NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033053

Metagenome / Metatranscriptome Family F033053

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033053
Family Type Metagenome / Metatranscriptome
Number of Sequences 178
Average Sequence Length 68 residues
Representative Sequence MNEATSRAAASEVLGTHKGLSGAALSSYLDTYFAKAWAHFDVNRTGAVEVIKMPQFMRFLASDQYMSLGE
Number of Associated Samples 114
Number of Associated Scaffolds 178

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 50.89 %
% of genes near scaffold ends (potentially truncated) 25.84 %
% of genes from short scaffolds (< 2000 bps) 94.94 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.76

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.258 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(35.955 % of family members)
Environment Ontology (ENVO) Unclassified
(72.472 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.270 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.94%    β-sheet: 2.04%    Coil/Unstructured: 51.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.76
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.128.1.0: automated matchesd5nx7a15nx70.64639
a.69.2.1: Ypt/Rab-GAP domain of gyp1pd2g77a12g770.63973
a.149.1.1: RNase III catalytic domain-liked2ez6a12ez60.63769
c.37.1.1: Nucleotide and nucleoside kinasesd1deka_1dek0.62792
e.58.1.1: Viral ssDNA binding proteind1urja_1urj0.62789

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.26 %
UnclassifiedrootN/A6.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10226481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300001846|ACM22_1088972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300002776|Ga0005234J37281_1039564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300002776|Ga0005234J37281_1042539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300005516|Ga0066831_10060700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1022Open in IMG/M
3300005516|Ga0066831_10079900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum885Open in IMG/M
3300005516|Ga0066831_10148210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300005608|Ga0066840_10083028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300006399|Ga0075495_1576515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300007513|Ga0105019_1140725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1264Open in IMG/M
3300007513|Ga0105019_1209390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium951Open in IMG/M
3300007760|Ga0105018_1091717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1125Open in IMG/M
3300008832|Ga0103951_10489679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae664Open in IMG/M
3300008958|Ga0104259_1029543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300009022|Ga0103706_10215468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300009023|Ga0103928_10123830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum850Open in IMG/M
3300009028|Ga0103708_100092364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300009028|Ga0103708_100146841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300009071|Ga0115566_10495083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300009071|Ga0115566_10581830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300009263|Ga0103872_1053632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium595Open in IMG/M
3300009268|Ga0103874_1022046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300009274|Ga0103878_1044121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300009276|Ga0103879_10053688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300009279|Ga0103880_10044847All Organisms → cellular organisms → Eukaryota617Open in IMG/M
3300009402|Ga0103742_1058166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300009422|Ga0114998_10272746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium795Open in IMG/M
3300009432|Ga0115005_11444027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300009436|Ga0115008_10332044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1079Open in IMG/M
3300009436|Ga0115008_10699796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300009436|Ga0115008_10791537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300009441|Ga0115007_10909689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300009495|Ga0115571_1272082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300009550|Ga0115013_11478456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300009677|Ga0115104_10448483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium722Open in IMG/M
3300009679|Ga0115105_10694707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300009679|Ga0115105_10739189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300009679|Ga0115105_10954691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300009679|Ga0115105_11010178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300009679|Ga0115105_11170715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300009679|Ga0115105_11257558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium547Open in IMG/M
3300009679|Ga0115105_11440162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300009705|Ga0115000_10562743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300009785|Ga0115001_10597813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300009790|Ga0115012_11430175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300010354|Ga0129333_11508988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300010981|Ga0138316_10460586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300010981|Ga0138316_11225489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300010985|Ga0138326_10021652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium503Open in IMG/M
3300010985|Ga0138326_10496573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300010987|Ga0138324_10284598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum787Open in IMG/M
3300010987|Ga0138324_10323832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium741Open in IMG/M
3300010987|Ga0138324_10514392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300010987|Ga0138324_10649233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300012415|Ga0138263_1255731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300012416|Ga0138259_1563980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium788Open in IMG/M
3300012952|Ga0163180_10363058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1048Open in IMG/M
3300012952|Ga0163180_11007188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300012952|Ga0163180_11470951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300012953|Ga0163179_10450202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1055Open in IMG/M
3300016689|Ga0182050_1054077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300016754|Ga0182072_1265162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300016781|Ga0182063_1308256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300017962|Ga0181581_10846898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300018515|Ga0192960_107860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300018645|Ga0193071_1008663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300018646|Ga0192895_1021469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300018666|Ga0193159_1031674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300018692|Ga0192944_1064633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300018725|Ga0193517_1049124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300018765|Ga0193031_1053680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium673Open in IMG/M
3300018765|Ga0193031_1063167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018765|Ga0193031_1064837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium616Open in IMG/M
3300018765|Ga0193031_1079547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300018779|Ga0193149_1042328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium648Open in IMG/M
3300018796|Ga0193117_1063063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300018855|Ga0193475_1049545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300018882|Ga0193471_1071212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300018928|Ga0193260_10073717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium739Open in IMG/M
3300018928|Ga0193260_10119534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300018968|Ga0192894_10278341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300018968|Ga0192894_10299683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300018968|Ga0192894_10299776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300018968|Ga0192894_10318909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300018975|Ga0193006_10151534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium691Open in IMG/M
3300018975|Ga0193006_10188868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300018980|Ga0192961_10136697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium747Open in IMG/M
3300018982|Ga0192947_10176305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300018982|Ga0192947_10274220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018983|Ga0193017_10158365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium742Open in IMG/M
3300018983|Ga0193017_10210630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300018983|Ga0193017_10262833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium525Open in IMG/M
3300018989|Ga0193030_10143548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300018989|Ga0193030_10145829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum763Open in IMG/M
3300018989|Ga0193030_10145842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum763Open in IMG/M
3300018989|Ga0193030_10223674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium619Open in IMG/M
3300018989|Ga0193030_10257546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300019022|Ga0192951_10416107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300019031|Ga0193516_10173901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300019031|Ga0193516_10196445All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium670Open in IMG/M
3300019031|Ga0193516_10295517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300019033|Ga0193037_10304535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300019039|Ga0193123_10407578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300019051|Ga0192826_10263269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium634Open in IMG/M
3300019051|Ga0192826_10367763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300019051|Ga0192826_10376169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300019054|Ga0192992_10250628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019095|Ga0188866_1023556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300019111|Ga0193541_1072879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300019118|Ga0193157_1017004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium723Open in IMG/M
3300019118|Ga0193157_1025998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium605Open in IMG/M
3300019118|Ga0193157_1026853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium596Open in IMG/M
3300019118|Ga0193157_1034211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300019118|Ga0193157_1035390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300019118|Ga0193157_1037143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300019125|Ga0193104_1030012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium749Open in IMG/M
3300019133|Ga0193089_1143341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300020252|Ga0211696_1044308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300020436|Ga0211708_10233437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum742Open in IMG/M
3300021342|Ga0206691_1048727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300021342|Ga0206691_1084522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300021345|Ga0206688_10098851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium594Open in IMG/M
3300021345|Ga0206688_10154106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300021345|Ga0206688_10453812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum735Open in IMG/M
3300021345|Ga0206688_10959615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium755Open in IMG/M
3300021348|Ga0206695_1056743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300021348|Ga0206695_1276639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300021348|Ga0206695_1417918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300021353|Ga0206693_1269522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300021353|Ga0206693_1927982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300021365|Ga0206123_10148928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1073Open in IMG/M
3300021365|Ga0206123_10461118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300021876|Ga0063124_111807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021902|Ga0063086_1015271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300021928|Ga0063134_1139142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300021957|Ga0222717_10160375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1362Open in IMG/M
3300021957|Ga0222717_10659509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300025869|Ga0209308_10269008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300026182|Ga0208275_1038751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum972Open in IMG/M
3300026182|Ga0208275_1044200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum899Open in IMG/M
3300026437|Ga0247577_1059312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300026443|Ga0247559_1092169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300026462|Ga0247568_1092002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300027849|Ga0209712_10739278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300028109|Ga0247582_1171849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300028575|Ga0304731_10736853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300030699|Ga0307398_10836024Not Available507Open in IMG/M
3300030702|Ga0307399_10451749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300030720|Ga0308139_1035330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium740Open in IMG/M
3300030720|Ga0308139_1078961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300030721|Ga0308133_1045393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300030722|Ga0308137_1065225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300030750|Ga0073967_12049753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300031569|Ga0307489_10365930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium951Open in IMG/M
3300031580|Ga0308132_1091106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium627Open in IMG/M
3300031580|Ga0308132_1105924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300031580|Ga0308132_1116106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300031622|Ga0302126_10234392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300031710|Ga0307386_10522461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300031710|Ga0307386_10550151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium607Open in IMG/M
3300031710|Ga0307386_10676999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium550Open in IMG/M
3300031735|Ga0307394_10244265Not Available709Open in IMG/M
3300031738|Ga0307384_10326747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300031738|Ga0307384_10430366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium618Open in IMG/M
3300031739|Ga0307383_10475128Not Available621Open in IMG/M
3300031739|Ga0307383_10567048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300032088|Ga0315321_10540158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300032517|Ga0314688_10204839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1009Open in IMG/M
3300032732|Ga0314711_10496526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine35.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater8.43%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.25%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.25%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.81%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.81%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.81%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.81%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.69%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.69%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.12%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.12%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.56%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.56%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.56%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.56%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.56%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.56%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.56%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.56%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.56%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001846Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25bEnvironmentalOpen in IMG/M
3300002776Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300016689Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011509AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018645Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002739 (ERX1789677-ERR1719371)EnvironmentalOpen in IMG/M
3300018646Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782189-ERR1712202)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300020252Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX555968-ERR599022)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021876Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-18 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026437Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 34R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1022648113300000128MarineAAAAEVLATHKGETGSAYLDTYFDKAFGHFDVNRTGEIEVIKMPQFMRFLASDQYMQLGESGQK*
BBAY83_1008606623300001263Macroalgal SurfaceMDEAAARAASHEVLDTHRHLTGKAREDYLNTYFKRTWAHFDVNQTGKIEVIKMPQFERFLCSDQQMYLW*LHQYEQVYLS*
ACM22_108897213300001846Marine PlanktonASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0005234J37281_103956413300002776MarineMNAVTMRAAASEVLCTHKGLCGAKLASYLDTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0005234J37281_104253923300002776MarineMNANTMRAASSEVLCTHKGLCGAKLQSYLDTYFEKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0066831_1006070023300005516MarineMNEATARAAASEVLATHKGLKGDALEKYLGTYFAKAWGHFDVNRTGTIEVIKMPQFMRFLASD*
Ga0066831_1007990023300005516MarineMNEATARSAAGEVLETHKGLKGDTLQKYLDTYFAKAWGHFDVNRTGMVEVIKMPQFMRFLASDQYMPLQP*
Ga0066831_1014821013300005516MarineGHFWMNEATTRAAAGEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0066840_1008302823300005608MarineGGEPSGKFWMNQASSLAAAKEVLATHKGMSGKILDDYITTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0075495_157651513300006399AqueousMDEFASKAAASEVLCTHKKICGDELTTYLDQYFSKAWGHFDVNRTGYVEVIKMPQFMRFLASDQYFSLQP*
Ga0105019_114072523300007513MarineMNEATTRAASAEVLGTHKGLAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQLMRFLASDQYMSLQP*
Ga0105019_120939013300007513MarineMRAAASEVLCTHKGLCGAGLTGYLDTYFAKAWGHFDVNKTGEIEVIKSPQFMRFLASD*
Ga0105018_109171713300007760MarineMNETTARSAASEVLGTHKGLKGAALQSYLDTYFAKAWAHFDVNRTGTIEVIKMP*
Ga0103951_1048967923300008832MarineMSESEMKAAAKEVLCTHKAICGPALATYLDTYWAKAWGHFDVNRTGSVEVIKSPQLMRFLASDQYMSLQ*
Ga0104259_102954323300008958Ocean WaterMTEAATRAAASEVLETHKGLSGAAKEAYLNTYFAKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP*
Ga0104258_106983013300008993Ocean WaterMDEATTRAAASEVLETHKNLKGDEKKKYLDTYFARTFAHFDVTKDGKIDVIKMPQFMRFLAS
Ga0103706_1021546823300009022Ocean WaterMNEAGAKGAAKEVLATHKGMSGDAAKEYIATYFPRTWAHFDVNGAGVVEVIKMPQFMRFLASDQR
Ga0103928_1012383023300009023Coastal WaterMQADGLTYWSCTCNCAAAKEVLQGHKGLSGKELDAYITTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0103708_10009236423300009028Ocean WaterMNHATTLAAAKEVLNTHKGLSGKLLDDYINTYFAKAWGHFDVNQTGYVEVIKMPQLMRFLCSDQYMQLGESG*
Ga0103708_10014684123300009028Ocean WaterNGVFTMTEAQTKAAATEVLGTHKGLTGAAAQAYLDTYFAKAWVHFDVNLSGEIEVIKMPQFMRFLASDQYMSLQ*
Ga0115566_1049508313300009071Pelagic MarineVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0115566_1058183023300009071Pelagic MarineMNEATTRAAAAEVLETHKGLKGDDLKLYLDTYFSKAWGHFDVNRVGYVEVIKMPQLMRFLASDQYFSLQP*
Ga0103872_105363213300009263Surface Ocean WaterLDEANARAASSEVLDTHKGLKGAARETYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW*
Ga0103874_102204613300009268Surface Ocean WaterNHASTLAAAREVLGTHKGLSGKMLDDYINTYFEKAWGHFDVNQTGFVEVIKMPQFMRFLCSDQYMQLGESG*
Ga0103878_104412113300009274Surface Ocean WaterKSTTLAAAKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNQSGKVDVIKMPQFMRFLASDQYMSLGESG*
Ga0103879_1005368813300009276Surface Ocean WaterDKATTKAAASEVLATHKGLSGIAQKAYLDTYFDKAWKHFDVNQSGTVEVIKMPQFMRFLCSDQYMSLGESA*
Ga0103880_1004484723300009279Surface Ocean WaterAAAAEVLATHKGLQGDALKAYLDTYFAKAWGHFDVNRINEVEVSKMPQFMRFLASDQRMSLGENGF*
Ga0103742_105816613300009402Ice Edge, Mcmurdo Sound, AntarcticaMGIKNFGGEPSGKFWMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0114998_1027274613300009422MarineMNKQAAFASSNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115005_1144402713300009432MarineTGKFIMNEATMRAAASEVLCTHKGLCGANLQNYMNSYFAKSWGHFDVNKTGEVEVIKSPQFMRFLASD*
Ga0115008_1033204423300009436MarineMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115008_1069979613300009436MarineAASEVLCTHKGLCAAELQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0115008_1079153713300009436MarineAAAREVLETHKGLSGTKLAEYLDTYFAKAWGHFDVNRTGLVEVIKMPQLMRFLASD*
Ga0115007_1090968923300009441MarineMNESTMRAAASEVLCTHKGLCAAELQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFL
Ga0115571_127208213300009495Pelagic MarineGATAKAAASEVLGTHKGLHGPALQTYLDTYYDKAWRHFDVNQSGSIEVIKMPQLMRFLCSDQYMTLGESG*
Ga0115013_1147845613300009550MarineSPDGTFWMNEATTRAAASEVLGTHKGLKGAALGSYLDTYFAKAWAHFDVNRTGAVEVIKMPQFMRFLASDQYMSLGESG*
Ga0115104_1044848323300009677MarineMNEATTRAAAAEVLETHKGMKGGELAGYLEKYFPKAWNHFDVNRTGFVEVIKMPQFMRFLASDQYMTLQP*
Ga0115105_1069470723300009679MarineMNEATSRAAAAEVLGTHKGLAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQLMRFL
Ga0115105_1073918923300009679MarineMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNKTGAIEVGKSPQFMRFLASDQYMSLQ*
Ga0115105_1095469113300009679MarineMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGTVEVIKMPQLMRFLASDQYMSLGE*
Ga0115105_1101017813300009679MarineMTEAGASAAAREVLSTHKGMSGAQLESYMTTYWPRTWAHFDVNRTGAIEVIKMPQVMRFLASDQQMYLW*
Ga0115105_1117071513300009679MarineAREVLGTHKGLSGQLLDDYMGTYFAKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMSLGESG*
Ga0115105_1125755823300009679MarineMNEATSRAAASEVLGTHKGLSGAALSSYLDTYFAKAWAHFDVNRTGAIEVIKM
Ga0115105_1144016213300009679MarineMNEATTRAAAAEVLSTHKGLSGGALQSYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0115000_1056274313300009705MarineMAKFWMNESITRAAAREVLETHKGLTGSKLDTYLDTYFGKAWGHFDVNRTGMVEVIKMPQFMRFLASDQYMSLQ*
Ga0115001_1059781313300009785MarineSEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGMIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0115001_1084285313300009785MarineFWMDFNTSKAAASEVLGTHKGLHGPALQTYLDTYYEKAWRHFDVNQSGTVEVIKMP*
Ga0115012_1143017523300009790MarineMEEKTDDGVPSGRFWMNESITRAAAREVLETHKGLTGSKLNEYLDTYFQKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ*
Ga0129333_1150898823300010354Freshwater To Marine Saline GradientMNEAGARAASIEVLGTHKGLKGDNLNKYLDRYFQKAWGHFDVNRTGTIEVIKMPQFMRFLCSDQYMSLGESG*
Ga0138316_1046058613300010981MarineMNEATTRAAAAEVLGTHKGLAGEALSKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFISSDQYMTLQP*
Ga0138316_1122548913300010981MarineMNEATSRAAASEVLNTHKGLSGAALGSYLDTYFAKAWAHFDVNRTGAIEVIKMP*
Ga0138326_1002165213300010985MarineMNESITRAAAREVLETHKGLSGEGLNKYLDTYFAKAWGHFDVNRTGLVEVIKMP*
Ga0138326_1049657313300010985MarineMNEATMRAASSEVLCTHKGICGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQ
Ga0138324_1028459833300010987MarineMNESTMRAAASEVLCTHKGLCGGKLQEYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ*
Ga0138324_1032383223300010987MarineMNEATTRAAAAEVLNTHKGLAGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE*
Ga0138324_1051439213300010987MarineMNEATMRAASSEVLCTHKGICGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ*
Ga0138324_1064923313300010987MarineGKFWMNQSAANAAAREVLGTHKGLTGKKLDKYMETYFAKAWGHFDVNRSGVVEVDKMPQFMRFLCSDQYMSLQ*
Ga0138263_125573123300012415Polar MarineMTESATRAAASEVLETHKGLSGAAKEAYLNTYFGKAWRHFDVNQGGAVEVIKMPQLMRFLASDQYMSLHP*
Ga0138259_156398013300012416Polar MarineMDEATTRAASTEVLATHKAMKGDALKKYLDTYFPRTFAHFDVTKGGKVEVIKMPQFMRFLASDQYMSLLP*
Ga0138260_1110831723300012419Polar MarineMDELAAKAAASEVLCTHKKICGEELTSYLSTYFSKAFGHFDVNRTGYIEVIKMPMFMRFLASDQYFQFIQPK*
Ga0163180_1036305813300012952SeawaterMNEATTRAAAAEVLATHKGLAGDALGKYLDTYFVKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP*
Ga0163180_1100718813300012952SeawaterREVLETHKGLTGDKLNAYLDTYFGKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ*
Ga0163180_1147095113300012952SeawaterESITRAAAREVLETHKGLTGNKLNEYLETYFQKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQ*
Ga0163179_1045020223300012953SeawaterMNEATSRAAAAEVLGTHKGLSGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLSSDQYMTLQP*
Ga0182050_105407723300016689Salt MarshMNEAGTRAAATEVLTNNVHMKAADVPKYLETYFAKAWGHFDVNRVGKVEVIKMPQFMRFLASDQYLSLQHY
Ga0182072_126516213300016754Salt MarshMTKADTRRAASEVLATHKGLKGDALKTFLNTYFDKAWSHFDVNRTGKVEVIKMPQFMRFLASDQQLQLGESL
Ga0182063_130825613300016781Salt MarshMNKVTMRAAASEVLCTHKGLCGDKLNSYLATYFDKAWGHFDVNQTGEVDVIKSPQFMRFLASDQYMSLQ
Ga0181581_1084689813300017962Salt MarshHKGLKGEALQKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLLSDQRIQLGESGF
Ga0192960_10786013300018515MarineMTEAATRAAASEVLETHKGLSGAAKEAYLNTYFAKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLLP
Ga0193071_100866313300018645MarineMNEATTRAAASEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0192895_102146923300018646MarineMNEATTRAAASEVMNTHKGLSGGALQAYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193159_103167423300018666MarineMNKVTMRAAAGEVLCTHKGLCGDKLNAYLGTYFDKAWGHFDVNQTGEVDVIKSPQFMRFLASDQYMSLQ
Ga0192944_102921623300018692MarineMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKDGKIDVIKMPQFMRFLASDQYMTL
Ga0192944_106463313300018692MarineMTEAATRAAASEVLETHKGLSGAAKEAYLNTYFAKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYM
Ga0193517_104912423300018725MarineMNEATTRAAAAEVLNTHKGLSGDALGKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0193031_105368013300018765MarineMNEATARAAASEVLATHKGLHGAALTKYLDTYFPRTWAHFDVNRGGAVEVIKMPMFMRFLASDQYMSLGE
Ga0193031_106316723300018765MarineMNEGTARAAASEVLGTHKGLKGAALGSYLDTYFAKAWAHFDVNRTGAVEVIKMPQFMRFLASDQYMSLGE
Ga0193031_106483713300018765MarineMNEATMRAAASEVLCTHKGLCGEKLQTYLGTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193031_107954723300018765MarineMNEATARAAASEVLATHKGLHGAALGKYLDTYFPRTWAHFDVNRGGTIEVYKMPMFMRFLASDQSMSLGE
Ga0193149_104232813300018779MarineMNEATARAAASEVLATHKGLKGAALAKYLDTYFPRTWAHFDVNRGGTIEVYKMPMFMRFLASDQSMSLGE
Ga0193117_106306313300018796MarineMNEATMRAASSEVLCTHKGICGGKLQEYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193475_104954523300018855MarineMNEATARAAASEVLGTHKGLKGAALGSYLDTYFAKAWAHFDVNRTGTVEVIKMP
Ga0193471_107121213300018882MarineMAAAKEVLATHKGLTGDALKTYLDTYFAKAWSHFDVNKGGLIEVSKAPQFMRFLASDQRMGLGESGF
Ga0193260_1007371713300018928MarineMNEATARAAAAEVLSTHKGLKGDALAKYLDTYFPRTFAHFDVNRTGFIEVIKMPMFMRFLASDQYMSLGE
Ga0193260_1011953413300018928MarineMNEATTRAAAAEVLGTHKGLAGDALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLSSDQYMPLQP
Ga0192894_1027834113300018968MarineLNQAAAKAAASEVLATHKGLNGDALSKYLDTYFAKAWGHFDVNRTGSVEVIKMPQFMRFLASDQYMSLQP
Ga0192894_1029968313300018968MarineMNPGTARAASAEVLETHKGLKGGVLQKYLDTYFEKCWGHFDVNRTGMIEVIKMPQFMRFLASDQYMSLQP
Ga0192894_1029977613300018968MarineMNNAAATAAAREVLGTHKGLSGGALDAYMNTYFAKAWGHFDVNQTGTIEVIKMPQLMRFLCSDQYMTLGESG
Ga0192894_1031890913300018968MarineMNEATTRAAAAEVLETHKGLKGEVLQKYLDTYFAKSWGHFDVNRTGLVEVIKMPQFMRFIASD
Ga0193006_1015153423300018975MarineMNEATARAAAAEVLHTHKGLSGDALGKYLDTYFPRTFAHFDVNRTGFIEVIKMPMFMRFLASDQYMSLGE
Ga0193006_1018886813300018975MarineMNEATARAAAAEVLNTHKGLKGEALGKYLDTYFPRTWAHFDVNRTGFIEVIKMPMFMRFLASDQYMSLGE
Ga0192961_1013669713300018980MarineMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKGGKVEVIKMP
Ga0192947_1017630523300018982MarineMTAVTMKAAASEVLCTHKGLCGAALQAYLGTYFDKSWGHFDVNLTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0192947_1027422023300018982MarineVDWVNAHAAAAEVLETHKGLKDKMLSDYIKTYFQKTWDHFDVNQTGYIEVVKMPQFMRFLASDQTMSLLPY
Ga0193017_1015836513300018983MarineMNETTARSAASEVLGTHKGLTGAALQSYLDTYFAKAWAHFDVNRTGAIEVIKMP
Ga0193017_1021063023300018983MarineMNEATTRAAAAEVLGTHKGLAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQLMRFLSSDQYMSLQP
Ga0193017_1026283313300018983MarineMNEVTARSAASEVLGTHKGLKGAALQSYLDTYFAKAWAHFDVNRTGTIEVIKMP
Ga0193030_1014354813300018989MarineMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGAVEVIKMPMLMRFLASDQYMSLGE
Ga0193030_1014582923300018989MarineMNEATSRAAASEVLNTHKGLSGAALSSYLETYFAKAWAHFDVNRTGAIEVIKMPQFMRFLASDQYMSLGE
Ga0193030_1014584223300018989MarineMNEATSRAAAAEVLGTHKGLAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP
Ga0193030_1022367413300018989MarineMNEATARAAAAEVLTTHKGLKGDALAKYLDTYFPRTFAHFDVNRSGFIEVIKMPMFMRFLASDQYMSLGE
Ga0193030_1025754623300018989MarineMNEATSRAAAAEVLATHKGLAGDALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMTLQP
Ga0192951_1041610723300019022MarineMTEAATRAAASEVLETHKGLSGAAKEAYLNTYFAKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMS
Ga0193516_1017390113300019031MarineMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGTVEVIKMPQLMRFLASDQYMSLGE
Ga0193516_1019644513300019031MarineMNEATMRAAASEVLCTHKGLCGASLGKYLDTYFAKAWGHFDVNKTGAIEVGKSPQFMRFLASDQYMSLQ
Ga0193516_1029551713300019031MarineMNEATTRAAASEVLGTHKGLSGAALGSYLDTYFAKAWAHFDVNRTGAIEVIKMPQFMRFLASD
Ga0193037_1030453523300019033MarineMDEAGAYAAAQEVLGTHKGLHGANLSNYLATYWAKAWGHFDVNRVGKIEVIVMPQLMRFLCSD
Ga0193123_1040757813300019039MarineMMTQSTTLAASKEVLGTHKGLSGDALSAYLDTYFAKAWAHFDVNQGGAIDVIKMPQFMRFLASDQYMSLGESG
Ga0192826_1026326923300019051MarineMDWANAHAAASEVLDTHKGLKGKELEAYLKTYFQKTWDHFDVNRTGYIEVAKMPQFMRFLASDQYMSLLP
Ga0192826_1036776313300019051MarineNTTKAAASEVLATHKGLTGAALQTYLDTYFEKAWGHFDVNRTGEIEVIKMPQFMRFLASDQYMQLGESG
Ga0192826_1037616913300019051MarineSAAAKEVLHTHKGLSGEMLDRYVNTYFDKAWGHFDVNQTGFIEVIKMPQFMRYLCSDQYMSLGEAA
Ga0192992_1025062813300019054MarineMNEATSRAAASEVLGTHKGLSGAALSSYLDTYFAKSWAHFDVNRTGAIEVIKMPQFMRFLASDQYMSLGE
Ga0188866_102355613300019095Freshwater LakeMTEAATRAAASEVLETHKGLSGAAKEAYLNTYFAKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0193541_107287913300019111MarineMNQASALAASKEVLATHKGLSGKMLDDYVNTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193157_101700413300019118MarineMNEATARAAASEVLATHKGLHGAALSKYLDTYFPRTWAHFDVNRGGAIEVIKMPQFMRFLASD
Ga0193157_102599823300019118MarineMNNIIMRAAASEVLCTHKALCGDKLQKYLDTYFEKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQXAASLXV
Ga0193157_102685323300019118MarineMNEATSRSAASEVLGTHKGLSGAALSSYLDTYFAKAWAHFDVNRTGAIEVIKMP
Ga0193157_103421123300019118MarineMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRF
Ga0193157_103539023300019118MarineMNEATARAAASEVLGTHKGLKGAALSSYLDTYFAKAWAHFDVNRTGTIEVIKMPQFCRFLASD
Ga0193157_103714323300019118MarineMNEATTRAAAGEVLGTHKALAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP
Ga0193104_103001223300019125MarineMNEATMRAAASEVLCTHKGLCGGSLQSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0193089_114334113300019133MarineMMEPRSAEPTGKFWMTKSTTLGASKEVLNTHKGLSGAALASYLDTYFDKAWAHFDVNKGGDIEVIKMPQFMRFLASDQYMSLGESG
Ga0211696_104430813300020252MarineGEPSGKFWMNQASALAAAKEVLATHKGLAGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0211708_1023343713300020436MarineAAKEVLATHKGLSGKMLEDYVTTYFAKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0206691_104872723300021342SeawaterMNEATTRAAAAEVLGTHKGLAGEGLGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP
Ga0206691_108452213300021342SeawaterMNEATTRAAAAEVLNTHKGLSGEALQAYLDTYFPRTWAHFDVNRTGTVEVIKMPQLMRFLASDQYMSLGE
Ga0206688_1009885113300021345SeawaterMTESGARAASMEVLNTHKGLSGAALDTYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFICSDQYMALW
Ga0206688_1015410623300021345SeawaterMNEATMRAAASEVLCTHKGLCGGALGKYLDTYFAKAWGHFDVNRTGEVEVIKSPQFMRFLASDQYMSLQ
Ga0206688_1045381213300021345SeawaterMNEATTRAAAAEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0206688_1095961523300021345SeawaterMNEATSRAAASEVLGTHKGLSGAALSSYLDTYFAKAWAHFDVNRTGAVEVIKMPQFMRFLASDQYMSLGE
Ga0206695_105674313300021348SeawaterMNEATTRAAAGEVLNTHKGLTGGALSDYLNTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP
Ga0206695_127663923300021348SeawaterMNAAASEVLCTHKGLCGEKLAGYLNTYFAKAWSHFDVNQTGAVEVLKAPQFMRFLASDQYMSLQ
Ga0206695_141791813300021348SeawaterMNEATTRAAASEVLATHKGLSGDALQKYLDTYFARTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0206693_126952223300021353SeawaterMNEATTRAAAAEVLGTHKGLSGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLSSDQYMTLQP
Ga0206693_192798223300021353SeawaterMNEATTRAAASEVLGTHKGIKGEAAKKYLDTYFARTFAHFDVTKGGKIEVIKMPQFMRFLASDQYMSLLP
Ga0206123_1014892823300021365SeawaterMNEATTRAAAAEVLSTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFLASDQYMSLGE
Ga0206123_1046111813300021365SeawaterEKTKDGLPSGKFWMNEATTRAAAAEVLGTHKALAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP
Ga0063124_11180723300021876MarineMNEATTRAAASEVLNTHKGLSGDALQKYLDTYFPRTWAHFDVNRTGFVEVIKMPMLMRFL
Ga0063086_101527123300021902MarineMNESTMRAAASEVLCTHKGLCAAELQTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0063134_113914223300021928MarineMNEATSRAAAAEVLGTHKGLAGEALGKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQPXAQQ
Ga0222717_1016037513300021957Estuarine WaterMSEATATAAAQEVLATHKNLKGQDLEKYLDTYWGKAWGHFDVNKSGHIEVIQMPQLMRFLASDQTMSLQ
Ga0222717_1065950913300021957Estuarine WaterKVTMRAAASEVLATHKGLSGDKLNSYLGTYFDKAWGHFDVNQTGEIEVGKSPQFMRFLASDQYMSLQ
Ga0209308_1026900813300025869Pelagic MarineMNEATTRAAAAEVLETHKGLKGDDLKLYLDTYFSKAWGHFDVNRVGYVEVIKMPQLMRFLASDQYFSLQP
Ga0208275_103875113300026182MarineMNEATARAAASEVLATHKGLKGDALEKYLGTYFAKAWGHFDVNRTGTIEVIKMPQFMRFLASD
Ga0208275_104420013300026182MarineMNEATARSAAGEVLETHKGLKGDTLQKYLDTYFAKAWGHFDVNRTGMVEVIKMPQFMRFLASDQYMPLQP
Ga0247577_105931213300026437SeawaterMNEASAAAAAREVLGTHKGLAGKLLDDYMNTYFGKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0247559_109216913300026443SeawaterMNQASAMAAAKEVLTTHKGLTGKQLEDYVTTYFAKSWGHFDVNQTGFIEVIKMPQFMRFFCSDQYMSLGESG
Ga0247594_104472323300026448SeawaterMDEAATRAAASEVLETHKGLKGDEKKKYLDSYFLRTFAHFDVTKEGKIDVIKMPQFMRFLASDQYMTLQN
Ga0247568_109200213300026462SeawaterGKFWMNEAAANAAAKEVLGTHKGLSGDALAAYMNTYFKKAWGHFDVNQTGFVEVIKMPQLMRFLCSDQYMQLGESG
Ga0209712_1073927823300027849MarineSNEVLCTHKGLCGAALQNYMSSYYGKAWGHFDVNKTGEVEVIKTPQFMRFLASDQYMSLQ
Ga0247582_117184913300028109SeawaterGKFVMNEATMRAAASEVLCTHKGLCGGALTSYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0304731_1073685313300028575MarineMNEATTRAAAAEVLGTHKGLAGEALSKYLDTYFAKAWGHFDVNRTGLVEVIKMPQFMRFISSDQYMTLQP
Ga0307398_1083602423300030699MarineMNEATSRAAAAEVLATHKGVTADSLAKYLETYFAKAWGHFDVNRTGLVEVIKMPQFM
Ga0307399_1045174923300030702MarineMNEATSRAAAAEVLGTHKGLTGEALAKYLDTYFVKAWGHFDVNRTGLVEVIKMPQFMRFISSDQYMTLQP
Ga0308139_103533013300030720MarineMDEATTRAAASEVLETHKNLKGDEKKKYLDTYFARTFAHFDVTKDGKIDVIKMPQFMRFLASDQYMTL
Ga0308139_107896123300030720MarineMTEAATRAAASEVLETHKGLSGAAKEAYLNTYFAKAWRHFDVNQGGSLEVIKMPQFMRFLASDQYMSLQP
Ga0308133_104539323300030721MarineMNKQASFASSNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0308137_106522513300030722MarineMNAVTMRAAASEVLCTHKGLCGAKLASYLDTYFDKAWGHFDVNKTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0073967_1204975313300030750MarineGGEPSGKFWMNEAAALAAAKEVLTTHKGLTGKLLDDYINTYFKKAWGHFDVNQTGFIEVIKMPQFMRFLCSDQYMSLGESG
Ga0307489_1036593013300031569Sackhole BrineMDEALTRSAATEVLRTHRNLAGKELDAYLKTYFPRTWAHFDVNRSGKIEVIKMPQVMRFLSSDQQMYLW
Ga0308132_109110623300031580MarineMNANTMRAASSEVLCTHKGLCGAKLQSYLDTYFEKSWGHFDVNRTGEIEVIKSPQFMRFLASDQYMSLQ
Ga0308132_110592413300031580MarineMNEATSRAAATEVLGTHKGLSGAALSSYLDTYFAKTWSHFDVNRTGAVEVIKMP
Ga0308132_111610623300031580MarineMAKFWMNESITRAAAREVLETHKGLTGSKLDTYLDTYFGKAWGHFDVNRTGMVEVIKMPQFMRFLASDQYMSLQ
Ga0302126_1023439223300031622MarineVLETHKGLAGPKLDAYLDTYFGKAWGHFDVNRTGLVEVIKMPQLMRFLSSDQYMSLQ
Ga0307386_1052246113300031710MarineMNEATTRAAASEVLNTHKGLSGAALSSYLDTYFAKAWAHFDVNRGGAIEVIKSPMFMRFLASDQYMSLGE
Ga0307386_1055015133300031710MarineMDEATTRAAATEVLGTHKAIKGDAAKKYLDTYFARTFAHFDVTKGGKLEVIKMPQFMRFLASDQY
Ga0307386_1067699923300031710MarineMNESTMRAAASEVLCTHKGLCGGALGTYLDTYFAKAWGHFDVNRTGEIEVIKSPQFMRFLASD
Ga0307394_1024426523300031735MarineMNEATSRAAAAEVLATHKGVTADSLAKYLETYFAKAWGHFDVNRTGLVEVIKMP
Ga0307384_1032674713300031738MarineMNEATSRAAAAEVLATHKGVTADSLAKYLETYFAKAWGHFDVNRTGLVEVIKMPQFMRFLASDQYMSLQP
Ga0307384_1043036633300031738MarineMDEATTRAAASEVLGTHKAIKGDAAKKYLDTYFARTFAHFDVTKGGKLEVIKMPQFMRFLASD
Ga0307383_1047512823300031739MarineLTESQARAAASEVLETHKGLKGEKLGGYLDTYWAKAWGHFDVNKIGQIETIKAP
Ga0307383_1056704823300031739MarineMNEAITRAAAREVLATHKGLTGPALDTYMTTYFGKAWGHFDVNRVGRVEVIKMPQLMRFLCSDQYMPL
Ga0315321_1054015813300032088SeawaterNCVPSGHFWMSESASRAAANEVLNTHKGLSGEALSSYLDTYFAKAWGHFDVNRVGYVEVIKMPQFMRFLCSDQYMSLGESG
Ga0314688_1020483923300032517SeawaterMNKQAAFAASNEVLNTHKGLSGNALKAYTDTYFEKAWGHFDVNQVGTIEVIKMPQFMRFLCSDQYMSLGESG
Ga0314699_1038771223300032730SeawaterMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKDGKIDVIKM
Ga0314711_1049652613300032732SeawaterMTEAAARAAASEVLETHKGLTGAAKEAYLNTYFAKAWRHFDVNQGGSLEVIKMPQFMRFLASDQYMSLQP
Ga0314714_1051933323300032733SeawaterMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKDGKIDVIKMPQFMRFLASDQ
Ga0314705_1049176423300032744SeawaterMDEATTRAAASEVLETHKGLKGDEKKKYLDTYFARTFAHFDVTKDGKIDVIKMPQFMRFLAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.