64DEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025673Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026123Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026200Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 (SPAdes)EnvironmentalOpen in IMG/M
3300026258Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes)EnvironmentalOpen in IMG/M
3300026260Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes)EnvironmentalOpen in IMG/M
3300026266Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes)EnvironmentalOpen in IMG/M
3300026268Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes)EnvironmentalOpen in IMG/M
3300026491Seawater microbial communities from Monterey Bay, California, United States - 52DEnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027553Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027572Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027702Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - DCM_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027709Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_150m (SPAdes)EnvironmentalOpen in IMG/M
3300027774Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028111Seawater microbial communities from Monterey Bay, California, United States - 35DEnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028133Seawater microbial communities from Monterey Bay, California, United States - 10DEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028273Seawater microbial communities from Monterey Bay, California, United States - 51DEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300031886Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Ocean5-_014010602166559017Environmental And Host-AssociatedVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKNDYRSFG
DelMOWin2010_10000732253300000117MarineSSLPEPKAQVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE*
DelMOWin2010_1004005833300000117MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID*
LPaug09P1610mDRAFT_100356933300000149MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTDIID*
GOS2230_103204243300001960MarineVKLILHQASLSGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLINKRRLF*
GOS2229_106539253300001963MarineVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVNYIIDE*
GOS2242_109008623300001967MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNMIINQLILKREGYFN*
GOS2246_1008121343300001974MarineVVKLLLHQASLNGSAQQQQWKITLKYIIGSKNLDKLANEPVMLIISYLI*
GOScombined01_10256097013300002040MarineVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKNDYRSFG*
JGI24927J35514_101792713300002524MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKLIINQLLLKREDYFN*
JGI26064J46334_100519823300003185MarineVVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID*
JGI26119J46589_104225723300003264MarineMLYQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSISIKHF
JGI26084J50262_100110473300003427MarineVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE*
NAP4_102993533300003474EstuarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN*
nap3_1007191733300003477EstuarineLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN*
nap3_1016458423300003477EstuarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID*
Ga0055584_10128325733300004097Pelagic MarineHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE*
Ga0066605_1000315873300004279MarineVVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID*
Ga0073579_109182243300005239MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREVYFN*
Ga0073579_118947133300005239MarineVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTDIID*
Ga0066867_1000934553300005400MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF*
Ga0066856_1008829633300005404MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR*
Ga0066856_1023083013300005404MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKEDYFNQGIVQFLK*
Ga0066851_1007983323300005427MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF*
Ga0066845_1011153723300005432MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR*
Ga0066845_1031277113300005432MarineVVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEP
Ga0066845_1032053213300005432MarineKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDCIIDQLIYKRRLF*
Ga0066865_1018523813300005523MarineGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID*
Ga0066837_1017721023300005593MarineVVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF*
Ga0074647_100028953300005611Saline Water And SedimentVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVSYIIDE*
Ga0076925_1023182103300005748MarineVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID*
Ga0066371_1027101713300006024MarineHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR*
Ga0075474_1020294623300006025AqueousVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPV
Ga0075514_195605323300006403AqueousVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVSYIIDE*
Ga0101389_100905923300006561MarineVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE*
Ga0101438_10747053300006615Marine Surface WaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLIYKRRLF*
Ga0101441_10366443300006621Marine Surface WaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFN*
Ga0075461_1018849213300006637AqueousLHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE*
Ga0075476_1006456113300006867AqueousKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVSYIIDE*
Ga0075477_1001092973300006869AqueousLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID*
Ga0075463_1000449873300007236AqueousQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVSYIIDE*
Ga0102948_100408023300007623WaterMLHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE*
Ga0102827_100348753300007715EstuarineMLYQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSISI
Ga0105349_1027722523300008253Methane Seep MesocosmVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKLIINQLILKREDYFN*
Ga0102963_102605453300009001Pond WaterMLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREVYFN*
Ga0115549_115168413300009074Pelagic MarineEPKAQVVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID*
Ga0117902_140106023300009104MarineVKLILHQASLNGNAQQQQWKITYKYIIGSKNLDKLANEPVDYIIDQLIYKRRYF*
Ga0118687_1026702023300009124SedimentVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTYIID*
Ga0118730_120702913300009132MarineASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLIYKRRLF*
Ga0118730_135101433300009132MarineKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR*
Ga0118730_135751733300009132MarineASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLTYKRRLF*
Ga0117928_116104833300009339MarineKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLIYKRRLF*
Ga0115570_1007957233300009496Pelagic MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFNL
Ga0115013_1079823513300009550MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVN
Ga0114933_1006945533300009703Deep SubsurfaceVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKSDYRSFG*
Ga0115012_1001458213300009790MarineVAKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKL
Ga0115012_1043796113300009790MarineLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLIYKRRLF*
Ga0115012_1206104133300009790MarineASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNSIINQLKLKRRLF*
Ga0160422_1023170743300012919SeawaterKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID*
Ga0163109_1002359413300012936Surface SeawaterLSLPEPKAQVVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID*
Ga0163111_1130373933300012954Surface SeawaterVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNMIINQLILKREGYFN*
Ga0163111_1131598113300012954Surface SeawaterQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF*
Ga0163111_1194975213300012954Surface SeawaterQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFN*
Ga0163111_1265995813300012954Surface SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEP
Ga0171646_117789533300013116MarineVKLILHQASLNGNAQQQQWKITFNYIIGSKNLDKLANEPVDYIIDQLIYKRRLF*
Ga0182051_128533633300016727Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDE
Ga0182094_140520923300016731Salt MarshVKLILHQASLNGSAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0182047_102254113300016737Salt MarshLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVNYIIDE
Ga0182053_101611613300016749Salt MarshKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLASEPVDYIIDE
Ga0182053_132141313300016749Salt MarshVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVNLIINQLILKREDYFNLGTSQSLKQ
Ga0181387_100938643300017709SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREVYFN
Ga0181388_100096973300017724SeawaterVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREGYFN
Ga0181381_100330573300017726SeawaterMLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0181415_106828423300017732SeawaterVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0181418_106790713300017740SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLISKREDYFNLGTSQSLK
Ga0181392_117414913300017749SeawaterQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSLIINQLILKREGYFN
Ga0187220_114748823300017768SeawaterVKLVLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREGYFN
Ga0181565_1001653273300017818Salt MarshVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0181552_1009781423300017824Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0181552_1031615113300017824Salt MarshQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREEYFN
Ga0181552_1048329033300017824Salt MarshVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRRQF
Ga0181607_1000603283300017950Salt MarshVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0181607_1004392033300017950Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDL
Ga0181583_1000055783300017952Salt MarshVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0181580_1075992423300017956Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFNLGTSQFLKQ
Ga0181601_1012289543300018041Salt MarshQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0181606_1002254413300018048Salt MarshVVKFILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVD
Ga0181606_1043659813300018048Salt MarshQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLL
Ga0181572_1039334913300018049Salt MarshLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0181559_1068273933300018415Salt MarshILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0181564_1000256623300018876Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR
Ga0181562_1007168533300019459Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRRQF
Ga0194024_105122813300019765FreshwaterHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0206125_1027429523300020165SeawaterVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0181603_1007448833300020174Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0181596_1001824813300020177Salt MarshVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDL
Ga0181599_101012373300020178Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQL
Ga0181599_104631053300020178Salt MarshHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0181605_1044811523300020188Salt MarshVKLILHQASLNGIAQQQQWKITFKLIIGSKNLDKLANEPVNYIINE
Ga0181578_1019463223300020189Salt MarshVVKFILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0181604_10013468103300020191Salt MarshHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDL
Ga0181597_1003297913300020194Salt MarshVKLILHQASLNSNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0211492_102268733300020238MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPV
Ga0211654_106447313300020247MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFN
Ga0211509_100063023300020276MarineVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKSDYRSFG
Ga0211513_107209113300020305MarineKGQVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKNDYRSFG
Ga0211522_100197863300020314MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR
Ga0211517_105381213300020319MarineEPKAQVVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID
Ga0211626_102719123300020343MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKNDYRSFG
Ga0211489_1017766213300020366MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYK
Ga0211677_1011833443300020385MarineNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREGYFN
Ga0211668_1036762633300020406MarineQVVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID
Ga0211576_1014438633300020438MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREGYFN
Ga0211473_1035481633300020451MarinePKGQVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKNDYRSFG
Ga0211545_1010612113300020452MarineVAKLILHQASLNGNAQQQQWKITFKYIIGSKNLDK
Ga0211550_1015803813300020453MarineLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID
Ga0211548_1057203913300020454MarineEPKAQVVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVHYIID
Ga0211543_1002039843300020470MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVDYIIDQLIYKRRLF
Ga0211579_1003113143300020472MarineVAKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIIDHLTYKRRLF
Ga0211541_1019388933300020475MarineVAKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLAN
Ga0206683_1011527033300021087SeawaterVKLLLHQASLKGNAQQQQWKITLKYIIGSKNLDKLAN
Ga0206683_1031148333300021087SeawaterVKLILHQASLNGIAQQQQWKITFKYIIGSKNLDKLANEPVSLIINQLILKREGYFN
Ga0206679_1002690143300021089SeawaterMLYQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFN
Ga0213863_1001828453300021371SeawaterVVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0213869_1025619733300021375SeawaterHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0213864_1000559183300021379SeawaterVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVNYIIDE
Ga0222718_1000785083300021958Estuarine WaterMLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLI
Ga0222716_1026555813300021959Estuarine WaterVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVNYII
Ga0222716_1065384223300021959Estuarine WaterMLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREVYFN
Ga0222714_1034309833300021961Estuarine WaterVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVSYIIDE
Ga0255771_105960113300022900Salt MarshLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0255756_100713673300022905Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREEYFN
Ga0255755_109253113300022909Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLI
Ga0255758_1002621613300022928Salt MarshVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLA
(restricted) Ga0233427_1001942183300022933SeawaterVLYQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSISIK
Ga0255782_1000508673300023105Salt MarshVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVNYIIDE
(restricted) Ga0233432_1002064013300023109SeawaterMLYQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSISIK
Ga0255768_1004210413300023180Salt MarshAQVVKFILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0232122_100252273300023709Salt MarshVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVTNIID
Ga0232122_100930113300023709Salt MarshVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVD
Ga0228657_111678323300024314SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKR
Ga0228652_114865713300024326SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLKLKRRLF
Ga0228632_100969413300024420SeawaterYELILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0208004_100773823300025630AqueousVKLLLHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVTNIID
Ga0209494_116969413300025673Methane Seep MesocosmVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKLIINQLILKREDYFN
Ga0209532_109371443300025696Pelagic MarineASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0209199_122214533300025809Pelagic MarineKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTNIID
Ga0209425_1009560813300025897Pelagic MarineLPEPKAQVVKLILHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0209955_100337043300026123WaterMLHQASLNGNAQQQQWKITFKLIIGSKNLDKLANEPVDYIIDE
Ga0208894_100086933300026200MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF
Ga0208130_102702243300026258MarineVAKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR
Ga0208408_1003670113300026260MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF
Ga0208410_102259513300026266MarineASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVGYIIDQLIYKRR
Ga0208410_107447213300026266MarineASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFN
Ga0208641_102311953300026268MarineSLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF
Ga0228641_101007313300026491SeawaterHQAPLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYFN
Ga0247571_114985423300026495SeawaterVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLALD
Ga0208947_101242533300027553MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREEYFN
Ga0208964_104311733300027572MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQ
Ga0209036_100619663300027702MarineVAKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFN
Ga0209228_103015513300027709MarineVKLLLHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVKFIISHLILKSHHSIIKEDL
Ga0209433_1031742113300027774MarineVVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVKYIID
Ga0209503_1069930933300027859MarineVVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLKLKRRLF
Ga0233397_107602213300028111SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREGYF
Ga0228621_105725413300028124SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKL
Ga0228609_112868023300028133SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLIL
Ga0256412_131818623300028137SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREDYFNLGTFQSLKQ
Ga0257110_102997043300028197MarineVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVTDIID
Ga0228640_107731833300028273SeawaterLNGNAQQHQWKITFKYIIGSKNIDKLANEPVNLIINQLLLKREDYFN
Ga0315322_1004637313300031766SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLAHEPVNLIINQLILKREGYFN
Ga0315322_1056219423300031766SeawaterVKLILHQASLNGIAQQQQWKITFKYIIGSKNLDKLANEP
Ga0315326_1042202843300031775SeawaterHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNHIIDQLISKRRLF
Ga0315326_1070930213300031775SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLLLKREDYF
Ga0315320_1018576043300031851SeawaterHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSLIINQLILKREGYFN
Ga0315318_1043598433300031886SeawaterQVVKLLLHQASLKGNAQQQQWKITLKYIIGSKNLDKLANEPVKLIISYLI
Ga0315315_1022260533300032073SeawaterVKLILHQASLDGNAQQQQWKITFKYIIGSKNLDKLANEPVNLIINQLILKREVYFN
Ga0315315_1023150043300032073SeawaterASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVNYIID
Ga0315315_1052450213300032073SeawaterVKLILHQASLNGNAQQQQWKITFKYIIGSKNLDKLANEPVSLIINQLILKREGYFN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.