NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033293

Metagenome / Metatranscriptome Family F033293

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033293
Family Type Metagenome / Metatranscriptome
Number of Sequences 177
Average Sequence Length 74 residues
Representative Sequence MIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQG
Number of Associated Samples 88
Number of Associated Scaffolds 177

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.49 %
% of genes near scaffold ends (potentially truncated) 84.75 %
% of genes from short scaffolds (< 2000 bps) 97.18 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (89.266 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(82.486 % of family members)
Environment Ontology (ENVO) Unclassified
(93.220 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(83.051 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.17%    β-sheet: 0.00%    Coil/Unstructured: 82.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 177 Family Scaffolds
PF03732Retrotrans_gag 2.26
PF00078RVT_1 1.13
PF00665rve 0.56
PF13650Asp_protease_2 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 177 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.56
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.56
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.56
COG4584TransposaseMobilome: prophages, transposons [X] 0.56

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.92 %
UnclassifiedrootN/A5.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005841|Ga0068863_100449602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1264Open in IMG/M
3300005842|Ga0068858_101077266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum789Open in IMG/M
3300009092|Ga0105250_10405319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Furfurilactobacillus → Furfurilactobacillus rossiae605Open in IMG/M
3300009553|Ga0105249_13479971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300009975|Ga0105129_107008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum698Open in IMG/M
3300009975|Ga0105129_114399All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300009980|Ga0105135_105825All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor830Open in IMG/M
3300009981|Ga0105133_102853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor980Open in IMG/M
3300009981|Ga0105133_129562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300009990|Ga0105132_121894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum637Open in IMG/M
3300009990|Ga0105132_122473Not Available632Open in IMG/M
3300009992|Ga0105120_1044492Not Available553Open in IMG/M
3300009994|Ga0105126_1031355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300009995|Ga0105139_1058708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300009995|Ga0105139_1093509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300009995|Ga0105139_1097048Not Available565Open in IMG/M
3300010371|Ga0134125_12474943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300010401|Ga0134121_10908968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum856Open in IMG/M
3300010401|Ga0134121_11963792All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300014326|Ga0157380_12713482All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300014968|Ga0157379_11024163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300014968|Ga0157379_12206594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300015270|Ga0182183_1017499All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum836Open in IMG/M
3300015270|Ga0182183_1054365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300015270|Ga0182183_1074777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015270|Ga0182183_1091640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300015270|Ga0182183_1095432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015280|Ga0182100_1003594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1361Open in IMG/M
3300015280|Ga0182100_1074291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300015284|Ga0182101_1032169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum733Open in IMG/M
3300015284|Ga0182101_1061043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300015290|Ga0182105_1043318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum690Open in IMG/M
3300015293|Ga0182103_1055443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300015293|Ga0182103_1089745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015297|Ga0182104_1078148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus590Open in IMG/M
3300015301|Ga0182184_1046255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300015301|Ga0182184_1055373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus619Open in IMG/M
3300015306|Ga0182180_1036329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum709Open in IMG/M
3300015306|Ga0182180_1092990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300015309|Ga0182098_1128212All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015310|Ga0182162_1013047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1074Open in IMG/M
3300015310|Ga0182162_1105425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015311|Ga0182182_1053558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015312|Ga0182168_1094651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015312|Ga0182168_1111070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300015312|Ga0182168_1129192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300015313|Ga0182164_1010076All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1210Open in IMG/M
3300015313|Ga0182164_1029427All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum874Open in IMG/M
3300015313|Ga0182164_1030440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum864Open in IMG/M
3300015313|Ga0182164_1039542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum792Open in IMG/M
3300015313|Ga0182164_1052970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum718Open in IMG/M
3300015313|Ga0182164_1112921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015313|Ga0182164_1120347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015313|Ga0182164_1131544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300015315|Ga0182120_1024075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum938Open in IMG/M
3300015316|Ga0182121_1006749All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae → Botrytis → Botrytis cinerea1423Open in IMG/M
3300015316|Ga0182121_1020872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1022Open in IMG/M
3300015317|Ga0182136_1033247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum846Open in IMG/M
3300015317|Ga0182136_1041946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum784Open in IMG/M
3300015317|Ga0182136_1090794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015318|Ga0182181_1062356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300015319|Ga0182130_1018258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum986Open in IMG/M
3300015319|Ga0182130_1108408All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015324|Ga0182134_1035198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum849Open in IMG/M
3300015326|Ga0182166_1029402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum879Open in IMG/M
3300015326|Ga0182166_1037317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis816Open in IMG/M
3300015326|Ga0182166_1071393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300015326|Ga0182166_1112229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300015327|Ga0182114_1020968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1061Open in IMG/M
3300015328|Ga0182153_1039764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum823Open in IMG/M
3300015328|Ga0182153_1108020All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum577Open in IMG/M
3300015328|Ga0182153_1146426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300015329|Ga0182135_1018506All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1058Open in IMG/M
3300015329|Ga0182135_1137578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis528Open in IMG/M
3300015330|Ga0182152_1042193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum819Open in IMG/M
3300015330|Ga0182152_1059960All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300015330|Ga0182152_1130390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300015331|Ga0182131_1093644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum618Open in IMG/M
3300015331|Ga0182131_1130963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015331|Ga0182131_1142753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300015332|Ga0182117_1064069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum751Open in IMG/M
3300015332|Ga0182117_1093191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300015333|Ga0182147_1072003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015333|Ga0182147_1148293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015333|Ga0182147_1160837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi514Open in IMG/M
3300015334|Ga0182132_1059115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum766Open in IMG/M
3300015334|Ga0182132_1107101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300015335|Ga0182116_1098209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300015335|Ga0182116_1178011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015336|Ga0182150_1025827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum988Open in IMG/M
3300015336|Ga0182150_1059937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum747Open in IMG/M
3300015336|Ga0182150_1102742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300015336|Ga0182150_1139737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300015337|Ga0182151_1040585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum854Open in IMG/M
3300015337|Ga0182151_1053390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum777Open in IMG/M
3300015337|Ga0182151_1107329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300015337|Ga0182151_1134904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300015337|Ga0182151_1165581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300015338|Ga0182137_1128127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015338|Ga0182137_1164809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300015339|Ga0182149_1042062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus874Open in IMG/M
3300015339|Ga0182149_1062125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum759Open in IMG/M
3300015339|Ga0182149_1153976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis529Open in IMG/M
3300015340|Ga0182133_1052578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum850Open in IMG/M
3300015340|Ga0182133_1110419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum639Open in IMG/M
3300015348|Ga0182115_1060839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1128Open in IMG/M
3300015348|Ga0182115_1125541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum816Open in IMG/M
3300015348|Ga0182115_1146384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum756Open in IMG/M
3300015348|Ga0182115_1219782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum607Open in IMG/M
3300015348|Ga0182115_1281798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300015349|Ga0182185_1246843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300015350|Ga0182163_1138356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M
3300015350|Ga0182163_1145658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum735Open in IMG/M
3300015350|Ga0182163_1199775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum626Open in IMG/M
3300015350|Ga0182163_1232474All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum578Open in IMG/M
3300015352|Ga0182169_1055565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1200Open in IMG/M
3300015352|Ga0182169_1300975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300015353|Ga0182179_1009993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1937Open in IMG/M
3300015353|Ga0182179_1060516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1059Open in IMG/M
3300015353|Ga0182179_1078684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum956Open in IMG/M
3300015353|Ga0182179_1138671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300015353|Ga0182179_1231027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum594Open in IMG/M
3300015353|Ga0182179_1236798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum587Open in IMG/M
3300015354|Ga0182167_1061255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1318Open in IMG/M
3300015354|Ga0182167_1066499All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1273Open in IMG/M
3300015354|Ga0182167_1104963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1034Open in IMG/M
3300015354|Ga0182167_1193269All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum746Open in IMG/M
3300015354|Ga0182167_1247784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum643Open in IMG/M
3300015354|Ga0182167_1335177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300017412|Ga0182199_1033858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum973Open in IMG/M
3300017412|Ga0182199_1170226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus542Open in IMG/M
3300017414|Ga0182195_1054954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis858Open in IMG/M
3300017414|Ga0182195_1155807All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300017414|Ga0182195_1177892All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300017422|Ga0182201_1050539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum719Open in IMG/M
3300017432|Ga0182196_1106433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
3300017432|Ga0182196_1121521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum550Open in IMG/M
3300017435|Ga0182194_1145122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis515Open in IMG/M
3300017439|Ga0182200_1009006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1317Open in IMG/M
3300017439|Ga0182200_1044485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300017439|Ga0182200_1059112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum717Open in IMG/M
3300017439|Ga0182200_1069342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
3300017440|Ga0182214_1080372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300017694|Ga0182211_1117363All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum627Open in IMG/M
3300017694|Ga0182211_1158777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300020023|Ga0182178_1010690All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300020023|Ga0182178_1017463All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300025972|Ga0207668_11165347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300028054|Ga0268306_1015608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300028055|Ga0268338_1003459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1047Open in IMG/M
3300028055|Ga0268338_1043916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300028140|Ga0268334_1008415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum660Open in IMG/M
3300028253|Ga0268316_1025307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300028262|Ga0268310_1033604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum586Open in IMG/M
3300028467|Ga0268333_1010179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300032465|Ga0214493_1086788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum745Open in IMG/M
3300032468|Ga0214482_1006385All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1808Open in IMG/M
3300032468|Ga0214482_1047481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum830Open in IMG/M
3300032502|Ga0214490_1102132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum655Open in IMG/M
3300032551|Ga0321339_1130129Not Available561Open in IMG/M
3300032591|Ga0214484_1032494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1078Open in IMG/M
3300032593|Ga0321338_1289003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum589Open in IMG/M
3300032689|Ga0214497_1062019All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum830Open in IMG/M
3300032697|Ga0214499_1243682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300032698|Ga0214485_1082021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum613Open in IMG/M
3300032699|Ga0214494_1020357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1212Open in IMG/M
3300032761|Ga0314733_1049431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum805Open in IMG/M
3300032791|Ga0314748_1087853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300032914|Ga0314750_1084507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum739Open in IMG/M
3300032915|Ga0314749_1062680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum802Open in IMG/M
3300033525|Ga0314758_1078377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum925Open in IMG/M
3300033538|Ga0314755_1188539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere82.49%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated6.78%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere3.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068863_10044960213300005841Switchgrass RhizosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIISEGPTKRTQWSHSPITFSEEDVNLIS
Ga0068858_10107726623300005842Switchgrass RhizosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSKGPTKRTQWSHSPITFSEEDVNLISYPHTDAL
Ga0105250_1040531913300009092Switchgrass RhizosphereMIMPISGGSTLDFENNRQRRDYFRQVHCIVSEGLTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTGS
Ga0105249_1347997123300009553Switchgrass RhizosphereMIMPISGGSTLEFQNKRQRSDYFRQVNSILVDGPTKKTPWSHMPIIFSEEDMSLNSYPHTDAMVIEANI
Ga0105129_10700813300009975Switchgrass AssociatedMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRI
Ga0105129_11439913300009975Switchgrass AssociatedLKQENQTNQNAQPAALPTFGRIMPISGGSSLEFKNKKQRRNYFQQVHSIMVDGPIQKTQWSHTPIAFSEEDVNLLSFPHTDALVIEANI*
Ga0105135_10582513300009980Switchgrass AssociatedMIMPISGGSTMDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPH
Ga0105133_10285313300009981Switchgrass AssociatedMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTG
Ga0105133_12956213300009981Switchgrass AssociatedMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSSITFFEEDVNLISYPHTDALVIEANIQGWRIGKILV
Ga0105132_12189413300009990Switchgrass AssociatedMPISKGSSLKFKNKRQRKDYFRQIHSIMPEGPIKRTQWSHAPITFFEEDVDLLNYSHTDALVIEANIQG
Ga0105132_12247313300009990Switchgrass AssociatedPSPLPTFGMIMPISRGSSLDFENKRQRRNYFRQVHSIIPEGTFKRTQWSQSPITFSEEDVQLISYPHTYALVIEANIQG*
Ga0105120_104449223300009992Switchgrass AssociatedMPIFGGSTLDFENKRQRRDYFRQVHCIVSEGLTKRTQWSHSPITFTEEDVNLISYPHTNALVIEANI*
Ga0105126_103135513300009994Switchgrass AssociatedNSQPAALPSFGMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGRTKRTQWSHSPITFSEEDANLISYPHTDALVIEVNI*
Ga0105139_105870823300009995Switchgrass AssociatedMIMPITGGSTLEFQNKRQRRDYFRQVSSILVDGPAKKTPWHHMPITFSEEDMSLNSYPHTDAMVIEANIHVWTIRKILVD
Ga0105139_109350923300009995Switchgrass AssociatedMIMPISGGPTLDFENKRQRRDYFRQVHCIVSEDPTKRTQWSHYPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTGS
Ga0105139_109704813300009995Switchgrass AssociatedMIMPISWGSSLEFKNKRKRRDFSRQVHSILVDGPVKETQWSHMKIVYSKEDVDLLSFPHTDALVIDA
Ga0134125_1247494313300010371Terrestrial SoilMIMPISGGSTLGFQNKRQRRDYFRQVNNILVYGPTKKTPWSHMPITFSEEDMSLNSYLHTDAMVIEANIQGWT
Ga0134121_1090896813300010401Terrestrial SoilPKQENQTTNSQPAAILSFGMIMPISGGSTLDFENKRQRRDYFRQVHFIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQG*
Ga0134121_1196379223300010401Terrestrial SoilMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEAN
Ga0157380_1271348213300014326Switchgrass RhizosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKI
Ga0157379_1102416333300014968Switchgrass RhizosphereMIMPISGGSTLGFQNKQQRRDYFRQVNNILVDGPTKKTPWSHMPITFSEEDMSLNSYLHT
Ga0157379_1220659433300014968Switchgrass RhizosphereMIMPITGGSTLEFQNKRQRRDYFRQVSSILVDSPAKKNPWPHMPITFSEEDMSLNSYPHTDAMVIEANIQ
Ga0182183_101749923300015270Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISHPHTDALVIEANIQGWRIGKILV
Ga0182183_105436513300015270Switchgrass PhyllosphereMIMPISGGSSLEFENKKQRRNYFRQVHSIMVDGPVQKTQWSHMPIVFSEEDVNLLSFPHTDALVIDANIQGWTIGKILVDTGSSADIIF*
Ga0182183_107477713300015270Switchgrass PhyllosphereMIMPISRGSSLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFFEEDVNLISYPHTDALVIEANI
Ga0182183_109164023300015270Switchgrass PhyllosphereMIMPISGGSTLKFQNKRQHRDYFRQVISILVDGPTKKTPWSHMTITISEEDMSLNSYLHTDAMVIEANIQGWTIGKILVDTGSSA
Ga0182183_109543223300015270Switchgrass PhyllosphereMIMPISRRSSLEFENKRQRRDYFRLVHSFLVDGPVKKTQWSHLPIVFSEEDVDLLSFPHTDALVIEANIQGWSIGKIMV
Ga0182100_100359433300015280Switchgrass PhyllosphereMIMPISGGSALVFENKRQRRGYFRQVHCIVSEGPTKRTQWSHSRITFSEEDVNLISYLHTDALVIEANIQGW
Ga0182100_107429113300015280Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRKNYFRQVHSIIPEGTFKRTQWSQIPITFSEEEVQLISYPHTDALVIEANIQG*
Ga0182101_103216923300015284Switchgrass PhyllosphereMIMPISGGSSLEFVNKKQRRNYFRQVHSIMVDGPVQKTQWSHMPIVFSEEDVNLLSFPHTDALVIEANIQGWTIGKILVD
Ga0182101_106104313300015284Switchgrass PhyllosphereMIMPISGGSTLEFENKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANI*
Ga0182105_104331823300015290Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRRDYFRQVHTILVDGPVKKIQWSHLPIVFSEEDVDLLSFPHIDALVIDA
Ga0182103_105544313300015293Switchgrass PhyllosphereMIMPISGGSTLELQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFLEEDMSLNCYPHTDAMVIEANIQGWTI
Ga0182103_108974513300015293Switchgrass PhyllosphereMIMPISGCSTLDFENKRQRRDYFRQVHSIVSEGPTKRTQWSHSPITFSEEDVNLVSYPHTDALVIEANIQGWRIGRILVDTGSSAD
Ga0182104_107814813300015297Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSGGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRVGKILVDTGSFANIIFS
Ga0182184_104625513300015301Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRSDYFRQVNSILVDGPTKKTPWSHMPIIFSEEDMSLNSYPHTDAMVIEANIQGWTIGKILVDTGSSANIIF
Ga0182184_105537313300015301Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRIQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTGSSAD
Ga0182180_103632923300015306Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRKDYFRQVHSILVDGPAKKTPWSHMLITFSEEDMSLNSYPH
Ga0182180_109299013300015306Switchgrass PhyllosphereMIMPMPEGSTLNFENKRQHRDYFKQVHCIVSESPTKRTQWSHSPITFFEEDVNLITNPHTDALVIEANIQG*
Ga0182098_112821213300015309Switchgrass PhyllosphereMIMPIFGGSYLEFENKRQRKNYFRQVHSIMPEGLYRRTQWSQSPVTFSEED
Ga0182162_101304723300015310Switchgrass PhyllosphereMIMPISEGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVI
Ga0182162_110542533300015310Switchgrass PhyllosphereMIMPISGGFTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPIIFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTGSS
Ga0182182_105355813300015311Switchgrass PhyllosphereMIMPISGGSSLEFENKRPRRNYFRQVHSIMIDGPVQKTQWSHMPIVFSEEDVNLLSFPHTDALVIDANIQGWTLCRYYLFKHL
Ga0182168_109465113300015312Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRKNYFWQVHSIMLEGLYKRTQWSQSPITFSEEVVQLLSYPYIDALVIETNIQDWTIGKILV
Ga0182168_111107023300015312Switchgrass PhyllosphereMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDLSLNSYPHT
Ga0182168_112919213300015312Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRRNYFRQVHSIVPEGTFKRTQWSQTPITFSEEDMQLISYPHTDALVIEAN
Ga0182164_101007613300015313Switchgrass PhyllosphereNQNAQPTALPTFGRIMPISGGSSLEFENKKQRRNYFRQVHSIMVDGPIQKTQWSHLPIVFSEEDVNLLSFPHTDALVIEANIQG*
Ga0182164_102942723300015313Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQG*
Ga0182164_103044023300015313Switchgrass PhyllospherePLKQEPQGSQASQTSALPSFGIIMPIYRGSTLEFQNKRQRRDYFRQVHNILVDGPAKKTPWSHMPITFSEEDMSLNS*
Ga0182164_103954223300015313Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFTEEDINLISYPHT
Ga0182164_105297013300015313Switchgrass PhyllosphereMIMPIFEGSTLNFENKRQRRDYFKQVHCIVSESPTKRTQWSHSPIIFSEEDVNLIIYPHTDALVIEANIQGWRIGKILVDTGSSAD
Ga0182164_111292113300015313Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFFEEDVNLISYPHTDALVIEANIQGWRIGKILVDTGSSADII
Ga0182164_112034713300015313Switchgrass PhyllosphereMIMPISGGSSLDFENKRQWRNYFRQVHSIIPKGTFKRTQWSQTPITFSEEDVQLISYPHTDALVIEANIQGW
Ga0182164_113154423300015313Switchgrass PhyllosphereSSLEFENKKQRRNYFQQVHSIMVDGPIQKTQWSHMPIVFSEEDVNLLSLPHTDALVIEANIQGWTIGKILVDTGSSADIIF*
Ga0182120_102407523300015315Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRRNYFRQVHSIIPKGTFKRMQWSQTPITFSEEDVQLISYPHTDALVIEANI*
Ga0182121_100674913300015316Switchgrass PhyllosphereENQTNQNAQPTALPTFGRIMSISGGSSLEFENKKQRRNYFRQVHSIMVDGPVQKTQWSHMPIVFSKEDVNLLSFPHTDALVIEANI*
Ga0182121_102087223300015316Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRKNYFRQVHSIMVDGPVLKTQWSHMPIVFSEEDVNLLSFSHTDALVIDANI*
Ga0182136_103324733300015317Switchgrass PhyllosphereMPSFGMIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIKANIQGWTIGKIL
Ga0182136_104194613300015317Switchgrass PhyllosphereTFGMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEYVNLISYPHTDALVIEANIQG*
Ga0182136_109079413300015317Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNHISYPHTDALVIEANIQGWRIGKILCNGPGF
Ga0182181_106235623300015318Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITLSEEDVNLISYPHTDALVIDANIQGWRIGKILVDTGSSADI
Ga0182130_101825813300015319Switchgrass PhyllosphereGGSTLEFQNKRQRKDYFRQVNSILVDGPAKKTPRSHMAITFSEEDYSTS*
Ga0182130_110840813300015319Switchgrass PhyllosphereMIMPISGGSTLDFKNKRQCRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGW
Ga0182134_103519823300015324Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEGMSLNSYP
Ga0182166_102940213300015326Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVFEGPTKRTKWSHSPITFSEDDVNLISYPHTDALVIEANIQGWRIGKILVD
Ga0182166_103731713300015326Switchgrass PhyllosphereIMPISGGSSLDFENKWQWRNYFRHVHSIIPKGTFKRMQLSQTPITFSEEDVQLISYPHTDALVIEANI*
Ga0182166_107139313300015326Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQG
Ga0182166_111222923300015326Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRRNYFRQVHSIVVEGPVKKTQWSHLPIVFSEEDVDLLSFPHTDALVIDAN
Ga0182114_102096813300015327Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAIVIEANIQGWTIGK
Ga0182153_103976423300015328Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVI
Ga0182153_110802023300015328Switchgrass PhyllosphereMIVRISGGSTLEFQNKRQRKDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNS*
Ga0182153_114642623300015328Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRREYFRQVHSILVDGPVKKTQWSHMPIVFYEEDVDLL
Ga0182135_101850623300015329Switchgrass PhyllosphereMITPISEGSSLEFENKRQRKNYFGQVHSILPEGIFKRTQWSQSPVTFSEEDVQLLSYPHTDALVIESDIQGWTIGKILVALEVPHISSSQAPSTA*
Ga0182135_113757813300015329Switchgrass PhyllosphereISGGSSLDFENKRQRKNYFRQVHSIIPEGTFKRTQWSPIPITFSEEEVQLISYPHTDALVIEANIQG*
Ga0182152_104219333300015330Switchgrass PhyllosphereMIMPISGGSTLDFETKRQRRDYFRQVHCIVFEGPTKRTQWSHSPITFSEE
Ga0182152_105996013300015330Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDTGSSADII
Ga0182152_113039013300015330Switchgrass PhyllosphereMIMPISGGSTLDFENKRRRRDYFRQVHCIISEGPTKRTQWSHSPITFSEEEVSLISYPHTDALVIEANIQGWRIGKILVDTG
Ga0182131_109364413300015331Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHIDALVIEANIQGWRIGQI
Ga0182131_113096313300015331Switchgrass PhyllosphereMIMPISGGSCLEFENKRQRKNYFGQVHSILPEGIFKRTQWSQSPVTFSEEDVQLLSYPHTDALVIESDIQGWTIGKILVALEVP
Ga0182131_114275323300015331Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRNYFRQIHCIVSEGPTKRIQWSHSPITFSEEDVNLISYPHTDALVIEANIQGW
Ga0182117_106406923300015332Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVNNILVDGLAKKTPWSHMPITVSEEDMSLNSYPHTNAMVIEANIQGWTIEKILV
Ga0182117_109319113300015332Switchgrass PhyllosphereMIMPITGGSTLEFQNKSQHRDYFRQVSNILVDGPAKKTPWSHMPITFSEEDMSLNSYPHT
Ga0182147_107200313300015333Switchgrass PhyllosphereMIMPISGCLSLEFENKRQRKNYFRQVHPIIPEGIFKRTQWSESPITFSEEDVQLLSYPHTDALVIEANIQG*
Ga0182147_114829323300015333Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVFEGPTKRTQWSHSPITFSEEDVNLINYPHTDALVIEANIQGWRICKILVDTGSSADI
Ga0182147_116083713300015333Switchgrass PhyllosphereSTLEFQNKRQRRDYFRQVNNILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTD*
Ga0182132_105911513300015334Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVLCIISEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIVKILVDTGSSA
Ga0182132_110710113300015334Switchgrass PhyllosphereMPISGGSSLDFENKRQRRNYFRQVHSIIPKGTFKRTQWSQTPITFSEEDMQLISYPHIDA
Ga0182116_109820913300015335Switchgrass PhyllosphereMIMPISGGSTLEFQNKWQCRDYFRQVHSILVDGPAKKTPWSHMAITFSEEDMSLNSYPHTDAMVIEANIQGWTIEKILVDTGSSADIIFPSTF
Ga0182116_117801113300015335Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFKQVHYIVSEGPTKRTQWSHSPITFSEEDV
Ga0182150_102582713300015336Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRRNYFRQVHSIMVDGPIQKTQWSHTPIAFSEEDVNLLSFPHTDALVIEANIQGWTIRKILVDT*
Ga0182150_105993713300015336Switchgrass PhyllosphereMIMPISGGSTLGFQNKQQRRDYFRQVNNILVDGPTKKTPWSHMPITFSEED
Ga0182150_110274213300015336Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRKDYFRQINSILVDGPAKKKPWSHMPITFSEEDISLNSYPHTDAMVIESNIQGWTIGKILVDT
Ga0182150_113973723300015336Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVHNILVDGPAKKTPWSHMPITFSEEDMSLNS*
Ga0182151_104058533300015337Switchgrass PhyllosphereMIMPISGGSTLDFENKRQHRDYFRQVHCIVSEGPTKRTQWSHSPITFPEEDVNLISYPHTYALVIEANIQG*
Ga0182151_105339023300015337Switchgrass PhyllosphereSSLEFENKKQRRNYFRQVHSIMVDGPIQKTQWSHMPIVFSEEDVNLLSFPRTDALVIEANIQGWTIGKILLDTGSSADIIFQVPSTA*
Ga0182151_110732923300015337Switchgrass PhyllosphereMIMPIYGGSTLEFQNKKQRRDYFRQVHNILVEGPAKKTPWSHMPITFSEEDMSLNS
Ga0182151_113490413300015337Switchgrass PhyllosphereMIMPISGGSILDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVI
Ga0182151_116558123300015337Switchgrass PhyllosphereMIMPISGGSTLDFENKRQCRDYFRQVHCIISEGPTKRTQWSHSLITFSEGDVNLISYPHTYALVIEANIQGWRIGKILV
Ga0182137_112812723300015338Switchgrass PhyllosphereIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLSSYSHTDAMVIEANI*
Ga0182137_116480923300015338Switchgrass PhyllosphereMIMPISGGSSLEFQNKKQRNDYFRLVHSILVEGPVKKTQWSHTPITFTEEDVNLMSHPHTDALVIEANI*
Ga0182149_104206213300015339Switchgrass PhyllosphereMIMPISGGSSLKFENKRQRKYYFRQVHSIISEGPYKKTQWSHTPITFSEQDVDLHSYPHTDALVIEANIQGWTIGKILVDTGSSADIIFSST
Ga0182149_106212523300015339Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRRDYFRQVHSIMVEGPVKKTQWSHLPIVFSEEDVDLLSFPHTDALVIDANI*
Ga0182149_115397613300015339Switchgrass PhyllosphereSALPSFGMIMPISGGSTLEFQNKRQHRDYFRQVNNILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANI*
Ga0182133_105257823300015340Switchgrass PhyllosphereMIMPISGGSSLEFKNKRKRRDFFRQVHSILVDGLVKKMQWSHMKIVYSEEDVDLLSFPHTDAL
Ga0182133_111041923300015340Switchgrass PhyllosphereMIMPITGGSTLEFQNKSQHRDYFRQVSNILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIETNIQGWTIGK
Ga0182115_104334023300015348Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRGDYFRQVNSILVDGPAKKTPWSHMPITFLEEDMSLNSYPHTDAMVIEANIQHWTIGKILVDTGSSADIILSSTFDRMNMIE
Ga0182115_106083933300015348Switchgrass PhyllosphereMIMPISGGSTLGFQNKRQRRDYFRQVNNILVDGPAKKTPWSHMPITFLEEDMSLNCYPHTDAMVIEANIQGWTIGKILVD
Ga0182115_112554123300015348Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRWDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNFIGYPHTDALVIEANIQGWRIGKILVDTGSSADIIFS
Ga0182115_114638433300015348Switchgrass PhyllosphereMIMPIYGGSTLEFQNKKQRRDYFRQVHSILVEGPAKKTPWSHMPITFSEEDMSLNSYP
Ga0182115_121978223300015348Switchgrass PhyllosphereMIMPISGGSTLKFQNKRQHRDYFRQVNNILVDAPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIKANIQGWTIGKILVDAGSSA
Ga0182115_128179813300015348Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILV
Ga0182185_124684313300015349Switchgrass PhyllosphereMIMPIYGGSTLEFQNKRQRRDYFRQVNCILVDGPAKKTPWSRMPITFSEEDMSLNSYPHTDAMVIEANIQGWTIEKIL
Ga0182163_113835623300015350Switchgrass PhyllosphereMIMPISGGSTLEFENKRQRRDYFRQVNSILVDSPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANI*
Ga0182163_114565823300015350Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRKNYFWQVHSIMLEGLYKRTQWSQSPITLSEEDVQLLSYPHTDALVIEANIQGWT
Ga0182163_119977513300015350Switchgrass PhyllosphereMIMPTSGGSSLEFENKRQRKNYFRQVHFIIPEGIFKRTQWSQSPITFSEEDV
Ga0182163_123247413300015350Switchgrass PhyllosphereMIMPISGGSSLDFENKRQRRNYFRQVHSIMVEGPVKKTQWSHLPIVFSEEDVDLLSFPHTDALVIDANI*
Ga0182163_129375123300015350Switchgrass PhyllosphereMIMRISGSTLEFQNKRQRKDYFRQVNSILVDGPAKKTHWSPMPITFSEEDMSLNSYPHTDAMVMEANIQGWTIGEILVDTGSSAGIIFSSTF
Ga0182169_105556533300015352Switchgrass PhyllosphereMIMPIIGGSTNEFNSKRQRKNYFCQVHCIVSEGLTKKTQWSHTPITFSEGDLDLKSFPHMDALVIEANIQGW
Ga0182169_130097523300015352Switchgrass PhyllosphereMIMPISGGSTLGFQNKQQRRDYFRQVNNILVYGPTKKTPWSHMPITFSEEDMSLNSYLHTDAMVIEANIQGWTIGKILVDTGSSA
Ga0182179_100999323300015353Switchgrass PhyllosphereMPISGGSSLEFENKKQRRNYFRQVHSIMVDGPIQKTQWSHMPIVFSEEDVNLLSFPHTDALVIEANIQGWTIGKILVDTGSSADIIF
Ga0182179_106051623300015353Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRRDYFRQVHSILVDNPVKKTQWSHMPIIFSEEDVDLLRFPHTDALVIDANIQGWTIEKILVDTGSSADIIFSSTF
Ga0182179_107868423300015353Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRKDYFRQVNSILVDGPAKKTPRSHMAITFSEEDMSLNSYPHTDAMVIEANIQGWTI
Ga0182179_111269513300015353Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRGDYFRQVNSILVDGPAKKTPWSHMPITFLEEDMSLNSYPHTDAMVIEANIQHWTIGKILVDTGSSADIILSST
Ga0182179_113867133300015353Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVNNILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANIQGW
Ga0182179_123102713300015353Switchgrass PhyllosphereNSQPAALPTFGMIMPISGGSTLDFENKRQHRDYFRQVHCIVSEGPTKKTQWSHSPITFSEEDVNLISYPHTDALFIEANIQGWRIGRILY*
Ga0182179_123679813300015353Switchgrass PhyllosphereMIMPISGGSSHDFENKRQRKNYFWQVHSIMLEGLYKRTQWSQSPITLSEEDVQLLSYLHTDALVIEA
Ga0182167_106125533300015354Switchgrass PhyllosphereMIMPIFGGSYLEFENKRQRKNYFRQVHSIMPEGLYKKTQWSQSPITFSEENVHLLSYPHTDA
Ga0182167_106649923300015354Switchgrass PhyllosphereMPIFEGSTLDFENKRQRRDYFRQVHCIVSEGPTRRTQWSHSPITFSEDDVNLISYPHIDTLVIE
Ga0182167_110496313300015354Switchgrass PhyllosphereMIMPIYGGSTLEFQNKKQRRDYFRQVHSILVEGPAKKTPWSHMPITFSEEDMSLNSYPHTYALVIEANIHGWTIGKILVDT
Ga0182167_119326913300015354Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPTKKTPWSHMTITISEEDMSLNSYPHTDT
Ga0182167_124778413300015354Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYCRQVNSILVDGPAKKTPWYHMPITFSEEDMSLNSYPHT
Ga0182167_133517723300015354Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPSKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWR
Ga0182199_103385823300017412Switchgrass PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVHSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANIQVGPSEKY
Ga0182199_117022613300017412Switchgrass PhyllosphereMPISGGSTLDFKNKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDINLISYPHIDALVIEANIQGWRIGKILVDTGSSANII
Ga0182195_105495433300017414Switchgrass PhyllospherePIFGGSYLEFENKRQRKNYFRQVHSIMPEGLYKRTQWSQSPVTFSEEDVQLIRYPHTDALVIEANIQGWTI
Ga0182195_115580713300017414Switchgrass PhyllosphereMIMPISGESTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLICYPHTDALVIEANIQGWR
Ga0182195_117789223300017414Switchgrass PhyllosphereMIMPISGGSSLEFENKRQRRDYFRQVHSIMPEGVFNRTQWSYSPITFSEEELGGVHFFAL
Ga0182201_105053923300017422Switchgrass PhyllosphereMPISGGSTLDFENKRQRRDYFRQVHCIISEGPTKRTQWSHSPITFSEEDVNLIIYPHTDALVIEANIQGWRTG
Ga0182196_110643313300017432Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEDDVNLISYPHTDALVIEANIQGW
Ga0182196_112152113300017432Switchgrass PhyllospherePIFGGSTLEFQNKRQRRDYFRQVHNILVDGPAKKTPWSHMPITFSEEDMSLNS
Ga0182194_114512213300017435Switchgrass PhyllosphereGGSTLEFENKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANI
Ga0182200_100900613300017439Switchgrass PhyllospherePPKQENQTTNSQPAALPSFGMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEYVNLISYPHTDALVIEANIQG
Ga0182200_104448523300017439Switchgrass PhyllosphereMIMPISGGSTLDFEKKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHADALVIE
Ga0182200_105911223300017439Switchgrass PhyllosphereMIIPISGGSTLEFQNKRQRRDYFRQVNNILVDGPTKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEA
Ga0182200_106934223300017439Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIISEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEGNMQGWRIGKIIVDTGSSADIIFSD
Ga0182214_108037223300017440Switchgrass PhyllosphereMIMPISGGSTLELQNKRQRMDYFRQVNNILVDGPAKKTPWSHMPITFLEEDMSLNCYPHTDAMVIEATIQGW
Ga0182211_111736323300017694Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEA
Ga0182211_115877713300017694Switchgrass PhyllosphereMPISGGSSLDFENKRQRKNYFWQVHSIMLEGLYKRTQWSQSPITLSEEDVQLLSYLHTDALVIEANIQ
Ga0182178_101069013300020023Switchgrass PhyllosphereMIMPISRGSTLEFQNKRQRRDYFRQVHSILVNGPAKKTPWSHMPITFSEKDMSLN
Ga0182178_101746313300020023Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHT
Ga0207668_1116534723300025972Switchgrass RhizosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQ
Ga0268306_101560813300028054PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDA
Ga0268338_100345923300028055PhyllosphereMIMPISGGSTLEFQNKRQHRDYFRQVHNILVDGPAKKTPWSHMPITFSEEDMSLNS
Ga0268338_104391613300028055PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSKGPTKRTQWSHSPIIFSEEDVNLISYPHTDALIIEANIQGWRIGKILVD
Ga0268334_100841523300028140PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSKEDVNLISYPHTDALVIEAN
Ga0268316_102530713300028253PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIG
Ga0268310_103360413300028262PhyllosphereMIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTHWSHMPITFSEEDMSLNSYPHTDAMVIEANIQGWTIRQV
Ga0268264_1057871323300028381Switchgrass RhizosphereMIMPISGGSTLEFQNKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHSDAMVIEANIQGWTIGKILVDIGSSAGIIFSSTFD
Ga0268333_101017923300028467PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKILVDT
Ga0214493_108678823300032465Switchgrass PhyllosphereMPIFGGSTLDFENKRQRRDYFRQVHCIVSECPTKRTQWSHSPITFSEEDVNLISYP
Ga0214482_100638513300032468Switchgrass PhyllosphereENQTNQNAQPAALPTFGMIIPISGGSSLEFENKKQRKNYFRQVHSIMVDGPVQKTQWSHMPIVFSEEDVNLLSFPHTDALIIEANIQG
Ga0214482_104748113300032468Switchgrass PhyllospherePISEGSTLDFENKRQCGDYFRQVHCIFSEGPTKRTQWSHSPITFSEEDINLISYPHTDALVIEANIQC
Ga0214490_100077713300032502Switchgrass PhyllosphereLPPPPAHPPKQENLTTNGQPAALPAFGMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSLITFSEEDVNLISYPHIDSLVIEANIQG
Ga0214490_110213223300032502Switchgrass PhyllosphereMPISGGSTLDFENKRQHRDYFRQVNCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTGALVIEA
Ga0321339_113012913300032551Switchgrass PhyllosphereNSQPAALPSFGMIMPIFGGSTLDFENKRQRRDYFRQVHCIISEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANI
Ga0214484_103249423300032591Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDINLISYPHTDALVIEANIQC
Ga0321338_128900333300032593Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEANIQGWRIGKIL
Ga0214497_106201923300032689Switchgrass PhyllosphereMIMPISEGSSLEFENKKQSRNYFRQVHSIMVDGPIQKTQWSHMPIVFSEEDVNLLSFPHTDALIIEANIQG
Ga0214499_124368213300032697Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIISEGPTKRTQWSHSPITFSEEDVNLISYPHTGALVIEANIQGWRIGEILVNT
Ga0214485_108202123300032698Switchgrass PhyllosphereALPTFGMIIPISGGSSLEFENKKQRKNYFRQVHSIMVDGPVQKTQWSHMPIVFSEEDVNLLSFPHTDALVIDANIQGWTIGKILVDTGSSADIIF
Ga0214494_102035733300032699Switchgrass PhyllosphereMIMPISGGSTLDFENKRQRRDYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISY
Ga0314733_104943123300032761Switchgrass PhyllosphereQNAQPAALPTFGMIMPISGGSSLEFENKKQRRNYFRQVHSIMVDGPVQKTQWSHMPIVFSEEDVNLLSFPHTDALIIEANIQG
Ga0314748_108785323300032791Switchgrass PhyllosphereMIMPISGGSTLEFENKRQRRDYFRQVNSILVDGPAKKTPWSHMPITFSEEDMSLNSYPHTDAMVIEANI
Ga0314750_108450713300032914Switchgrass PhyllosphereQTTNSQLAALPTFGMIMPISGDSTLDFENKRQRRYYFRQVHCIVSEGPTKRTQWSHSPITFSEEDVNLISYPHTDALVIEENI
Ga0314749_106268013300032915Switchgrass PhyllosphereLKQENQTNQNAQPAALPTFGMIIPISGGSSLEFENKKQRRNYFRQVHSILVDGPVQKMQWSHMPIVFSEEDVNLLSFPHTDALIIEANIQG
Ga0314758_107837713300033525Switchgrass PhyllosphereLKQENLTSQNAQPAALPTFGRIMPISGGSSLEFENKKQRRNYFRQVHSIMVDGPIQKTQWSHMPVVFSEEDVNLLSFPHTDALVIEANIQG
Ga0314755_118853933300033538Switchgrass PhyllosphereMPISRGSTLEVQNKRQCRDYFRQVHSILVDGPVKKTPWSHLLITFSEEDMSLNSYPHTDAMVIEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.