Metagenome / Metatranscriptome Family F033197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F033197
Family Type	Metagenome / Metatranscriptome
Number of Sequences	178
Average Sequence Length	38 residues
Representative Sequence	MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW
Number of Associated Samples	111
Number of Associated Scaffolds	178

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	84.83 %
% of genes near scaffold ends (potentially truncated)	19.66 %
% of genes from short scaffolds (< 2000 bps)	83.15 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (62.360 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.045 % of family members)
Environment Ontology (ENVO)	Unclassified (25.281 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.067 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 178 Family Scaffolds
PF08734	GYD	3.37
PF00571	CBS	2.81
PF00501	AMP-binding	1.69
PF03466	LysR_substrate	1.69
PF00550	PP-binding	1.12
PF00583	Acetyltransf_1	1.12
PF07045	DUF1330	1.12
PF16861	Carbam_trans_C	1.12
PF00126	HTH_1	1.12
PF01925	TauE	0.56
PF03401	TctC	0.56
PF04392	ABC_sub_bind	0.56
PF16177	ACAS_N	0.56
PF12071	DUF3551	0.56
PF14403	CP_ATPgrasp_2	0.56
PF02652	Lactate_perm	0.56
PF08379	Bact_transglu_N	0.56
PF00486	Trans_reg_C	0.56
PF12146	Hydrolase_4	0.56
PF02682	CT_C_D	0.56
PF01161	PBP	0.56
PF01381	HTH_3	0.56
PF01032	FecCD	0.56
PF13454	NAD_binding_9	0.56
PF13230	GATase_4	0.56
PF02518	HATPase_c	0.56
PF09339	HTH_IclR	0.56
PF03171	2OG-FeII_Oxy	0.56
PF01977	UbiD	0.56
PF01207	Dus	0.56
PF00291	PALP	0.56
PF00884	Sulfatase	0.56
PF01068	DNA_ligase_A_M	0.56
PF00171	Aldedh	0.56
PF01814	Hemerythrin	0.56
PF01844	HNH	0.56
PF01928	CYTH	0.56
PF00490	ALAD	0.56
PF03734	YkuD	0.56

COG ID	Name	Functional Category	% Frequency in 178 Family Scaffolds
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	3.37
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	1.12
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.56
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.56
COG0043	3-polyprenyl-4-hydroxybenzoate decarboxylase	Coenzyme transport and metabolism [H]	0.56
COG0113	Delta-aminolevulinic acid dehydratase, porphobilinogen synthase	Coenzyme transport and metabolism [H]	0.56
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.56
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.56
COG1305	Transglutaminase-like enzyme, putative cysteine protease	Posttranslational modification, protein turnover, chaperones [O]	0.56
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.56
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.56
COG1620	L-lactate permease	Energy production and conversion [C]	0.56
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.56
COG1881	Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family	General function prediction only [R]	0.56
COG2049	5-oxoprolinase subunit B/Allophanate hydrolase subunit 1	Amino acid transport and metabolism [E]	0.56
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.56
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.56
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.56
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.56

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
All Organisms	root	All Organisms	37.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
cellular organisms	root	All Organisms → cellular organisms	37.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	37.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	25.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	20.22 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.56 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10.67 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.25 %
Caulobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales	0.56 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	0.56 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.06 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.25 %
Betaproteobacteria bacterium 13_1_20CM_3_63_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8	0.56 %
Caulobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae	0.56 %
Enterobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae	0.56 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.81 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.25 %
unclassified Bradyrhizobiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae	0.56 %
Phenylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium	0.56 %
Escherichia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia	0.56 %
Rhodopseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas	0.56 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.56 %
Betaproteobacteria bacterium 13_1_20CM_3_63_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.25 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	0.56 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.56 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.56 %
unclassified Phenylobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium	0.56 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.56 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	0.56 %
Betaproteobacteria bacterium 13_1_20CM_3_63_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.36 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2.25 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.56 %
Phenylobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp.	0.56 %
Bradyrhizobium sp. SRL28	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28	0.56 %
Bradyrhizobiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	0.56 %
Escherichia coli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	0.56 %
Rhodopseudomonas palustris	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	0.56 %
Betaproteobacteria bacterium 13_1_20CM_3_63_8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459023\|GZGNO2B01DD52U	Not Available	507	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1002165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3151	Open in IMG/M
3300000580\|AF_2010_repII_A01DRAFT_1005969	Not Available	1979	Open in IMG/M
3300005332\|Ga0066388_100671848	All Organisms → cellular organisms → Bacteria	1647	Open in IMG/M
3300005434\|Ga0070709_11187576	Not Available	613	Open in IMG/M
3300005533\|Ga0070734_10000376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	100573	Open in IMG/M
3300005560\|Ga0066670_10287562	Not Available	999	Open in IMG/M
3300005764\|Ga0066903_100479786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2095	Open in IMG/M
3300005764\|Ga0066903_101137483	Not Available	1443	Open in IMG/M
3300005764\|Ga0066903_101191579	Not Available	1413	Open in IMG/M
3300005764\|Ga0066903_101319715	All Organisms → cellular organisms → Bacteria	1349	Open in IMG/M
3300005764\|Ga0066903_101715924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1196	Open in IMG/M
3300005764\|Ga0066903_106285229	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300006028\|Ga0070717_10276358	Not Available	1489	Open in IMG/M
3300006028\|Ga0070717_11145992	Not Available	708	Open in IMG/M
3300006028\|Ga0070717_11929168	Not Available	533	Open in IMG/M
3300006041\|Ga0075023_100121250	Not Available	930	Open in IMG/M
3300006047\|Ga0075024_100440274	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300006052\|Ga0075029_100082706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1903	Open in IMG/M
3300006057\|Ga0075026_100435781	Not Available	743	Open in IMG/M
3300006057\|Ga0075026_100657594	Not Available	622	Open in IMG/M
3300006059\|Ga0075017_100974258	Not Available	660	Open in IMG/M
3300006059\|Ga0075017_101131241	Not Available	612	Open in IMG/M
3300006086\|Ga0075019_10760594	Not Available	616	Open in IMG/M
3300006102\|Ga0075015_100271599	Not Available	924	Open in IMG/M
3300006102\|Ga0075015_100794739	Not Available	568	Open in IMG/M
3300006102\|Ga0075015_101041318	Not Available	502	Open in IMG/M
3300006172\|Ga0075018_10494130	Not Available	637	Open in IMG/M
3300006174\|Ga0075014_100053469	Not Available	1743	Open in IMG/M
3300006175\|Ga0070712_100093477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2207	Open in IMG/M
3300006175\|Ga0070712_100524963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	995	Open in IMG/M
3300006175\|Ga0070712_101502670	Not Available	588	Open in IMG/M
3300006800\|Ga0066660_11608223	Not Available	515	Open in IMG/M
3300006804\|Ga0079221_10028095	All Organisms → cellular organisms → Bacteria → Proteobacteria	2357	Open in IMG/M
3300006893\|Ga0073928_10074302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2935	Open in IMG/M
3300009038\|Ga0099829_11485249	Not Available	560	Open in IMG/M
3300009137\|Ga0066709_103884797	Not Available	543	Open in IMG/M
3300009792\|Ga0126374_10039322	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2303	Open in IMG/M
3300009792\|Ga0126374_10080259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1781	Open in IMG/M
3300009792\|Ga0126374_10273432	All Organisms → cellular organisms → Bacteria	1117	Open in IMG/M
3300009792\|Ga0126374_10815204	Not Available	715	Open in IMG/M
3300010047\|Ga0126382_10400357	Not Available	1071	Open in IMG/M
3300010048\|Ga0126373_10341037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1507	Open in IMG/M
3300010048\|Ga0126373_11578577	Not Available	721	Open in IMG/M
3300010359\|Ga0126376_10324017	Not Available	1352	Open in IMG/M
3300010360\|Ga0126372_10647496	Not Available	1022	Open in IMG/M
3300010361\|Ga0126378_10541276	Not Available	1279	Open in IMG/M
3300010361\|Ga0126378_13326671	Not Available	511	Open in IMG/M
3300010366\|Ga0126379_10782223	Not Available	1053	Open in IMG/M
3300010376\|Ga0126381_100977241	All Organisms → cellular organisms → Bacteria → Proteobacteria	1221	Open in IMG/M
3300010376\|Ga0126381_101362820	All Organisms → cellular organisms → Bacteria	1025	Open in IMG/M
3300012198\|Ga0137364_10182151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1533	Open in IMG/M
3300012198\|Ga0137364_11162313	Not Available	579	Open in IMG/M
3300012198\|Ga0137364_11169240	Not Available	577	Open in IMG/M
3300012207\|Ga0137381_10261058	Not Available	1506	Open in IMG/M
3300012208\|Ga0137376_10734248	Not Available	851	Open in IMG/M
3300012209\|Ga0137379_10226767	Not Available	1782	Open in IMG/M
3300012209\|Ga0137379_10958185	Not Available	760	Open in IMG/M
3300012209\|Ga0137379_11143266	Not Available	685	Open in IMG/M
3300012285\|Ga0137370_10388064	Not Available	844	Open in IMG/M
3300012359\|Ga0137385_10587947	All Organisms → cellular organisms → Bacteria → Proteobacteria	937	Open in IMG/M
3300012971\|Ga0126369_13230846	Not Available	534	Open in IMG/M
3300016319\|Ga0182033_11370152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	636	Open in IMG/M
3300016341\|Ga0182035_10050273	Not Available	2824	Open in IMG/M
3300016341\|Ga0182035_11993943	Not Available	527	Open in IMG/M
3300016341\|Ga0182035_12157715	Not Available	505	Open in IMG/M
3300016357\|Ga0182032_10087353	Not Available	2161	Open in IMG/M
3300016422\|Ga0182039_10841696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	816	Open in IMG/M
3300017822\|Ga0187802_10010967	All Organisms → cellular organisms → Bacteria	2927	Open in IMG/M
3300017822\|Ga0187802_10026145	Not Available	2044	Open in IMG/M
3300017822\|Ga0187802_10028424	All Organisms → cellular organisms → Bacteria → Proteobacteria	1970	Open in IMG/M
3300017822\|Ga0187802_10089107	Not Available	1155	Open in IMG/M
3300017823\|Ga0187818_10537642	Not Available	526	Open in IMG/M
3300017924\|Ga0187820_1034491	Not Available	1324	Open in IMG/M
3300017924\|Ga0187820_1280130	Not Available	543	Open in IMG/M
3300017943\|Ga0187819_10103012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8	1705	Open in IMG/M
3300017955\|Ga0187817_10230194	Not Available	1181	Open in IMG/M
3300017955\|Ga0187817_10775767	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300017959\|Ga0187779_10757157	Not Available	660	Open in IMG/M
3300017961\|Ga0187778_10180854	Not Available	1339	Open in IMG/M
3300017970\|Ga0187783_10041428	Not Available	3411	Open in IMG/M
3300017970\|Ga0187783_10142048	Not Available	1769	Open in IMG/M
3300017972\|Ga0187781_10672549	Not Available	748	Open in IMG/M
3300017973\|Ga0187780_10535201	All Organisms → cellular organisms → Bacteria → Proteobacteria	838	Open in IMG/M
3300017974\|Ga0187777_10114033	Not Available	1784	Open in IMG/M
3300017994\|Ga0187822_10358430	Not Available	528	Open in IMG/M
3300018001\|Ga0187815_10111353	All Organisms → cellular organisms → Bacteria	1155	Open in IMG/M
3300018001\|Ga0187815_10512268	Not Available	514	Open in IMG/M
3300018007\|Ga0187805_10573820	Not Available	532	Open in IMG/M
3300018062\|Ga0187784_10000784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24250	Open in IMG/M
3300018062\|Ga0187784_11154622	Not Available	615	Open in IMG/M
3300018433\|Ga0066667_12195193	Not Available	514	Open in IMG/M
3300019888\|Ga0193751_1002067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12389	Open in IMG/M
3300019888\|Ga0193751_1009719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5117	Open in IMG/M
3300019888\|Ga0193751_1010359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4931	Open in IMG/M
3300020010\|Ga0193749_1007705	Not Available	2088	Open in IMG/M
3300020581\|Ga0210399_10146792	All Organisms → cellular organisms → Bacteria	1950	Open in IMG/M
3300021168\|Ga0210406_11297118	Not Available	525	Open in IMG/M
3300021433\|Ga0210391_11026627	Not Available	642	Open in IMG/M
3300021560\|Ga0126371_10078183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3239	Open in IMG/M
3300021560\|Ga0126371_10117987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2672	Open in IMG/M
3300021560\|Ga0126371_10291446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium	1756	Open in IMG/M
3300021560\|Ga0126371_10331428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1654	Open in IMG/M
3300021560\|Ga0126371_10997214	Not Available	979	Open in IMG/M
3300022557\|Ga0212123_10062885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3268	Open in IMG/M
3300025915\|Ga0207693_10442988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1015	Open in IMG/M
3300025939\|Ga0207665_11302677	Not Available	579	Open in IMG/M
3300026330\|Ga0209473_1244354	Not Available	625	Open in IMG/M
3300026552\|Ga0209577_10295255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1210	Open in IMG/M
3300026552\|Ga0209577_10369719	Not Available	1047	Open in IMG/M
3300026896\|Ga0207730_1012668	Not Available	721	Open in IMG/M
3300026979\|Ga0207817_1016906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris	796	Open in IMG/M
3300026997\|Ga0207784_1030795	Not Available	550	Open in IMG/M
3300027042\|Ga0207766_1030647	All Organisms → cellular organisms → Bacteria → Proteobacteria	604	Open in IMG/M
3300027050\|Ga0209325_1005993	All Organisms → cellular organisms → Bacteria	1291	Open in IMG/M
3300027680\|Ga0207826_1155550	Not Available	623	Open in IMG/M
3300027824\|Ga0209040_10464489	Not Available	572	Open in IMG/M
3300027826\|Ga0209060_10000061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	294831	Open in IMG/M
3300027842\|Ga0209580_10657910	Not Available	518	Open in IMG/M
3300027874\|Ga0209465_10231481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	923	Open in IMG/M
3300027898\|Ga0209067_10119762	Not Available	1381	Open in IMG/M
3300027898\|Ga0209067_10828834	Not Available	541	Open in IMG/M
3300027898\|Ga0209067_10914892	Not Available	516	Open in IMG/M
3300027910\|Ga0209583_10193977	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300027910\|Ga0209583_10403937	Not Available	651	Open in IMG/M
3300030844\|Ga0075377_11686015	Not Available	506	Open in IMG/M
3300031057\|Ga0170834_109479439	Not Available	520	Open in IMG/M
3300031057\|Ga0170834_113905066	Not Available	812	Open in IMG/M
3300031128\|Ga0170823_12007422	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300031128\|Ga0170823_12975906	Not Available	510	Open in IMG/M
3300031128\|Ga0170823_16098464	All Organisms → cellular organisms → Bacteria	1196	Open in IMG/M
3300031128\|Ga0170823_16483875	Not Available	607	Open in IMG/M
3300031231\|Ga0170824_104144544	All Organisms → cellular organisms → Bacteria	3574	Open in IMG/M
3300031231\|Ga0170824_108239543	Not Available	559	Open in IMG/M
3300031231\|Ga0170824_118199175	Not Available	521	Open in IMG/M
3300031231\|Ga0170824_127945427	Not Available	792	Open in IMG/M
3300031474\|Ga0170818_102047501	Not Available	702	Open in IMG/M
3300031474\|Ga0170818_104548795	Not Available	546	Open in IMG/M
3300031545\|Ga0318541_10063198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1926	Open in IMG/M
3300031545\|Ga0318541_10208085	Not Available	1083	Open in IMG/M
3300031545\|Ga0318541_10849116	Not Available	509	Open in IMG/M
3300031573\|Ga0310915_10499329	Not Available	864	Open in IMG/M
3300031679\|Ga0318561_10486656	Not Available	679	Open in IMG/M
3300031682\|Ga0318560_10510719	Not Available	651	Open in IMG/M
3300031708\|Ga0310686_119156766	All Organisms → cellular organisms → Bacteria → Proteobacteria	2722	Open in IMG/M
3300031719\|Ga0306917_10439770	Not Available	1021	Open in IMG/M
3300031719\|Ga0306917_11417326	Not Available	536	Open in IMG/M
3300031748\|Ga0318492_10254484	Not Available	908	Open in IMG/M
3300031768\|Ga0318509_10125602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1402	Open in IMG/M
3300031771\|Ga0318546_10227153	All Organisms → cellular organisms → Bacteria	1281	Open in IMG/M
3300031879\|Ga0306919_10185236	Not Available	1539	Open in IMG/M
3300031879\|Ga0306919_10319634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1181	Open in IMG/M
3300031890\|Ga0306925_10122349	All Organisms → cellular organisms → Bacteria → Proteobacteria	2785	Open in IMG/M
3300031890\|Ga0306925_10418596	Not Available	1434	Open in IMG/M
3300031890\|Ga0306925_10522241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1262	Open in IMG/M
3300031897\|Ga0318520_11073878	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300031910\|Ga0306923_10093139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3392	Open in IMG/M
3300031910\|Ga0306923_11320901	Not Available	764	Open in IMG/M
3300031912\|Ga0306921_10033816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	5725	Open in IMG/M
3300031912\|Ga0306921_10241397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28	2117	Open in IMG/M
3300031941\|Ga0310912_10114659	All Organisms → cellular organisms → Bacteria	2002	Open in IMG/M
3300031941\|Ga0310912_10295323	Not Available	1253	Open in IMG/M
3300031941\|Ga0310912_10757108	Not Available	751	Open in IMG/M
3300031945\|Ga0310913_10058905	Not Available	2525	Open in IMG/M
3300031946\|Ga0310910_10078459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp.	2400	Open in IMG/M
3300031947\|Ga0310909_10833239	Not Available	760	Open in IMG/M
3300032035\|Ga0310911_10847948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	528	Open in IMG/M
3300032059\|Ga0318533_10216329	Not Available	1376	Open in IMG/M
3300032076\|Ga0306924_11561678	Not Available	697	Open in IMG/M
3300032180\|Ga0307471_100287161	Not Available	1724	Open in IMG/M
3300032180\|Ga0307471_100472463	All Organisms → cellular organisms → Bacteria	1398	Open in IMG/M
3300032180\|Ga0307471_100826124	Not Available	1094	Open in IMG/M
3300032180\|Ga0307471_101632970	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300032261\|Ga0306920_103664950	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300032261\|Ga0306920_104252985	Not Available	515	Open in IMG/M
3300033289\|Ga0310914_11277640	Not Available	636	Open in IMG/M
3300033290\|Ga0318519_10445803	Not Available	775	Open in IMG/M
3300033290\|Ga0318519_10647900	Not Available	644	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	80.34%
Aquatic	Environmental → Aquatic	19.66%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	80.34%
Sediment	Environmental → Aquatic → Sediment	10.11%
Freshwater	Environmental → Aquatic → Freshwater	8.43%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.12%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	62.36%
Loam	Environmental → Terrestrial → Soil → Loam	12.92%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	10.11%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	8.43%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.06%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.12%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	35.39%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.47%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	10.11%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	7.87%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.87%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.06%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.06%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.93%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.12%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	14.04%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.24%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.24%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	10.11%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	7.87%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	7.87%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.30%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	6.18%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.06%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.06%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.25%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.81%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.69%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.12%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.12%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.56%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.56%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.56%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459023	Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)	Environmental	Open in IMG/M
3300000580	Forest soil microbial communities from Amazon forest - 2010 replicate II A01	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006059	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012	Environmental	Open in IMG/M
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental	Open in IMG/M
3300006102	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental	Open in IMG/M
3300017823	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3	Environmental	Open in IMG/M
3300017924	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018001	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020010	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026896	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes)	Environmental	Open in IMG/M
3300026979	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes)	Environmental	Open in IMG/M
3300026997	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes)	Environmental	Open in IMG/M
3300027042	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)	Environmental	Open in IMG/M
3300027050	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027898	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300030844	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031128	Oak Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FA3_01963740	2170459023	Grass Soil	MNTQIFNKGGLAGNFWLQIAALVIVTLVVIALASKYVW
AF_2010_repII_A01DRAFT_10021652	3300000580	Forest Soil	MNTQTSNKAGFANNFWVQMTALLVVTVGIIALAAKYIW*
AF_2010_repII_A01DRAFT_10059692	3300000580	Forest Soil	MPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW*
Ga0066388_1006718483	3300005332	Tropical Forest Soil	MIREGGDQMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW*
Ga0070709_111875762	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	LYSTGYQPKEVIQYETQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW*
Ga0070734_1000037612	3300005533	Surface Soil	MTTQAANKNSLANNLWVQMAALIVVTVVIIALAAKYIW*
Ga0066670_102875622	3300005560	Soil	MDTQLANKGDITNNFWLQMAALVIVTVAMIALAAKYVW*
Ga0066903_1004797863	3300005764	Tropical Forest Soil	MDTRISPKTGFANNAWVQIAALLVLTIVVIALAAKYIW*
Ga0066903_1011374832	3300005764	Tropical Forest Soil	MATQITSKHGFTDNFWLQMAALVIVTLVMIALAAEYVW*
Ga0066903_1011915793	3300005764	Tropical Forest Soil	MDTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW*
Ga0066903_1013197152	3300005764	Tropical Forest Soil	MNTQTSNKAGFANNFWVQMAALVVVTVVIIALAAKYIW*
Ga0066903_1017159241	3300005764	Tropical Forest Soil	MNTQITSKRSFANNFWLQAAALVVMTLVVIALAANYVW*
Ga0066903_1062852291	3300005764	Tropical Forest Soil	MNTQTSNKTGFANNFWVQMTALVVVTVLIIALAAKYIW*
Ga0070717_102763582	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MNTQIRNTGGFTNNFWVQMAALVIVSLAVIAVAAKYIW*
Ga0070717_111459923	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDTQIAPKSGFANNVWVQMAALVIVTIVVIALAAKYIW*
Ga0070717_119291681	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MNTQIRSTGGLANNFWVQMAALIVVVAVLIALAAKYLW*
Ga0075023_1001212502	3300006041	Watersheds	MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW*
Ga0075024_1004402741	3300006047	Watersheds	MNTQIRNTDGFTNSFWVQIAALVIVTLAVIALAAKYIW*
Ga0075029_1000827062	3300006052	Watersheds	MDTQITPKGGVANNVWVQMAALVIVTIVVIALAAKYIW*
Ga0075026_1004357813	3300006057	Watersheds	LLDRCVPSGHRLKGGNRAMNTQIRNKGGFTNNFWVQMAALVIVTLAVIALAAKYIW*
Ga0075026_1006575941	3300006057	Watersheds	MDTQTTPKSGFARNFWVQMAALVIVTIVVIALAAKYIW*
Ga0075017_1009742582	3300006059	Watersheds	MDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYIW*
Ga0075017_1011312411	3300006059	Watersheds	MDTQITRKSGFANKFWVQMAALVIVTIVVIALAAKYIW*
Ga0075019_107605942	3300006086	Watersheds	LTMNTQITTKQGFTNNFWVQMAAMVILTVVVIALAAKYIW*
Ga0075015_1002715991	3300006102	Watersheds	MDTQIPRKSGFANNFWVQMAALVVVTIAVIALAAKYIW*
Ga0075015_1007947391	3300006102	Watersheds	MDTQIAPKSGFANNVWVQMAAMVILTVVVIALAAKYIW
Ga0075015_1010413181	3300006102	Watersheds	QIPPQKRGFANNVWVQMAALVIVTIVVIALAAKYIW*
Ga0075018_104941301	3300006172	Watersheds	MNTQIFNKGGLAGNFWLQIAALVIVTLVVIALASKYVW*
Ga0075014_1000534695	3300006174	Watersheds	MNTQIFNKGGFADNFWVQMAALVIVTLVVIALAAKYVW*
Ga0070712_1000934775	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MNTQTSNKAGFTNNFWVQMAALVIVTVVIIALAAKYIW*
Ga0070712_1005249632	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MDNTQITRKSGFANNFWVQMAALVIVTIVVIAIAAKYVW*
Ga0070712_1015026701	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW*
Ga0066660_116082232	3300006800	Soil	MNTQIFNKGGFANNLWVQMATLVIVTLVVVALAAMYVW*
Ga0079221_100280952	3300006804	Agricultural Soil	MNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW*
Ga0073928_100743024	3300006893	Iron-Sulfur Acid Spring	MNTQIRNIGSFANNFWVQMAALVVVVAIVIAFAAKYLW*
Ga0099829_114852491	3300009038	Vadose Zone Soil	MDTRADSRRGFVNNLWVQMAALVIVVLVLLALAAKYIW*
Ga0066709_1038847971	3300009137	Grasslands Soil	MNTQTFNKGGFANNFWVQMAALVIVTLVVIAFAAKYVW*
Ga0126374_100393222	3300009792	Tropical Forest Soil	MNTQIGNTSGFANNIWVQMAALVIVVGGLIALAAKYIW*
Ga0126374_100802593	3300009792	Tropical Forest Soil	MDSQITSKSGLANDFWLQMAALAILTIVVIALAAKYVW*
Ga0126374_102734321	3300009792	Tropical Forest Soil	MNTQISNKAGFANNFWVQVTALIVVTVVIIALAAKYIW*
Ga0126374_108152042	3300009792	Tropical Forest Soil	MATQITSKHGFTDNLWLQMVALVIVTLVVIALAAEYVW*
Ga0126382_104003572	3300010047	Tropical Forest Soil	MATQITSKHGFTDNLWLQMAALVIVTLVVITLAAEYVW*
Ga0126373_103410373	3300010048	Tropical Forest Soil	MATQIASKHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126373_115785771	3300010048	Tropical Forest Soil	MATQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126376_103240172	3300010359	Tropical Forest Soil	MDSQITSKSGLANDFWLQMAALTILTIVVIALAAKYVW*
Ga0126372_106474962	3300010360	Tropical Forest Soil	MATQITSNHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126378_105412762	3300010361	Tropical Forest Soil	MATQITSKHGFADNFWLQMAALVIVTLIVIALAAEYVW*
Ga0126378_133266711	3300010361	Tropical Forest Soil	MNTQITGKRSFANNFWLQAAALVVVTLVVIALAANYV
Ga0126379_107822231	3300010366	Tropical Forest Soil	MNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW*
Ga0126381_1009772411	3300010376	Tropical Forest Soil	MDTQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW*
Ga0126381_1013628201	3300010376	Tropical Forest Soil	MPTQINKGGFTNNVWVQMAALGVITVIIIALAAKYIW*
Ga0137364_101821511	3300012198	Vadose Zone Soil	SMNTQIFKKGGLANNFWVQMAALVIVTLVVIALAANYIW*
Ga0137364_111623132	3300012198	Vadose Zone Soil	VIQYESQTFNKGGFANNFWVQMAALVIVTLVVIAFAAKYVW*
Ga0137364_111692401	3300012198	Vadose Zone Soil	MDAWADRKSGFANNFWVPIAALVIVVVVIIALAAKYIW*
Ga0137381_102610581	3300012207	Vadose Zone Soil	MNTQIRNTDGFANNFWVQMAALVVVVAVVIVLAAKYVW*
Ga0137376_107342482	3300012208	Vadose Zone Soil	MNTQIFNKGGFANNLWVQMAALVIVTLVVIALAAKYVW*
Ga0137379_102267673	3300012209	Vadose Zone Soil	MNTQIRNTGGFANNFWVQMAALVVVVAVVIVLAAKYVW*
Ga0137379_109581851	3300012209	Vadose Zone Soil	MNTQIFKKGGFANNFWVQMAALVIVTLVVIALAAKYVW*
Ga0137379_111432662	3300012209	Vadose Zone Soil	MDTKADSRSGFVNKLWVQMAALVIVVLVLIALATKYIW*
Ga0137370_103880642	3300012285	Vadose Zone Soil	MNTQIRNIGGLANNFWVQMAALVIVTLVVIALAANYIW*
Ga0137385_105879474	3300012359	Vadose Zone Soil	MDTRADSRSGFVNKLWVQMAALVIVVLVLIALAAKYIW*
Ga0126369_132308461	3300012971	Tropical Forest Soil	MNTQITSKRSFANNFWLQAAAMVVVTLVVIALAANYVW*
Ga0182033_113701521	3300016319	Soil	GDPLMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0182035_100502734	3300016341	Soil	EIRMDTQITHKSGLANNLWVQMAALVIVKNVVIALAAEFIW
Ga0182035_119939431	3300016341	Soil	VDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0182035_121577152	3300016341	Soil	MATPITSKHGFADNFWLQMAALVIVTLVVIALAAEYVW
Ga0182032_100873532	3300016357	Soil	MDTQISPKTGFTNNAWVQITALVVLTIIVIALAAKYIW
Ga0182039_108416961	3300016422	Soil	LMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0187802_100109673	3300017822	Freshwater Sediment	MDTQITGKSGFANNVWVQMAALVIVTIAVIALAAKYIW
Ga0187802_100261453	3300017822	Freshwater Sediment	MDTPTRQRSGLANNFWLQMAALVIVVAIIIALAAKYIW
Ga0187802_100284242	3300017822	Freshwater Sediment	MNTQIRNTGGFINNFWVQMAALVVVTLAVIALAAKYIW
Ga0187802_100891071	3300017822	Freshwater Sediment	MDTQITPKSGFANNFWVQMAAMVIVTIVVIALAAKYIW
Ga0187818_105376422	3300017823	Freshwater Sediment	MDTPTRQKSGLANNFWLQMAALVIVVAIIIALAAKYIW
Ga0187820_10344911	3300017924	Freshwater Sediment	MDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYIW
Ga0187820_12801301	3300017924	Freshwater Sediment	MDTQITPKSGFANNFWVQMAAMVIVTIVVIALEAKY
Ga0187819_101030121	3300017943	Freshwater Sediment	MATQITSRHGFTDNFWLQMAGLVIVTLVVIALAAEYIW
Ga0187817_102301941	3300017955	Freshwater Sediment	MDTQVGNTSGFTNNFWVQIAALVIVTLVVIALAAQYIW
Ga0187817_107757671	3300017955	Freshwater Sediment	QITPKSGFANNFWVQMAAMVIVTIVVIALAAKYIW
Ga0187779_107571571	3300017959	Tropical Peatland	MDTQITRKSGLTNNLWVQMAALVIVTIAVIALAAKFIW
Ga0187778_101808543	3300017961	Tropical Peatland	MNMQTKGSLANNFWLQMAALVIVTVVIIALAAKYIW
Ga0187783_100414284	3300017970	Tropical Peatland	MNTQIRKRGGLANNFWVQAAALAVVAVVLIALAAKYVW
Ga0187783_101420481	3300017970	Tropical Peatland	MDSQTTNKTGLANNFWMQTAALVIVVVVLIALAAKYIW
Ga0187781_106725492	3300017972	Tropical Peatland	MNTQTDSKSGLANNLWVQIAALVIVGVVLIVFAAKYIW
Ga0187780_105352011	3300017973	Tropical Peatland	MDTQITHKSGLANNLWVQMAALVIVTIAVIALAAKFIW
Ga0187777_101140333	3300017974	Tropical Peatland	MNTQLENKGGLTNNFWVQIAALIIVTLVVIALAAKYIW
Ga0187822_103584302	3300017994	Freshwater Sediment	MDTQVGNTSGFTNNFWVQIAALVIVTLVVIALAAQY
Ga0187815_101113531	3300018001	Freshwater Sediment	MDTQITPKRGFTNNVWVQIAALVIVTIVVIALAAKYIW
Ga0187815_105122682	3300018001	Freshwater Sediment	MDTQITRKSGFANNFWVQMTALVIVTIAVIALAAKYVW
Ga0187805_105738202	3300018007	Freshwater Sediment	RGGGDSAMDTQITGKSGFANNVWVQMAALVIVTIAVIALAAKYIW
Ga0187784_1000078421	3300018062	Tropical Peatland	MNMQTKGSLANNFWLQIAALVIVTVVIIALAAKYIW
Ga0187784_111546221	3300018062	Tropical Peatland	MNAQTTHKGGFASSFWLQRAALVVVTVVALAAKYI
Ga0066667_121951931	3300018433	Grasslands Soil	MNTQIFNKGGFANNLWVQMAALVIVTLVVIALAAKYVW
Ga0193751_10020677	3300019888	Soil	MNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW
Ga0193751_10097192	3300019888	Soil	MNTQADSKSGFAKNFWVQMAALVIVAVVLIALAAKYVW
Ga0193751_10103596	3300019888	Soil	MDTQITRKSGFANNFWVQMTALVIVTVVVIALAAKYVW
Ga0193749_10077052	3300020010	Soil	MNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYV
Ga0210399_101467923	3300020581	Soil	MNAQTSNRTGFANNFWVQMAAMVIVTVVIIALAAKYIW
Ga0210406_112971181	3300021168	Soil	MNTQTFNKSGFANSFWVQIAVLVIVTLVVIAVAAKYVW
Ga0210391_110266272	3300021433	Soil	MNAQTSNKAGFANNFWVQMAALVVVTVGIIALAAKYIW
Ga0126371_100781838	3300021560	Tropical Forest Soil	MATQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW
Ga0126371_101179871	3300021560	Tropical Forest Soil	MDSQITSKSGLANDFWLQMAALAILTIVVIALAAKYVW
Ga0126371_102914463	3300021560	Tropical Forest Soil	MDTRISPKTGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0126371_103314282	3300021560	Tropical Forest Soil	MDTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW
Ga0126371_109972143	3300021560	Tropical Forest Soil	MATQITSKHGFTDNFWLQMAALVIVTLVMIALAAEYVW
Ga0212123_100628853	3300022557	Iron-Sulfur Acid Spring	MNTQIRNIGSFANNFWVQMAALVVVVAIVIAFAAKYLW
Ga0207693_104429881	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MNTQASNKPGFANNLWVQMAALVIVTVVIIALAAKY
Ga0207665_113026772	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MNTQIFNKGGLAGNFWLQIAALVIVTLVVVALAAKYVW
Ga0209473_12443541	3300026330	Soil	MDTQLANKGDITNNFWLQMAALVIVTVAMIALAAKYVW
Ga0209577_102952551	3300026552	Soil	MNTQIFNKGGFANNLWVQMATLVIVTLVVVALAAMYVW
Ga0209577_103697193	3300026552	Soil	MNTQTFNKGGFANNFWVQIAALVIVTLVVIDVAAKYVW
Ga0207730_10126681	3300026896	Tropical Forest Soil	MDTQITHKSGLANNLWVQMAALVFVTIAVIALAAKFIW
Ga0207817_10169062	3300026979	Tropical Forest Soil	MDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0207784_10307951	3300026997	Tropical Forest Soil	MATQITSKHGFTDNFWLQMAALVIMTLIVILAAEYVW
Ga0207766_10306473	3300027042	Tropical Forest Soil	MDTQITRKSGLANNFWVQMAALVIVTIAVIALAAKFIW
Ga0209325_10059932	3300027050	Forest Soil	MNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW
Ga0207826_11555502	3300027680	Tropical Forest Soil	MATQITSKHGFTDNFWLQMAALVIMTLVVIALAAEYIW
Ga0209040_104644891	3300027824	Bog Forest Soil	SSMNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW
Ga0209060_1000006197	3300027826	Surface Soil	MTTQAANKNSLANNLWVQMAALIVVTVVIIALAAKYIW
Ga0209580_106579101	3300027842	Surface Soil	MSTQAANKNSLANNLWVQMAALIVVTVVVIALAAKYIW
Ga0209465_102314812	3300027874	Tropical Forest Soil	MATQITSKHGFADNFWLQMAALVIVTLVVIALAAEYVW
Ga0209067_101197623	3300027898	Watersheds	MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW
Ga0209067_108288341	3300027898	Watersheds	MDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYI
Ga0209067_109148922	3300027898	Watersheds	MATQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYV
Ga0209583_101939772	3300027910	Watersheds	MNTQTSNKAGFANNFWVQMAALVIVTVAIIALAAKYIW
Ga0209583_104039372	3300027910	Watersheds	RPRGGDPAMDTQIPRKSGFANNFWVQMAALVIVTIAVIALAAKYIW
Ga0075377_116860151	3300030844	Soil	MNTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYLW
Ga0170834_1094794391	3300031057	Forest Soil	MNTQTSNKAGFANNVWMQVAALVVVTVVIIALGAKYIW
Ga0170834_1139050661	3300031057	Forest Soil	MNTQTFNKGGFANNFWVQIAVLVIVTLVVIAVAAKYVW
Ga0170823_120074222	3300031128	Forest Soil	MNTQIRNIGGLANNFWVQMAALVIVTLVVIAVAANYIW
Ga0170823_129759061	3300031128	Forest Soil	MNTQTSNKAGFANNVWMQVAALVVVTVVIIALAAKYIW
Ga0170823_160984641	3300031128	Forest Soil	MDTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYLW
Ga0170823_164838751	3300031128	Forest Soil	MNTQIFKTGGFANNFWVQMAALVIVTLVVIALAAKYVW
Ga0170824_1041445443	3300031231	Forest Soil	MNTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYIW
Ga0170824_1082395431	3300031231	Forest Soil	MDTQIAPKSGFANNVWVQIAALVIVTIVVIALAAKYIW
Ga0170824_1181991752	3300031231	Forest Soil	MNTQIRNTGGFINNFWVQIAALVVVTLAVIALAAKYIW
Ga0170824_1279454272	3300031231	Forest Soil	MNTQIRNTGGFTNNFWVQMAALVIVSLAVIALAAKYIW
Ga0170818_1020475011	3300031474	Forest Soil	MDTRIAPKSGFANNFWVQMAALVIVTIVVIALAAKYIW
Ga0170818_1045487951	3300031474	Forest Soil	QIRNTGGFTNNFWVQMAALVIVSLAVIALAAKYIW
Ga0318541_100631982	3300031545	Soil	MIIQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW
Ga0318541_102080851	3300031545	Soil	MATQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYVW
Ga0318541_108491161	3300031545	Soil	MATQIASKHGFTDNLWLQMAALVIVTLVVIALAAEYVW
Ga0310915_104993292	3300031573	Soil	MDTQLANKSGLTNNFWVQIAALVILTVVVIALAAEYIW
Ga0318561_104866562	3300031679	Soil	MDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0318560_105107191	3300031682	Soil	MNTQIRNTGGLVNNIWVQMAALVIVTLVVIALAAKYIW
Ga0310686_1191567663	3300031708	Soil	MSTRIGNKGGFANITWVQLAALVIVPAFLIAVAAKCVWLPT
Ga0306917_104397702	3300031719	Soil	MPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0306917_114173261	3300031719	Soil	MNTQTSNKAGLANNFWVQMAAMVVVTVVIIALAAK
Ga0318492_102544842	3300031748	Soil	MNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYLW
Ga0318509_101256021	3300031768	Soil	MATQITSKHGFTDNFWLQRAALVIMTLVVIALAAEYVW
Ga0318546_102271531	3300031771	Soil	MDTQISPQTGFTNNAWVQITALVVLTIVVIALAAK
Ga0306919_101852363	3300031879	Soil	MATQITSKHGFTDNFWLQMAALVIMTLVVIALAAEYVW
Ga0306919_103196342	3300031879	Soil	MNTQTSNKTGFANNFWVQMTALVVVTVLIIALAAKYIW
Ga0306925_101223494	3300031890	Soil	MDTQISPKTGFTNNAWVQITALVVLTILVIALAAKYIW
Ga0306925_104185961	3300031890	Soil	IRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0306925_105222411	3300031890	Soil	MDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW
Ga0318520_110738782	3300031897	Soil	HMNTQTSNKAGFANNFWVQMAALVVVTVVIIALAAKYIW
Ga0306923_100931393	3300031910	Soil	MNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW
Ga0306923_113209011	3300031910	Soil	MNTQSANKGGLANNLWVQMAALVIVTVVVIALAAKFIW
Ga0306921_100338166	3300031912	Soil	MDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0306921_102413971	3300031912	Soil	MPNRGEVIRMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310912_101146591	3300031941	Soil	NRGEVIRMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310912_102953231	3300031941	Soil	LDTQITHKSGLANNLWVQMAALLIVTIVVIALAAKFIW
Ga0310912_107571082	3300031941	Soil	VCPSRGGDNMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW
Ga0310913_100589051	3300031945	Soil	VIRLDTQITHKSGLANNLWVQMAALLIVTIVVIALAAKFIW
Ga0310910_100784592	3300031946	Soil	MIREGGDQMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW
Ga0310909_108332391	3300031947	Soil	FSWITVCPSRGGDNMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310911_108479481	3300032035	Soil	VDTQITRKSGFVNNFWVQMAALLIVTIAVIALAAKYVW
Ga0318533_102163292	3300032059	Soil	MDTQISPQTGFTNNAWVQITALVVLTIVVIALAAKYI
Ga0306924_115616781	3300032076	Soil	DMDTQISPKTGFTNNAWVQITALVVLTIIVIALAAKYIW
Ga0307471_1002871613	3300032180	Hardwood Forest Soil	MNTQSSNKAGFANNFWVQMAALVIVTVVIIALAAKYIW
Ga0307471_1004724633	3300032180	Hardwood Forest Soil	MNTQASNKPGFANNLWVQMAALAIVTVVIIALAAKYIW
Ga0307471_1008261242	3300032180	Hardwood Forest Soil	MDTRAGNKSGFASNLWVQMAALVIVVLVLIALAAKYIW
Ga0307471_1016329702	3300032180	Hardwood Forest Soil	MNTQISNKAGFANNFWVQMAALVIVTVAIIALAAKYIW
Ga0306920_1036649501	3300032261	Soil	MNTQTSNKAGFANNFWVQMTALAVVTVGIIALAAKYIW
Ga0306920_1042529852	3300032261	Soil	MPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW
Ga0310914_112776402	3300033289	Soil	DTQITRKSGLANNLWVQMAALVIVTIVVIALAVKFIW
Ga0318519_104458031	3300033290	Soil	AAQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYVW
Ga0318519_106479001	3300033290	Soil	MNTQTSNKAGFANNFWVQMAALVVVTIVIIALAAKYIW

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F033197

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences