Metagenome / Metatranscriptome Family F033338

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F033338
Family Type	Metagenome / Metatranscriptome
Number of Sequences	177
Average Sequence Length	48 residues
Representative Sequence	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR
Number of Associated Samples	65
Number of Associated Scaffolds	176

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	74.57 %
% of genes near scaffold ends (potentially truncated)	31.64 %
% of genes from short scaffolds (< 2000 bps)	78.53 %
Associated GOLD sequencing projects	55
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (77.966 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (71.186 % of family members)
Environment Ontology (ENVO)	Unclassified (98.870 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (71.186 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 57.89% β-sheet: 0.00% Coil/Unstructured: 42.11%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 176 Family Scaffolds
PF13148	DUF3987	19.32
PF12965	DUF3854	3.41
PF05930	Phage_AlpA	0.57

COG ID	Name	Functional Category	% Frequency in 176 Family Scaffolds
COG3311	DNA-binding transcriptional regulator AlpA	Transcription [K]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
All Organisms	root	All Organisms	22.03 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
cellular organisms	root	All Organisms → cellular organisms	20.90 %
Viruses	superkingdom	All Organisms → Viruses	1.13 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	20.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	20.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	20.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	20.90 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	5.08 %
Pseudanabaenales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales	2.26 %
Gloeomargaritales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales	1.13 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	1.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	5.08 %
Leptolyngbyaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae	2.26 %
Gloeomargaritaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae	1.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %
Synechococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	5.08 %
Leptolyngbya	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya	2.26 %
Gloeomargarita	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita	1.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %
Synechococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	5.08 %
unclassified Leptolyngbya	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya	2.26 %
Gloeomargarita	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita	1.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %
unclassified Synechococcus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus	0.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	77.97 %
Cyanophyceae	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	5.08 %
Leptolyngbya sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp.	2.26 %
Gloeomargarita	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita	1.13 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.13 %
Synechococcus sp. PCC 7502	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. PCC 7502	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002493\|JGI24185J35167_1072545	Not Available	626	Open in IMG/M
3300002510\|JGI24186J35511_1006412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2859	Open in IMG/M
3300002510\|JGI24186J35511_1009022	Not Available	2266	Open in IMG/M
3300002510\|JGI24186J35511_1029459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	892	Open in IMG/M
3300003688\|Ga0061020_1029243	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1552	Open in IMG/M
3300003688\|Ga0061020_1111230	Not Available	537	Open in IMG/M
3300005243\|Ga0068643_1033192	Not Available	1811	Open in IMG/M
3300005249\|Ga0068645_1003207	Not Available	905	Open in IMG/M
3300005250\|Ga0068635_1005338	Not Available	665	Open in IMG/M
3300005251\|Ga0068634_1022719	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2772	Open in IMG/M
3300005410\|Ga0068632_1005889	Not Available	625	Open in IMG/M
3300005411\|Ga0068647_1016685	Not Available	1636	Open in IMG/M
3300005413\|Ga0068633_1014157	Not Available	972	Open in IMG/M
3300005413\|Ga0068633_1016100	Not Available	759	Open in IMG/M
3300005414\|Ga0068646_1007356	Not Available	826	Open in IMG/M
3300005452\|Ga0068706_1065402	Not Available	646	Open in IMG/M
3300005452\|Ga0068706_1086137	Not Available	549	Open in IMG/M
3300005452\|Ga0068706_1101178	Not Available	504	Open in IMG/M
3300005453\|Ga0068705_10031732	Not Available	1900	Open in IMG/M
3300005498\|Ga0068649_1120450	Not Available	1896	Open in IMG/M
3300006848\|Ga0101768_1045021	Not Available	2120	Open in IMG/M
3300006848\|Ga0101768_1213494	Not Available	1129	Open in IMG/M
3300006849\|Ga0102029_1042138	Not Available	1535	Open in IMG/M
3300006849\|Ga0102029_1099686	Not Available	500	Open in IMG/M
3300007000\|Ga0102499_1000854	Not Available	648	Open in IMG/M
3300010023\|Ga0130028_100666	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1835	Open in IMG/M
3300010023\|Ga0130028_103007	Not Available	819	Open in IMG/M
3300010023\|Ga0130028_104536	Not Available	629	Open in IMG/M
3300010182\|Ga0124917_1137192	Not Available	1042	Open in IMG/M
3300010184\|Ga0124920_1041516	Not Available	1017	Open in IMG/M
3300010184\|Ga0124920_1112217	Not Available	1949	Open in IMG/M
3300010193\|Ga0124924_1022070	Not Available	959	Open in IMG/M
3300010193\|Ga0124924_1260034	Not Available	513	Open in IMG/M
3300010194\|Ga0124921_1207040	Not Available	1457	Open in IMG/M
3300010194\|Ga0124921_1213203	Not Available	1066	Open in IMG/M
3300010196\|Ga0124923_1096912	Not Available	926	Open in IMG/M
3300010257\|Ga0124913_1295679	Not Available	912	Open in IMG/M
3300026237\|Ga0209750_1003049	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	5288	Open in IMG/M
3300026237\|Ga0209750_1003376	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp.	4939	Open in IMG/M
3300026237\|Ga0209750_1026847	Not Available	1172	Open in IMG/M
3300026237\|Ga0209750_1086736	Not Available	531	Open in IMG/M
3300026280\|Ga0209017_10032632	Not Available	1330	Open in IMG/M
3300026509\|Ga0209809_1009139	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	4801	Open in IMG/M
3300027279\|Ga0209691_1008903	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	3383	Open in IMG/M
3300027279\|Ga0209691_1038425	Not Available	982	Open in IMG/M
3300027279\|Ga0209691_1055924	Not Available	741	Open in IMG/M
3300027279\|Ga0209691_1060442	Not Available	698	Open in IMG/M
3300027279\|Ga0209691_1067652	Not Available	639	Open in IMG/M
3300027279\|Ga0209691_1084562	Not Available	531	Open in IMG/M
3300028761\|Ga0272447_1004701	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	5580	Open in IMG/M
3300028761\|Ga0272447_1014851	Not Available	1884	Open in IMG/M
3300031245\|Ga0308395_1008844	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4144	Open in IMG/M
3300031245\|Ga0308395_1021796	Not Available	2091	Open in IMG/M
3300031245\|Ga0308395_1035796	Not Available	1418	Open in IMG/M
3300031245\|Ga0308395_1037077	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	1380	Open in IMG/M
3300031245\|Ga0308395_1054575	Not Available	1030	Open in IMG/M
3300031245\|Ga0308395_1094322	Not Available	693	Open in IMG/M
3300031245\|Ga0308395_1095036	Not Available	689	Open in IMG/M
3300031245\|Ga0308395_1122549	Not Available	577	Open in IMG/M
3300031245\|Ga0308395_1128633	Not Available	558	Open in IMG/M
3300031508\|Ga0308394_1020715	Not Available	1912	Open in IMG/M
3300031508\|Ga0308394_1030520	Not Available	1428	Open in IMG/M
3300031508\|Ga0308394_1039384	Not Available	1176	Open in IMG/M
3300031508\|Ga0308394_1042373	Not Available	1112	Open in IMG/M
3300031508\|Ga0308394_1065058	Not Available	807	Open in IMG/M
3300031508\|Ga0308394_1093936	Not Available	617	Open in IMG/M
3300031508\|Ga0308394_1124577	Not Available	506	Open in IMG/M
3300031509\|Ga0308399_1012355	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2317	Open in IMG/M
3300031509\|Ga0308399_1017603	Not Available	1856	Open in IMG/M
3300031509\|Ga0308399_1030497	Not Available	1288	Open in IMG/M
3300031509\|Ga0308399_1078458	Not Available	679	Open in IMG/M
3300031512\|Ga0308397_1021088	Not Available	1911	Open in IMG/M
3300031512\|Ga0308397_1022817	Not Available	1800	Open in IMG/M
3300031512\|Ga0308397_1040521	Not Available	1190	Open in IMG/M
3300031512\|Ga0308397_1043494	Not Available	1130	Open in IMG/M
3300031512\|Ga0308397_1067935	Not Available	820	Open in IMG/M
3300031513\|Ga0308412_1008837	Not Available	4885	Open in IMG/M
3300031514\|Ga0308390_1076633	Not Available	766	Open in IMG/M
3300031514\|Ga0308390_1102712	Not Available	611	Open in IMG/M
3300031515\|Ga0308396_1019775	All Organisms → Viruses → Predicted Viral	1836	Open in IMG/M
3300031515\|Ga0308396_1033140	All Organisms → Viruses → Predicted Viral	1258	Open in IMG/M
3300031515\|Ga0308396_1044667	Not Available	1015	Open in IMG/M
3300031516\|Ga0308398_1089799	Not Available	683	Open in IMG/M
3300031517\|Ga0308392_1010441	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2828	Open in IMG/M
3300031517\|Ga0308392_1051607	Not Available	944	Open in IMG/M
3300031517\|Ga0308392_1056714	Not Available	884	Open in IMG/M
3300031517\|Ga0308392_1118129	Not Available	533	Open in IMG/M
3300031518\|Ga0308389_1002927	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita	10308	Open in IMG/M
3300031518\|Ga0308389_1082638	Not Available	761	Open in IMG/M
3300031567\|Ga0308391_1014337	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2072	Open in IMG/M
3300031567\|Ga0308391_1125517	Not Available	524	Open in IMG/M
3300031568\|Ga0308393_1010288	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2883	Open in IMG/M
3300031568\|Ga0308393_1026259	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1512	Open in IMG/M
3300031568\|Ga0308393_1114619	Not Available	566	Open in IMG/M
3300031767\|Ga0308401_1010592	Not Available	2227	Open in IMG/M
3300031767\|Ga0308401_1056666	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	786	Open in IMG/M
3300031767\|Ga0308401_1070242	Not Available	689	Open in IMG/M
3300031776\|Ga0308415_1018113	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2093	Open in IMG/M
3300031783\|Ga0308418_1007256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. PCC 7502	4298	Open in IMG/M
3300031783\|Ga0308418_1052459	Not Available	991	Open in IMG/M
3300031783\|Ga0308418_1077962	Not Available	751	Open in IMG/M
3300031812\|Ga0308411_10132616	Not Available	905	Open in IMG/M
3300031812\|Ga0308411_10175811	Not Available	739	Open in IMG/M
3300031830\|Ga0308409_1055951	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	964	Open in IMG/M
3300031830\|Ga0308409_1058627	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	934	Open in IMG/M
3300031830\|Ga0308409_1084912	Not Available	721	Open in IMG/M
3300031830\|Ga0308409_1086119	Not Available	714	Open in IMG/M
3300031830\|Ga0308409_1098277	Not Available	652	Open in IMG/M
3300031830\|Ga0308409_1129157	Not Available	540	Open in IMG/M
3300031865\|Ga0308408_1005063	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	4724	Open in IMG/M
3300031865\|Ga0308408_1005784	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4320	Open in IMG/M
3300031865\|Ga0308408_1005903	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	4256	Open in IMG/M
3300031865\|Ga0308408_1018416	Not Available	1988	Open in IMG/M
3300031865\|Ga0308408_1084003	Not Available	724	Open in IMG/M
3300031865\|Ga0308408_1090400	Not Available	689	Open in IMG/M
3300031875\|Ga0308405_1038798	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1389	Open in IMG/M
3300031875\|Ga0308405_1063055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	979	Open in IMG/M
3300031875\|Ga0308405_1081241	Not Available	817	Open in IMG/M
3300031875\|Ga0308405_1086175	Not Available	783	Open in IMG/M
3300031875\|Ga0308405_1119004	Not Available	626	Open in IMG/M
3300031878\|Ga0308404_1011055	Not Available	2146	Open in IMG/M
3300031878\|Ga0308404_1071484	Not Available	686	Open in IMG/M
3300031878\|Ga0308404_1073694	Not Available	674	Open in IMG/M
3300031878\|Ga0308404_1104260	Not Available	550	Open in IMG/M
3300031878\|Ga0308404_1119806	Not Available	507	Open in IMG/M
3300031948\|Ga0308406_1052749	Not Available	912	Open in IMG/M
3300031948\|Ga0308406_1054452	Not Available	892	Open in IMG/M
3300031948\|Ga0308406_1066057	Not Available	781	Open in IMG/M
3300031948\|Ga0308406_1086751	Not Available	649	Open in IMG/M
3300031948\|Ga0308406_1097059	Not Available	602	Open in IMG/M
3300031950\|Ga0308417_1089923	Not Available	1119	Open in IMG/M
3300031958\|Ga0308410_1023825	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	2415	Open in IMG/M
3300031966\|Ga0308420_1157874	Not Available	676	Open in IMG/M
3300031966\|Ga0308420_1160436	Not Available	668	Open in IMG/M
3300031980\|Ga0308403_1016773	Not Available	1738	Open in IMG/M
3300031980\|Ga0308403_1057440	Not Available	796	Open in IMG/M
3300031980\|Ga0308403_1073150	Not Available	683	Open in IMG/M
3300032033\|Ga0308402_1047198	Not Available	863	Open in IMG/M
3300032034\|Ga0308407_1007023	Not Available	3600	Open in IMG/M
3300032034\|Ga0308407_1013618	Not Available	2296	Open in IMG/M
3300032034\|Ga0308407_1053745	Not Available	905	Open in IMG/M
3300032045\|Ga0308400_1000983	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	9646	Open in IMG/M
3300032045\|Ga0308400_1008020	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	2870	Open in IMG/M
3300032045\|Ga0308400_1023941	Not Available	1504	Open in IMG/M
3300032045\|Ga0308400_1042482	Not Available	1041	Open in IMG/M
3300032045\|Ga0308400_1105286	Not Available	570	Open in IMG/M
3300032049\|Ga0308416_1002726	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeomargaritales → Gloeomargaritaceae → Gloeomargarita	5530	Open in IMG/M
3300032049\|Ga0308416_1066916	Not Available	693	Open in IMG/M
3300032049\|Ga0308416_1073956	Not Available	645	Open in IMG/M
3300032056\|Ga0308310_1032609	Not Available	1612	Open in IMG/M
3300032056\|Ga0308310_1121870	Not Available	596	Open in IMG/M
3300032056\|Ga0308310_1126306	Not Available	580	Open in IMG/M
3300032057\|Ga0308421_1051119	Not Available	1153	Open in IMG/M
3300032057\|Ga0308421_1092950	Not Available	742	Open in IMG/M
3300032057\|Ga0308421_1106720	Not Available	669	Open in IMG/M
3300032058\|Ga0308419_1072747	Not Available	1079	Open in IMG/M
3300032058\|Ga0308419_1162123	Not Available	573	Open in IMG/M
3300032356\|Ga0308414_1011638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp.	4881	Open in IMG/M
3300032356\|Ga0308414_1011638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp.	4881	Open in IMG/M
3300032356\|Ga0308414_1038356	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	2145	Open in IMG/M
3300032356\|Ga0308414_1109136	Not Available	955	Open in IMG/M
3300032356\|Ga0308414_1154205	Not Available	717	Open in IMG/M
3300033886\|Ga0308413_003157	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp.	8036	Open in IMG/M
3300033886\|Ga0308413_030802	Not Available	1712	Open in IMG/M
3300033886\|Ga0308413_035457	Not Available	1543	Open in IMG/M
3300033886\|Ga0308413_038815	Not Available	1442	Open in IMG/M
3300033886\|Ga0308413_055677	Not Available	1106	Open in IMG/M
3300033886\|Ga0308413_089139	Not Available	787	Open in IMG/M
3300033886\|Ga0308413_123191	Not Available	627	Open in IMG/M
3300033886\|Ga0308413_154856	Not Available	535	Open in IMG/M
3300033886\|Ga0308413_159714	Not Available	524	Open in IMG/M
3300034646\|Ga0372965_033298	Not Available	716	Open in IMG/M
3300034649\|Ga0372972_015650	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae	1272	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Thermal Springs	Environmental → Aquatic → Thermal Springs	100.00%

Habitat	Taxonomy	Distribution
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	97.18%
Alkaline	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline	1.69%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	1.13%

Habitat	Taxonomy	Distribution
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	71.19%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	19.77%
Anoxygenic And Chlorotrophic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic	6.21%
Terrestrial Hot Spring Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat	1.69%
Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat	1.13%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002493	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012	Environmental	Open in IMG/M
3300002510	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300003688	Coassembly of YNP Bryant MS undermat 2012 and YNP Bryant MS upper layer 2012	Environmental	Open in IMG/M
3300005243	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005249	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005250	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005251	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005410	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005411	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005413	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005414	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005452	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG	Environmental	Open in IMG/M
3300005453	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG	Environmental	Open in IMG/M
3300005498	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006848	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300006849	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007000	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010023	Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly	Environmental	Open in IMG/M
3300010182	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010184	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010193	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010194	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010196	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010257	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300026237	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)	Environmental	Open in IMG/M
3300026280	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 (SPAdes)	Environmental	Open in IMG/M
3300026509	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)	Environmental	Open in IMG/M
3300027279	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)	Environmental	Open in IMG/M
3300028761	Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3	Environmental	Open in IMG/M
3300031245	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4	Environmental	Open in IMG/M
3300031508	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2	Environmental	Open in IMG/M
3300031509	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60	Environmental	Open in IMG/M
3300031512	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8	Environmental	Open in IMG/M
3300031513	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer	Environmental	Open in IMG/M
3300031514	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149	Environmental	Open in IMG/M
3300031515	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_Pe2	Environmental	Open in IMG/M
3300031516	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9	Environmental	Open in IMG/M
3300031517	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2	Environmental	Open in IMG/M
3300031518	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148	Environmental	Open in IMG/M
3300031567	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1	Environmental	Open in IMG/M
3300031568	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2	Environmental	Open in IMG/M
3300031767	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1	Environmental	Open in IMG/M
3300031776	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55	Environmental	Open in IMG/M
3300031783	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd	Environmental	Open in IMG/M
3300031812	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer	Environmental	Open in IMG/M
3300031830	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4	Environmental	Open in IMG/M
3300031865	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3	Environmental	Open in IMG/M
3300031875	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13	Environmental	Open in IMG/M
3300031878	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4	Environmental	Open in IMG/M
3300031948	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1	Environmental	Open in IMG/M
3300031950	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65	Environmental	Open in IMG/M
3300031958	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore	Environmental	Open in IMG/M
3300031966	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55	Environmental	Open in IMG/M
3300031980	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3	Environmental	Open in IMG/M
3300032033	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2	Environmental	Open in IMG/M
3300032034	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2	Environmental	Open in IMG/M
3300032045	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65	Environmental	Open in IMG/M
3300032049	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60	Environmental	Open in IMG/M
3300032056	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65	Environmental	Open in IMG/M
3300032057	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60	Environmental	Open in IMG/M
3300032058	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50	Environmental	Open in IMG/M
3300032356	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50	Environmental	Open in IMG/M
3300033886	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd	Environmental	Open in IMG/M
3300034646	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0000_MSt4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034649	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24185J35167_10725451	3300002493	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERNNSIR*
JGI24186J35511_10064121	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MKRTNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGHKNSVR*
JGI24186J35511_10090222	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MSTLLSGGSMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR*
JGI24186J35511_10294591	3300002510	Anoxygenic And Chlorotrophic Microbial Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRXRKNVRXNSIR*
Ga0061020_10292431	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR*
Ga0061020_11112301	3300003688	Anoxygenic And Chlorotrophic Microbial Mat	MKRSNLHNELYKLALGMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR*
Ga0068643_10331921	3300005243	Anoxygenic And Chlorotrophic Microbial Mat	GGSMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR*
Ga0068645_10032071	3300005249	Anoxygenic And Chlorotrophic Microbial Mat	PGGSMSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0068635_10053381	3300005250	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNGHKNSVR*
Ga0068634_10227193	3300005251	Anoxygenic And Chlorotrophic Microbial Mat	TSTLPPGGSMKRTNLHNELYKLAIAMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0068632_10058891	3300005410	Anoxygenic And Chlorotrophic Microbial Mat	LHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0068647_10166852	3300005411	Anoxygenic And Chlorotrophic Microbial Mat	MSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0068633_10141572	3300005413	Anoxygenic And Chlorotrophic Microbial Mat	MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR*
Ga0068633_10161001	3300005413	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLAIAMHKYNGRGVKWNLDYLLSQEQVRNKARNNSIR*
Ga0068646_10073561	3300005414	Anoxygenic And Chlorotrophic Microbial Mat	MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR*
Ga0068706_10654022	3300005452	Anoxygenic And Chlorotrophic	LHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGNKNSVR*
Ga0068706_10861371	3300005452	Anoxygenic And Chlorotrophic	MTSKNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR*
Ga0068706_11011781	3300005452	Anoxygenic And Chlorotrophic	RGWVQASSVMSTLFSGGGMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARSNKHNNRVR*
Ga0068705_100317321	3300005453	Anoxygenic And Chlorotrophic	NKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR*
Ga0068649_11204502	3300005498	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR*
Ga0101768_10450211	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	MSTNKLHNELYKLAIAMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR*
Ga0101768_12134943	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRTRKNGHKNSVR*
Ga0102029_10421382	3300006849	Anoxygenic And Chlorotrophic Microbial Mat	SRTSTLPPGGSMKRTNLHNELYKLAIAMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0102029_10996861	3300006849	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR*
Ga0102499_10008541	3300007000	Anoxygenic And Chlorotrophic Microbial Mat	MTSKNLHNELYKLALEMNKYNGRGVKHNLDYLLSQEQVRNKARNNSIR*
Ga0130028_1006662	3300010023	Terrestrial Hot Spring Microbial Mat	MKRSNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR*
Ga0130028_1030071	3300010023	Terrestrial Hot Spring Microbial Mat	SMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR*
Ga0130028_1045361	3300010023	Terrestrial Hot Spring Microbial Mat	MKRSNLHNELYKLAIAMHKYNGRGVKWNLDHLLSQEQVPKKTRNNSSR*
Ga0124917_11371922	3300010182	Anoxygenic And Chlorotrophic Microbial Mat	MKRTNLHNELYKLAIAMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0124920_10415162	3300010184	Anoxygenic And Chlorotrophic Microbial Mat	SMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR*
Ga0124920_11122172	3300010184	Anoxygenic And Chlorotrophic Microbial Mat	MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRTRKNGHKNSVR*
Ga0124924_10220701	3300010193	Anoxygenic And Chlorotrophic Microbial Mat	SSRTSTLPPGGSMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSVR
Ga0124924_12600341	3300010193	Anoxygenic And Chlorotrophic Microbial Mat	MKRTNLHNELYKLAIAMHKYNGRGVKHNLDYLVRQVEERNKAN
Ga0124921_12070402	3300010194	Anoxygenic And Chlorotrophic Microbial Mat	MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNGHKNSVR*
Ga0124921_12132031	3300010194	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVR*
Ga0124923_10969121	3300010196	Anoxygenic And Chlorotrophic Microbial Mat	TLPPGGSMSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR*
Ga0124913_12956791	3300010257	Anoxygenic And Chlorotrophic Microbial Mat	HNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR*
Ga0209750_10030493	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLAIAMHKYNGRGVKWNLDYLLSQEQVRNKARNNSIR
Ga0209750_10033765	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MSTLLSGGSMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR
Ga0209750_10268472	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR
Ga0209750_10867362	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRTRKNGHKNSVR
Ga0209017_100326321	3300026280	Anoxygenic And Chlorotrophic Microbial Mat	MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERNNSIR
Ga0209809_10091391	3300026509	Anoxygenic And Chlorotrophic	RTSSRASTLPPGGSMSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR
Ga0209691_10089032	3300027279	Anoxygenic And Chlorotrophic	MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR
Ga0209691_10384251	3300027279	Anoxygenic And Chlorotrophic	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR
Ga0209691_10559241	3300027279	Anoxygenic And Chlorotrophic	MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQVRNKARNNSIR
Ga0209691_10604422	3300027279	Anoxygenic And Chlorotrophic	MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERKNSIR
Ga0209691_10676522	3300027279	Anoxygenic And Chlorotrophic	MRSKYWHNELYKLAIAMHKVNGRGVKRNLDYLVRQEQVRNK
Ga0209691_10845621	3300027279	Anoxygenic And Chlorotrophic	MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARSNKHNNRVR
Ga0272447_10047014	3300028761	Microbial Mat	MKRSNLRNELYKLAIAMHKYNGRGVKWNLDYLLRQEQVPKKARNNSIR
Ga0272447_10148513	3300028761	Microbial Mat	MASKNLHNELYKLAIAMAKLNGKSVKQNLDLLLSQVRTRNNGHNNSVR
Ga0308395_10088441	3300031245	Hot Spring Phototrophic Mat	LSGRTMKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR
Ga0308395_10217962	3300031245	Hot Spring Phototrophic Mat	MKRTNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGHKNSVR
Ga0308395_10357962	3300031245	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQVPKKTRNNSIR
Ga0308395_10370771	3300031245	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR
Ga0308395_10545751	3300031245	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308395_10943221	3300031245	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEIHKYNGQGVKHNLDLLLSQVRARNKERKNSIR
Ga0308395_10950361	3300031245	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARKNVRNNSIR
Ga0308395_11225491	3300031245	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMHKYNGKGVKQNLDLLLSQVRARKNGHKNSVR
Ga0308395_11286331	3300031245	Hot Spring Phototrophic Mat	ALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308394_10207154	3300031508	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKKERKNSIR
Ga0308394_10305203	3300031508	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR
Ga0308394_10393844	3300031508	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVR
Ga0308394_10423731	3300031508	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERKNSIR
Ga0308394_10650581	3300031508	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNRVR
Ga0308394_10939361	3300031508	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKKERKNSIR
Ga0308394_11245771	3300031508	Hot Spring Phototrophic Mat	MRSKYWHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR
Ga0308399_10123552	3300031509	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308399_10176031	3300031509	Hot Spring Phototrophic Mat	MTSKNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKNVRKNSIR
Ga0308399_10304971	3300031509	Hot Spring Phototrophic Mat	MTSKNLRNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308399_10784581	3300031509	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR
Ga0308397_10210883	3300031512	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLSQEQVRNKARNNSIR
Ga0308397_10228171	3300031512	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNGHKNSVR
Ga0308397_10405213	3300031512	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVQ
Ga0308397_10434941	3300031512	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMHKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR
Ga0308397_10679351	3300031512	Hot Spring Phototrophic Mat	WHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308397_11263801	3300031512	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGKGVKQNLDYLLRQEQAR
Ga0308412_10088374	3300031513	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGRGVKRNLDYLLSQEQVRNKARNNSIR
Ga0308390_10766332	3300031514	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR
Ga0308390_11027122	3300031514	Hot Spring Phototrophic Mat	HNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308396_10197751	3300031515	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKNGHKNSVR
Ga0308396_10331402	3300031515	Hot Spring Phototrophic Mat	MKRTNLHNELYKLALEMHKYNSMGVKHNLDLLLSQVRARKNGHKNSVR
Ga0308396_10446672	3300031515	Hot Spring Phototrophic Mat	RTSSRTSTLPPGGSMKRTNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARKNGHKNSVR
Ga0308398_10897992	3300031516	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARNKERKNSIR
Ga0308392_10104411	3300031517	Hot Spring Phototrophic Mat	SMTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR
Ga0308392_10516072	3300031517	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKHNGQGVKRNLDLLLSQVQVRNNGHNNNVR
Ga0308392_10567143	3300031517	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308392_11181291	3300031517	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR
Ga0308389_10029279	3300031518	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNARNNSIR
Ga0308389_10826382	3300031518	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARNKERNNSIR
Ga0308391_10143373	3300031567	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIALHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR
Ga0308391_10765221	3300031567	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKWNLDYLLRHEQ
Ga0308391_11255171	3300031567	Hot Spring Phototrophic Mat	MSTNKLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308393_10102881	3300031568	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR
Ga0308393_10262591	3300031568	Hot Spring Phototrophic Mat	FSGGSMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERNNSIR
Ga0308393_11146191	3300031568	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARNKERKNSIR
Ga0308401_10105924	3300031767	Hot Spring Phototrophic Mat	MSTNKLRNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNRHNNNVR
Ga0308401_10566662	3300031767	Hot Spring Phototrophic Mat	SMKRTNLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308401_10702421	3300031767	Hot Spring Phototrophic Mat	MSTNKLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNRHNNNV
Ga0308415_10181131	3300031776	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARNNGHKNSVR
Ga0308418_10072564	3300031783	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKKERKNSIR
Ga0308418_10524594	3300031783	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSN
Ga0308418_10779621	3300031783	Hot Spring Phototrophic Mat	RGWVQTSSRVSTLLSGRTMKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR
Ga0308411_101326161	3300031812	Hot Spring Phototrophic Mat	MKRSNLHNELYKLAIAMHKYNGRGVKWNLDHLLSQEQVPKKTRNNSSR
Ga0308411_101758112	3300031812	Hot Spring Phototrophic Mat	MSTLPSGGSMTSKNLHNELYKLAIAMARVNGKTVKQNLDYLLSQEQVPKKERKNSIR
Ga0308409_10559511	3300031830	Hot Spring Phototrophic Mat	YWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERNNSIR
Ga0308409_10586271	3300031830	Hot Spring Phototrophic Mat	LALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308409_10849121	3300031830	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNGHKNSVR
Ga0308409_10861191	3300031830	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308409_10982771	3300031830	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKKERKNSIR
Ga0308409_11291571	3300031830	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNEHKNSVR
Ga0308408_10050631	3300031865	Hot Spring Phototrophic Mat	MSTLFSGGGMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNSVR
Ga0308408_10057842	3300031865	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQIRTRKNVRNNSIR
Ga0308408_10059031	3300031865	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR
Ga0308408_10184162	3300031865	Hot Spring Phototrophic Mat	LHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR
Ga0308408_10840031	3300031865	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARNKERKNSIR
Ga0308408_10904001	3300031865	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKWNLDYLLRQEQVRNK
Ga0308405_10387981	3300031875	Hot Spring Phototrophic Mat	SMKRSNLHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308405_10630551	3300031875	Hot Spring Phototrophic Mat	SMKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARNKERNNSIR
Ga0308405_10812411	3300031875	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARNKERKNSIR
Ga0308405_10861751	3300031875	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKWNLDYLLSQEQVRNKARNNSIR
Ga0308405_11190041	3300031875	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQARN
Ga0308404_10110552	3300031878	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRVRKNVRNNSIR
Ga0308404_10714842	3300031878	Hot Spring Phototrophic Mat	MELDPVTVNELYKLAIAMNKHNNKGVKRNLDLLLSQVRTRSNKHNNRVR
Ga0308404_10736941	3300031878	Hot Spring Phototrophic Mat	MSTNKLRNELYKLAIAMHKYNGRGVKRNLDLLLSQVQVRNNGHNNNVR
Ga0308404_11042601	3300031878	Hot Spring Phototrophic Mat	MTSKNLRNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308404_11198061	3300031878	Hot Spring Phototrophic Mat	MHPNHQHNELYKLAIAMHKVNGKGVKRNLDYLLRQEQVRNKVRNNSIR
Ga0308406_10527491	3300031948	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308406_10544521	3300031948	Hot Spring Phototrophic Mat	MKRTNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR
Ga0308406_10660571	3300031948	Hot Spring Phototrophic Mat	KYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNNRVR
Ga0308406_10867511	3300031948	Hot Spring Phototrophic Mat	RGWVQTSTGTLTLLSGGSMKSKYWHNELYKLALEMNKYNGQGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308406_10970591	3300031948	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLRQEQAR
Ga0308417_10899231	3300031950	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNSMGVKQNLDLLLSQVRTRKKERKNSIR
Ga0308410_10238254	3300031958	Hot Spring Phototrophic Mat	MTSKNLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR
Ga0308420_11578741	3300031966	Hot Spring Phototrophic Mat	MSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNGHKNSV
Ga0308420_11604361	3300031966	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNGHKNSVR
Ga0308403_10167732	3300031980	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKVNGRGVKQNLDLLLSQVRARNNGHKNSVR
Ga0308403_10574401	3300031980	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKHNLDYLLRQVEERNKAN
Ga0308403_10731501	3300031980	Hot Spring Phototrophic Mat	MKSKYWHNELYKLAIAMHKVNGKGVKRNLDYLLSQEQVRNKARNNSIR
Ga0308402_10471981	3300032033	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVQVRNNRHNNNVR
Ga0308407_10070233	3300032034	Hot Spring Phototrophic Mat	NLHNELYKLALEMHKYNSMGVKQNLDLLLSQVRARNKERKNSIR
Ga0308407_10136184	3300032034	Hot Spring Phototrophic Mat	MTSKNLHNELYKLAIAMHKYNGKGVKQNLDYLLSQEQVRNKARNNSIR
Ga0308407_10537451	3300032034	Hot Spring Phototrophic Mat	GGSMKRTNLHNELYKLALEMHKYNSMGVKHNLDLLLSQVRARKNGHKNSVR
Ga0308407_10972721	3300032034	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVR
Ga0308400_100098310	3300032045	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKVNGKGVKHNLDLLLSQVQVRNNRHNNNVR
Ga0308400_10080204	3300032045	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKYNGRGVKQNLDLLLSQVRARKNVRKNSIR
Ga0308400_10239412	3300032045	Hot Spring Phototrophic Mat	MSTNKLYNELYKLAIAMHKHNGRGVKHNLDLLLSQVRARKNVRKNSIR
Ga0308400_10424822	3300032045	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKHNGRGVKHNLDLLLSQVRARKNVRKNSIR
Ga0308400_11052861	3300032045	Hot Spring Phototrophic Mat	MKRTNLHNELYKLAIAMHKHNGRGVKRNLDLLLSQVQVRNNG
Ga0308416_10027265	3300032049	Hot Spring Phototrophic Mat	MSTNKLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308416_10669161	3300032049	Hot Spring Phototrophic Mat	MSTNKLHNELYKLAIAMHKYNGRGVKRNLDLLLSQVRARKNVRKNSIR
Ga0308416_10739561	3300032049	Hot Spring Phototrophic Mat	MSTNKLHNELYKLAIAMHKHNGRGVKRNLDLLLSQVQVRNNGHNNNVR
Ga0308310_10326092	3300032056	Hot Spring Phototrophic Mat	SMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR
Ga0308310_11218701	3300032056	Hot Spring Phototrophic Mat	MKRTNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNS
Ga0308310_11263061	3300032056	Hot Spring Phototrophic Mat	SSRTSTLPPGGSMKRTNLHNELYKLAIAMHKYNGRGVKHNLDLLLSQVRARKNGHKNSVR
Ga0308421_10511192	3300032057	Hot Spring Phototrophic Mat	KSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLSQEQVRNKARNNSIR
Ga0308421_10929501	3300032057	Hot Spring Phototrophic Mat	GSMSTNKLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKKERKNSIR
Ga0308421_11067201	3300032057	Hot Spring Phototrophic Mat	MSTNKLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR
Ga0308419_10727472	3300032058	Hot Spring Phototrophic Mat	MKRTNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRERKNKHNNRVR
Ga0308419_11621232	3300032058	Hot Spring Phototrophic Mat	MRRSNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARKNVRKNSIR
Ga0308414_10116381	3300032356	Hot Spring Phototrophic Mat	MSTLFSGGSMKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARNKERKNSIR
Ga0308414_10116387	3300032356	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARN
Ga0308414_10383563	3300032356	Hot Spring Phototrophic Mat	MRSKYWHNELYKLALEMNKYNGRGVKHNLDLLLSQVRARSNGHKNSVR
Ga0308414_11091362	3300032356	Hot Spring Phototrophic Mat	STLPPGGTMKRSSLHNELYKLAIAMAKYNGKGVKQNLDYLLSQEQVRNKARNNSIR
Ga0308414_11542051	3300032356	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLAIQMSKFNGKGVKQNLDYLLSQEQIRNKARNNSIR
Ga0308413_003157_2525_2671	3300033886	Hot Spring Phototrophic Mat	MSTNKLRNELYKLAIAMHKYNGRGVKHNLDLLLSQVQVRNNGHNNNVR
Ga0308413_030802_1309_1458	3300033886	Hot Spring Phototrophic Mat	MEHSGNLHNELYKLALEMHKYNGQGVKQNLDLLLSQVRARNKERKNSIR
Ga0308413_035457_2_118	3300033886	Hot Spring Phototrophic Mat	YKLALEMNKYNGRGVKHNLDLLLSQVRARSNGHKNSVR
Ga0308413_038815_1052_1198	3300033886	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARSNKHNNRVR
Ga0308413_055677_970_1104	3300033886	Hot Spring Phototrophic Mat	MKSKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRSNKHNN
Ga0308413_089139_138_284	3300033886	Hot Spring Phototrophic Mat	MKRSNLHNELYKLALEMHKYNGRGVKQNLDLLMSQVRARKNVRKNSIR
Ga0308413_109011_579_683	3300033886	Hot Spring Phototrophic Mat	MKNKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQ
Ga0308413_123191_2_169	3300033886	Hot Spring Phototrophic Mat	TLLSGGSMKNKYWHNELYKLALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR
Ga0308413_154856_286_432	3300033886	Hot Spring Phototrophic Mat	MTSKNLHNELYKLALEMNKYNGRGVKQNLDLLLSQVRTRKNVRKNSIR
Ga0308413_159714_413_523	3300033886	Hot Spring Phototrophic Mat	LALEMNKYNGRGVKQNLDLLLSQVRARKNVRNNSIR
Ga0372965_033298_117_263	3300034646	Hot Spring Phototrophic Mat	MKRTNLHNELYKLALEMHKYNGQGVKHNLDLLLSQVRARKNGHKNSVR
Ga0372972_015650_1108_1272	3300034649	Hot Spring Phototrophic Mat	LLSGGSMKSKYWHNELYKLAIAMHKYNGKGVKWNLDYLLSQEQVRNKARNNSIR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F033338

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences