Basic Information | |
---|---|
Family ID | F033431 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 177 |
Average Sequence Length | 44 residues |
Representative Sequence | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFR |
Number of Associated Samples | 135 |
Number of Associated Scaffolds | 177 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 98.87 % |
% of genes from short scaffolds (< 2000 bps) | 92.09 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (84.746 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.859 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.147 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.797 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.37% β-sheet: 14.93% Coil/Unstructured: 59.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 177 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 3.39 |
PF03354 | TerL_ATPase | 0.56 |
PF04586 | Peptidase_S78 | 0.56 |
PF04860 | Phage_portal | 0.56 |
COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 3.39 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.56 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.35 % |
Unclassified | root | N/A | 5.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001097|JGIcombinedJ13537_10065210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300002408|B570J29032_108895003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300002408|B570J29032_109037293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300003431|JGI25913J50563_1021540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1038 | Open in IMG/M |
3300003497|JGI25925J51416_10079238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300004054|Ga0063232_10134568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300004096|Ga0066177_10144001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
3300004096|Ga0066177_10208603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300004481|Ga0069718_15867525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300004769|Ga0007748_10867172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300006484|Ga0070744_10013388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2433 | Open in IMG/M |
3300006802|Ga0070749_10430714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300006805|Ga0075464_10483506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300006805|Ga0075464_10939244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300006917|Ga0075472_10691158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300006920|Ga0070748_1088318 | All Organisms → Viruses → Predicted Viral | 1190 | Open in IMG/M |
3300007363|Ga0075458_10045220 | All Organisms → Viruses → Predicted Viral | 1388 | Open in IMG/M |
3300007363|Ga0075458_10048435 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
3300007363|Ga0075458_10071805 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300007363|Ga0075458_10165600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300007538|Ga0099851_1203875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300007542|Ga0099846_1179792 | Not Available | 753 | Open in IMG/M |
3300007992|Ga0105748_10133563 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
3300008106|Ga0114339_1113929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
3300008107|Ga0114340_1252470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300008108|Ga0114341_10225992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300008108|Ga0114341_10297705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300008108|Ga0114341_10343383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
3300008108|Ga0114341_10376094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300008111|Ga0114344_1173695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300008113|Ga0114346_1190036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300008113|Ga0114346_1223780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300008117|Ga0114351_1249516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300008122|Ga0114359_1022742 | All Organisms → Viruses → Predicted Viral | 2523 | Open in IMG/M |
3300008262|Ga0114337_1313091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300008265|Ga0114361_1048106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1361 | Open in IMG/M |
3300008266|Ga0114363_1248265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300008267|Ga0114364_1040488 | All Organisms → Viruses → Predicted Viral | 1743 | Open in IMG/M |
3300008267|Ga0114364_1160405 | Not Available | 604 | Open in IMG/M |
3300008448|Ga0114876_1042529 | All Organisms → Viruses → Predicted Viral | 2119 | Open in IMG/M |
3300008448|Ga0114876_1194237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300008450|Ga0114880_1228874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300009009|Ga0105105_10207808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300009037|Ga0105093_10393811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300009068|Ga0114973_10719332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300009146|Ga0105091_10303914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300009155|Ga0114968_10059820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2421 | Open in IMG/M |
3300009159|Ga0114978_10401192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300009183|Ga0114974_10416715 | Not Available | 766 | Open in IMG/M |
3300009183|Ga0114974_10477677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300009183|Ga0114974_10588689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009470|Ga0126447_1088056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300010316|Ga0136655_1041500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1458 | Open in IMG/M |
3300010368|Ga0129324_10229836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300010368|Ga0129324_10385788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300010388|Ga0136551_1017892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1399 | Open in IMG/M |
3300010885|Ga0133913_12635243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
3300011183|Ga0136713_1050813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300012705|Ga0157555_1179429 | Not Available | 676 | Open in IMG/M |
3300012708|Ga0157595_1173896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300012724|Ga0157611_1167239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300012728|Ga0157552_1076361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300012732|Ga0157549_1246483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300012745|Ga0157532_140360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300012760|Ga0138273_1113804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300012769|Ga0138279_1146858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300012771|Ga0138270_1252001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
3300012774|Ga0138283_1230325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300012779|Ga0138284_1056650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300013005|Ga0164292_10047488 | All Organisms → Viruses → Predicted Viral | 3394 | Open in IMG/M |
3300013005|Ga0164292_10774829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300013006|Ga0164294_10725325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300013006|Ga0164294_10737861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300013014|Ga0164295_10720869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300013077|Ga0157526_1035151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300013295|Ga0170791_14957050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300013310|Ga0157622_1160170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300013372|Ga0177922_10096841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300014811|Ga0119960_1071816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300016690|Ga0180048_1131051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300017701|Ga0181364_1010225 | All Organisms → Viruses → Predicted Viral | 1583 | Open in IMG/M |
3300017701|Ga0181364_1039845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300017701|Ga0181364_1040547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300017701|Ga0181364_1042193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300017716|Ga0181350_1042734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300017716|Ga0181350_1123960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300017722|Ga0181347_1014253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2553 | Open in IMG/M |
3300017736|Ga0181365_1087104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300017736|Ga0181365_1088070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300017736|Ga0181365_1090778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300017736|Ga0181365_1134416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300017736|Ga0181365_1143052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300017747|Ga0181352_1120603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300017761|Ga0181356_1206867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300017766|Ga0181343_1162850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300017777|Ga0181357_1237069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300017777|Ga0181357_1243699 | Not Available | 627 | Open in IMG/M |
3300017778|Ga0181349_1110205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300017778|Ga0181349_1230301 | Not Available | 627 | Open in IMG/M |
3300017780|Ga0181346_1265417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300017784|Ga0181348_1264311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300017785|Ga0181355_1346335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300019784|Ga0181359_1215211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300020529|Ga0208233_1014743 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
3300020549|Ga0207942_1005926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1746 | Open in IMG/M |
3300020568|Ga0208598_1055722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300021956|Ga0213922_1017779 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
3300021963|Ga0222712_10508531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300021963|Ga0222712_10654087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300022190|Ga0181354_1021639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2045 | Open in IMG/M |
3300022190|Ga0181354_1128448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300022190|Ga0181354_1203335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300022407|Ga0181351_1033476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
3300022407|Ga0181351_1045012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
3300022747|Ga0228703_1008070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4238 | Open in IMG/M |
3300022748|Ga0228702_1144863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300023184|Ga0214919_10006424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16174 | Open in IMG/M |
3300023184|Ga0214919_10489697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300024346|Ga0244775_10684369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300024346|Ga0244775_10999292 | Not Available | 660 | Open in IMG/M |
3300024348|Ga0244776_10730115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300024481|Ga0256330_1076923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300024556|Ga0256341_1092427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300024573|Ga0256337_1099004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300024574|Ga0255275_1165944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300024857|Ga0256339_1069008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300025635|Ga0208147_1092402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300025671|Ga0208898_1010676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4586 | Open in IMG/M |
3300027212|Ga0208554_1060167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300027644|Ga0209356_1168661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300027659|Ga0208975_1062459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300027721|Ga0209492_1316615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300027732|Ga0209442_1088360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
3300027734|Ga0209087_1359185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300027756|Ga0209444_10079754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300027764|Ga0209134_10181870 | Not Available | 724 | Open in IMG/M |
3300027785|Ga0209246_10345200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300027798|Ga0209353_10356867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300027805|Ga0209229_10208173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300027808|Ga0209354_10095668 | All Organisms → Viruses → Predicted Viral | 1211 | Open in IMG/M |
3300027808|Ga0209354_10130168 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
3300027808|Ga0209354_10354459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300027836|Ga0209230_10260945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300027892|Ga0209550_10754342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300027963|Ga0209400_1207781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300027969|Ga0209191_1056770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
3300027969|Ga0209191_1235228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300027969|Ga0209191_1241716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300028271|Ga0255256_1101593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1123316 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
3300031758|Ga0315907_10892512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300031758|Ga0315907_10912254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300031758|Ga0315907_11017488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300031787|Ga0315900_10140355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2257 | Open in IMG/M |
3300031885|Ga0315285_10963047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300031963|Ga0315901_11048033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300032053|Ga0315284_12176089 | Not Available | 554 | Open in IMG/M |
3300033488|Ga0316621_10432344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300033996|Ga0334979_0050217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2707 | Open in IMG/M |
3300034012|Ga0334986_0220752 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
3300034020|Ga0335002_0142054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1568 | Open in IMG/M |
3300034023|Ga0335021_0046232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2662 | Open in IMG/M |
3300034061|Ga0334987_0512843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300034061|Ga0334987_0683122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300034066|Ga0335019_0277638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
3300034068|Ga0334990_0366308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300034073|Ga0310130_0279159 | Not Available | 529 | Open in IMG/M |
3300034101|Ga0335027_0404933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
3300034102|Ga0335029_0321558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300034106|Ga0335036_0416525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300034106|Ga0335036_0611876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300034112|Ga0335066_0199476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
3300034118|Ga0335053_0246186 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
3300034122|Ga0335060_0642010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300034167|Ga0335017_0160383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
3300034357|Ga0335064_0201497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
3300034357|Ga0335064_0246255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1135 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.86% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.77% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.60% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.04% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.34% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.39% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.82% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.69% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.69% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.69% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.69% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.13% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.13% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.13% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.13% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.13% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.56% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.56% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.56% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.56% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.56% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.56% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008106 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-53-LTR | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300012705 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012732 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012745 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES017 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012760 | Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012771 | Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013077 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES009 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300016690 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES019 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020568 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028271 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13537_100652101 | 3300001097 | Hypersaline | MAFITIERTDGTRLTGEITPAVEYAFEQHFKKGFY |
B570J29032_1088950031 | 3300002408 | Freshwater | MAKLKIVRLDGSVLEGEITPAVEYSFEQYAKKGFH |
B570J29032_1090372932 | 3300002408 | Freshwater | MARLKIVRNDGSVLEGEITPAVEYAFEMYAKKGFH |
JGI25913J50563_10215403 | 3300003431 | Freshwater Lake | MARLKIVRNDGSVLEGEITPAVEYSFELHHKMGFHRAFREQEMQ |
JGI25925J51416_100792381 | 3300003497 | Freshwater Lake | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDE |
Ga0063232_101345681 | 3300004054 | Freshwater Lake | MAKLKIVRQDGSVIEGEITPAVEYFFEQQTKMGFHKAFRTEEMQSHVY |
Ga0066177_101440013 | 3300004096 | Freshwater Lake | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRD |
Ga0066177_102086033 | 3300004096 | Freshwater Lake | MAKLKIVRQDGSVIEGEITPAVEYFFEQQTKMGFHKAFRTEEMQSHVYLLAHEVIRRSGETVKP |
Ga0069718_158675252 | 3300004481 | Sediment | MARLKIVRNDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQ |
Ga0007748_108671721 | 3300004769 | Freshwater Lake | MAKLKIVRQDGSVIEGEITPAVEYFFEQQTKMGFHKAFRTE |
Ga0070744_100133886 | 3300006484 | Estuarine | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKNGFSQGFPR* |
Ga0070749_104307143 | 3300006802 | Aqueous | MAKLKITKTDGSVVEGEITPAVEYFFEQQTKMGFHRAFREEEKQSHVYLLA |
Ga0075464_104835063 | 3300006805 | Aqueous | MAKLKVTRADGSVNEYQITPAIEYSFEQYAKMGFHKAFRDLEQQTHVYWLCW |
Ga0075464_109392441 | 3300006805 | Aqueous | MAKLKIVRTDGSVLEGDITPAVEYSFEQYAKKGFHKA |
Ga0075472_106911582 | 3300006917 | Aqueous | MAKLKVTRADGQVGEYPITPLVQYGFEIYAKKGFHKAFIEDQ |
Ga0070748_10883181 | 3300006920 | Aqueous | MAKLKVTRADGQVQEFEITPVLEYSFENYAKKGFHKALIEDQKQSDVY |
Ga0075458_100452205 | 3300007363 | Aqueous | MARLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEK |
Ga0075458_100484355 | 3300007363 | Aqueous | MAKLKVTRADNSVQEFEITPVIEYSFEQYAKKGFHKALIEDQKQSD |
Ga0075458_100718053 | 3300007363 | Aqueous | MAKLKVTRADNSVSEFEITPLIEYAFEQYAKKGFHKALIEDQ |
Ga0075458_101656001 | 3300007363 | Aqueous | MAKLKVTRADGQVGEYPITPLVQYGFEIYAKKGFH |
Ga0099851_12038753 | 3300007538 | Aqueous | MARLKIVRVDGSVLEGEITPAVEYAFELHAKQGFHKAFREFERQQDVYFLAWEVTRRSGESVKP |
Ga0099846_11797923 | 3300007542 | Aqueous | MASLKVVRADGTESIHEITPAVEYAFEQYAKKGFYKAFREDQKQ |
Ga0105748_101335631 | 3300007992 | Estuary Water | MAKLKIVRQDGSIVEGEITPAVEYFFEQHTKMGFHKAFRDEEKQSH |
Ga0114339_11139294 | 3300008106 | Freshwater, Plankton | MAKLKIVRQDGSVIEGEITPAVEYAFELHTKMGFHRAFRQEEKQ |
Ga0114340_12524702 | 3300008107 | Freshwater, Plankton | MARLKIVRQDGSVLEGEITPAVEYAFEMYAKKGFHKAFR |
Ga0114341_102259921 | 3300008108 | Freshwater, Plankton | MAKLKVTRADGQVGEYPITPLVQYGFEIHAKKGFHKA |
Ga0114341_102977053 | 3300008108 | Freshwater, Plankton | MAKLKIVRTDGTELEGEISPAVEYSFEQFYKIGFHKAFRE |
Ga0114341_103433835 | 3300008108 | Freshwater, Plankton | MAKLKVTRADGSVGEYPITPLVQYGFEMYAKKGFHKA |
Ga0114341_103760943 | 3300008108 | Freshwater, Plankton | MARLKIVRQDGSVLEGEITPAVEYAFEQYAKKGLHQAFR |
Ga0114344_11736953 | 3300008111 | Freshwater, Plankton | MARLKIVRMDGSIVEGEITPAVEYFFEQQTKMGFHKAFRDEEK |
Ga0114346_11900363 | 3300008113 | Freshwater, Plankton | MARLKIVRNDGSVLEGEITPAVEYFFEQQTKMGFHRAFREEEKQSHVYLLAHE |
Ga0114346_12237803 | 3300008113 | Freshwater, Plankton | MARLKIVRQDGSVLEGEITPAVEYAFEMYAKKGFHKAFRDEEKQSD |
Ga0114351_12495161 | 3300008117 | Freshwater, Plankton | MARLKIVRQDGSVLEGEITPAVEYAFEMYAKKGFHKAFRDEEKQ |
Ga0114359_10227427 | 3300008122 | Freshwater, Plankton | MAKLKVTRADGTESTHELTPAIEYAFEQYAKKGFYKAFRE |
Ga0114337_13130912 | 3300008262 | Freshwater, Plankton | MAKLKVTRADGSVGEYPITPLVQYGFEMYAKKGFHKAFIED |
Ga0114361_10481065 | 3300008265 | Freshwater, Plankton | MARLKIVRQDGSVLEGEITPAVEYAFEQYAKKGFHKAF |
Ga0114363_12482652 | 3300008266 | Freshwater, Plankton | MASLKVVRADGTESIHEITPAVEYAFEQYAKKGFYKAF |
Ga0114364_10404881 | 3300008267 | Freshwater, Plankton | MAKLKIVRQDGSVLEGEITPAVEYAFEQYAKKGFH |
Ga0114364_11604052 | 3300008267 | Freshwater, Plankton | MAKLKIVRQDGSVIEGEITPAVEYFFEQHTKMGFHKAFRTEEMQSHVY |
Ga0114876_10425296 | 3300008448 | Freshwater Lake | MAKLKVTRADGQVQEFEITPLIEYAFEQYAKKGFH |
Ga0114876_11942371 | 3300008448 | Freshwater Lake | MAKLKIVRQEGSVIEGEITPAVEYAFELHTKMGFHRAF |
Ga0114880_12288741 | 3300008450 | Freshwater Lake | MAKLKIVRTDGSVIEGEITPAVEYAFELHTKMGFHRA |
Ga0105105_102078081 | 3300009009 | Freshwater Sediment | MAKLKIVRTDGSVLEGEISPAVEFEFEQHAKMGFHKAFREMERQQDVYFLAWVITRR |
Ga0105093_103938111 | 3300009037 | Freshwater Sediment | MAKLKVTRADNSVQEFEITPLIEYAFEQYAKKGFHKA |
Ga0114973_107193321 | 3300009068 | Freshwater Lake | MAKLKIVLTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQSDVY |
Ga0105091_103039142 | 3300009146 | Freshwater Sediment | MARLKIVRQDGSVLEGEITPAVEYSFEQYAKKGFHK |
Ga0114968_100598201 | 3300009155 | Freshwater Lake | MAKLKVTRADGQVGEYPITPLVQYGFEIYAKKGFHKAF |
Ga0114978_104011924 | 3300009159 | Freshwater Lake | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKALIEDQKQS |
Ga0114974_104167151 | 3300009183 | Freshwater Lake | MAKLKIVRTDGSELVGEITPSVEYSFELHHKKGFHRAFREDEMQT |
Ga0114974_104776771 | 3300009183 | Freshwater Lake | MAKLKITRTDGSILEGEITPAVEYLFELHHKVGFHRA |
Ga0114974_105886891 | 3300009183 | Freshwater Lake | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQTDVYW |
Ga0126447_10880562 | 3300009470 | Meromictic Pond | MAKLKVTRADGQVQEFEITPLLEYAYEQYAKKGFHKS |
Ga0136655_10415001 | 3300010316 | Freshwater To Marine Saline Gradient | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKALI |
Ga0129324_102298361 | 3300010368 | Freshwater To Marine Saline Gradient | MAKLKIVRTDGSVIEGEITPAVEYFFEQQTKMGFHKAFRNEERQSHVYLLAHEVIRRSGETVKP |
Ga0129324_103857882 | 3300010368 | Freshwater To Marine Saline Gradient | MAKLKVTRADNSVQEFEITPLIEYAFEQYAKKGFHKALLED |
Ga0136551_10178924 | 3300010388 | Pond Fresh Water | MARLKIVRQDGSVLEGEITPAVEYAFEQYAKKGFHQAFRVDE |
Ga0133913_126352431 | 3300010885 | Freshwater Lake | MAKLKIVRTDGSELVGEITPSVEYSFELHHKKGFHR |
Ga0136713_10508131 | 3300011183 | Freshwater | MAKLKIVRNDGSVLEGEITPAVEYSFEQWAKKGFHKAFRDDEMQTSV |
Ga0157555_11794292 | 3300012705 | Freshwater | MARLKIVRTDGSVLEGEITPAVEYSFELHHKLGFHRAFREQEMQGMVYWIAWEV |
Ga0157595_11738962 | 3300012708 | Freshwater | MAKLKIVRQDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEE |
Ga0157611_11672391 | 3300012724 | Freshwater | MAKLKIVRQDGSVIEGEITPAVEYFFEQQTKMGFHKAFRTEEMQ |
Ga0157552_10763613 | 3300012728 | Freshwater | MAKLKIVRQDGSVIEGEITPAVEYFFEQHTKMGFHKAFRTEEL |
Ga0157549_12464831 | 3300012732 | Freshwater | MAKLKIVRTDGSVLEGEITPAVEYSFELHAKKGFHRAFREEERQ |
Ga0157532_1403602 | 3300012745 | Freshwater | MAKLKIVRQDGSVLEGEISPAVEYLFELHHKIGFHKAFRDEEKQTMVYWLAWEITRRSGETVKPFGI |
Ga0138273_11138044 | 3300012760 | Freshwater Lake | MAKLRVTTTDNLTADYEITPLIEYSFEQYAKKGFHKALME |
Ga0138279_11468582 | 3300012769 | Freshwater Lake | MAKLKVTRADNSVTEYEITPLIEYAFEQYAKKGFHKALIE |
Ga0138270_12520015 | 3300012771 | Freshwater Lake | MAKLRVTTSDNQVTDYEITPLIEYAFEQYAKKGFHKALLEDQ |
Ga0138283_12303251 | 3300012774 | Freshwater Lake | MAKLKIVRQDGSVIEGEITPAVEYSFELYAKKGFHRAFREDEMQTSVYWL |
Ga0138284_10566503 | 3300012779 | Freshwater Lake | MAKLKIVRTDGSIVEGEITPAVEYFFEQQTKMGFHKAFRTEELQSHVYLLAWEIIRRSGE |
Ga0164292_100474887 | 3300013005 | Freshwater | MAKLKVTRADGQVNEYEITPLLEYSFEQYAKKGFHKALI |
Ga0164292_107748292 | 3300013005 | Freshwater | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEE |
Ga0164294_107253252 | 3300013006 | Freshwater | MAKLKIVRQDGSVLEGEITPAVEYLFELHHKIGFHKAFRDEEKQTMVYWLAW |
Ga0164294_107378612 | 3300013006 | Freshwater | MAKLKIVRQDGSVLEGEISPAVEYLFELHHKIGFHKAFRDEEKQTMVYWLAWEITRRSGETVK |
Ga0164295_107208693 | 3300013014 | Freshwater | MAKLKIVRQDGSTLEGEISPAVEYLFELHHKIGFHKAFRDEEKQT |
Ga0157526_10351512 | 3300013077 | Freshwater | MAKLKIVRQDGSVLEGEISPAVEYLFELHHKIGFHKAFRDEEKQTMVYWLAWEI |
Ga0170791_149570502 | 3300013295 | Freshwater | MAKLRVTTSDNQVTDYEITPLIEFAFEQYAKKGFHKALLEDQKQSDIY |
Ga0157622_11601703 | 3300013310 | Freshwater | MAKLKIVRQDGSVIEGEITPAVEYFFEQQTKMGFHKAFRTEEMQSHVYLLAHEVIR |
Ga0177922_100968411 | 3300013372 | Freshwater | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKALIEDQKQSDVY |
Ga0119960_10718161 | 3300014811 | Aquatic | MAKLKVTRADNSVQEFEITPLIEYSFEQFAKKGFHKALIEDQKQTERS* |
Ga0180048_11310513 | 3300016690 | Freshwater | MAKLKIVRTNGSVIEGEITPAVEYSFELYAKKGFHRAFR |
Ga0181364_10102251 | 3300017701 | Freshwater Lake | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKAL |
Ga0181364_10398453 | 3300017701 | Freshwater Lake | MAKLKIVRQDGSIVEGEITPAVEYFFEQHTKMGFHKAFRDEEKQ |
Ga0181364_10405473 | 3300017701 | Freshwater Lake | MAKLKIVRTDGSELIGEITPSVEYSFELHHKKGFHRAFREDEMQSMLFWLSW |
Ga0181364_10421933 | 3300017701 | Freshwater Lake | MAKLKIVKVDGSVIEGEITPAVEYFFEQHTKMGFHK |
Ga0181350_10427341 | 3300017716 | Freshwater Lake | MARLKVTRTDGAVAEYQITPRVEYAFELHFKKGFHKAFRDDEMQTMVYWLCWE |
Ga0181350_11239601 | 3300017716 | Freshwater Lake | MAKLKIVRQDGSIVEGEITPAVEYFFEQHTKMGFHKAFRDEEKQSHVYLLAH |
Ga0181347_10142536 | 3300017722 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKAFRDDEMQTSVYWLAWEITRR |
Ga0181365_10871041 | 3300017736 | Freshwater Lake | MARLKITRTDGSVIEGEITPAVEYSFELYAKKGFHRAFREDEMQTSVYW |
Ga0181365_10880703 | 3300017736 | Freshwater Lake | MTKLKVTRVDGQVQEFEITPVLEYSFEQYAKKGFHK |
Ga0181365_10907783 | 3300017736 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKAFRDDE |
Ga0181365_11344162 | 3300017736 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKAFRDDEM |
Ga0181365_11430521 | 3300017736 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKAFRDDEMQT |
Ga0181352_11206031 | 3300017747 | Freshwater Lake | MAKLKVTRADGQVNEYEITPLLEYSFEQYAKKGFHKALIED |
Ga0181356_12068672 | 3300017761 | Freshwater Lake | MAKLKVTRADGQVQEYEITPVLEYSFEQYAKKGFHKALIEDQ |
Ga0181343_11628502 | 3300017766 | Freshwater Lake | MARLKIVRQDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQSDV |
Ga0181357_12370691 | 3300017777 | Freshwater Lake | MARLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAF |
Ga0181357_12436993 | 3300017777 | Freshwater Lake | MAKLKITRSTGEVQEFEITPTIEYAFEQNKKKGIH |
Ga0181349_11102054 | 3300017778 | Freshwater Lake | MARLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQSD |
Ga0181349_12303012 | 3300017778 | Freshwater Lake | MAKLKIVKVDGSIVEGEITPAVEYFFEQQTKMGFHKAFRDEEKQS |
Ga0181346_12654172 | 3300017780 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKAF |
Ga0181348_12643112 | 3300017784 | Freshwater Lake | MAKLKIVRQDGSIVEGEITPAVEYFFEQHTKMGFHKAFRDEEKQSHVYLLAHEVIRRSG |
Ga0181355_13463352 | 3300017785 | Freshwater Lake | MARLKIVRVDGSVLEGEISPAVEYSFELYAKKGFHQAFRID |
Ga0181359_12152112 | 3300019784 | Freshwater Lake | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEK |
Ga0208233_10147431 | 3300020529 | Freshwater | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKA |
Ga0207942_10059264 | 3300020549 | Freshwater | MAKLKIVRNDGSVLEGEITPAVEFAFESHHKKGFHKAFRDDEMQSMVYWLA |
Ga0208598_10557222 | 3300020568 | Freshwater | MAKLKIVRTDGSIIEGEITPAVEYFFEQTTKMGFHKAFRDEEKQSHVYLLAHEV |
Ga0213922_10177791 | 3300021956 | Freshwater | MAKLRVTTTDNTTADYEITPLLEYAFEQYAKMGFHKA |
Ga0222712_105085313 | 3300021963 | Estuarine Water | MAKLKVTRADNQVQEFEITPLLEYSFENYAKKGFHKALIEDQKQT |
Ga0222712_106540871 | 3300021963 | Estuarine Water | MAKLKVTRADNSVTEYEITPLIEYAFEQYAKKGFH |
Ga0181354_10216391 | 3300022190 | Freshwater Lake | MAKLKVTRADGQINEYEITPVIEYSFEQHFKKGFHKSLIE |
Ga0181354_11284481 | 3300022190 | Freshwater Lake | MAKLKIVRQDGSIVEGEITPAVEYFFEQHTKMGFHKAFRDEEKQSHVYLLAHE |
Ga0181354_12033351 | 3300022190 | Freshwater Lake | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFH |
Ga0181351_10334766 | 3300022407 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHK |
Ga0181351_10450126 | 3300022407 | Freshwater Lake | MAKLKIVRTDGSELIGEITPSVEYSFELHHKKGFHRAFREDEMQTMV |
Ga0228703_10080701 | 3300022747 | Freshwater | MAKLKVTRADGQVGEYPITPLVQYGFEIYAKKGFHK |
Ga0228702_11448631 | 3300022748 | Freshwater | MAKLKVVRADGTVNEYEITPVIEYAFEQSRNKGFHKAMIEDQ |
Ga0214919_100064241 | 3300023184 | Freshwater | MAKLKITRTDGSILEGEITPAVEYEFEQYAKKGFHKAFREDEMQS |
Ga0214919_104896972 | 3300023184 | Freshwater | MARLKITRTDGSILEGEITPAVEYEFEQYAKKGFHKAFREDEMQS |
Ga0244775_106843691 | 3300024346 | Estuarine | MARLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQS |
Ga0244775_109992923 | 3300024346 | Estuarine | MAKLKITRTTGEVQEFEITPTIEYAFEQHYKKGIH |
Ga0244776_107301151 | 3300024348 | Estuarine | MAKLKITKTDGSVVEGEITPAVEYFFEQQTKMGFHRAFREEEKQSHVYLLAHEVIRRSGETVK |
Ga0256330_10769233 | 3300024481 | Freshwater | MAKLKVTRADGQVQEYEITPLLEYSFEQYAKKGFHKALIEDSKQSD |
Ga0256341_10924272 | 3300024556 | Freshwater | MAKLKVTRADGQVQEFEITPILEYSFEQYAKKGFH |
Ga0256337_10990043 | 3300024573 | Freshwater | MAKLKVTRADGQVQAFEITPLLEYSFERYAKKGFHKVLIEDSKQS |
Ga0255275_11659442 | 3300024574 | Freshwater | MAKLKVTRADGQVQEFELTPILEYSFEQYAKKGFHK |
Ga0256339_10690083 | 3300024857 | Freshwater | MASLKIVRADGTESQHEITPAIEYAFEQYAKKGFYKAFREDQ |
Ga0208147_10924023 | 3300025635 | Aqueous | MARLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKA |
Ga0208898_10106768 | 3300025671 | Aqueous | MASLKVVRADGSESSHEITPAIEYAFEQYAKKGFYR |
Ga0208554_10601672 | 3300027212 | Estuarine | MAKLKITKTDGSVVEGEITPAVEYFFEQQTKMGFHRAFREEEKQSHVYLLAHEVIRRS |
Ga0209356_11686611 | 3300027644 | Freshwater Lake | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKALIEDQKQ |
Ga0208975_10624591 | 3300027659 | Freshwater Lentic | MASLKVVRADGTESIHEITPAVEYAFEQYAKKGFY |
Ga0209492_13166151 | 3300027721 | Freshwater Sediment | MARLKIVRQDGSVLEGEITPAVEYSFEQYAKKGFHKAF |
Ga0209442_10883601 | 3300027732 | Freshwater Lake | MAKLKVTRADGSVNEYQITPAIEYSFEQFAKKGFHKAFRDD |
Ga0209087_13591851 | 3300027734 | Freshwater Lake | MAKLKVTRADGSVGEYPITPLVQYGFEIYAKKGFHKAFIED |
Ga0209444_100797545 | 3300027756 | Freshwater Lake | MAKLKIVRQDGSVIEGEITPAVEYFFEQQTKMGFHKAFRTEEMQSHVYLLAHEVIRRSGETV |
Ga0209134_101818701 | 3300027764 | Freshwater Lake | MAKLKIVRTDGSVIEGEITPAVEYSFELHAKQGFHRAFRLEERQTDVFWLAWE |
Ga0209246_103452001 | 3300027785 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKAFRDD |
Ga0209353_103568671 | 3300027798 | Freshwater Lake | MARLKIVRTDGSVIEGEITPAVEYSFELYAKKGFHRAFREDEMQ |
Ga0209229_102081731 | 3300027805 | Freshwater And Sediment | MAKLKITKTDGSVVEGEITPAVEYFFEQQTKMGFHRAFREEEKQSHVYLLAHEVIRRSGETVKPFGM |
Ga0209354_100956681 | 3300027808 | Freshwater Lake | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQTDVY |
Ga0209354_101301681 | 3300027808 | Freshwater Lake | MAKLKVTRADGQVQEFEITPLLEYSFEQYAKKGFHK |
Ga0209354_103544592 | 3300027808 | Freshwater Lake | MARLKIVRQDGSVLEGEISPAVEFSFEQYAKKGFHKA |
Ga0209230_102609454 | 3300027836 | Freshwater And Sediment | MARLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFRD |
Ga0209550_107543421 | 3300027892 | Freshwater Lake | MAKLKIVRQDGSIVEGEITPAVEYFFEQSTKMGFHKAFRDEEKQSHVYL |
Ga0209400_12077813 | 3300027963 | Freshwater Lake | MAKLKIVRTDGSVIEGEITPAVEYAFEQYAKKGFHK |
Ga0209191_10567705 | 3300027969 | Freshwater Lake | MAKLRVTTSDNTTTDYEITPLIEFAFEQYAKKGFHKAL |
Ga0209191_12352283 | 3300027969 | Freshwater Lake | MAKLKVTRADGSVNEYQITPAIEYAFEQHAKMGFQ |
Ga0209191_12417161 | 3300027969 | Freshwater Lake | MAKLKITRTDGSTLEGEITPAVEYSFELHHKAGFHRSFREQEMQGMVYWLAWEVTRRSGE |
Ga0255256_11015932 | 3300028271 | Freshwater | MAKLKIVRQDGSIVEGEITPAVEFFFEQSTKMGFHKAFRDEEKQSHVYLLAHEVIR |
(restricted) Ga0247831_11233161 | 3300028559 | Freshwater | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFHKAFR |
Ga0315907_108925123 | 3300031758 | Freshwater | MASLKVVRADGTESIHEITPAVEYAFEQYAKKGFYKAFREDQ |
Ga0315907_109122543 | 3300031758 | Freshwater | MASLKVVRADGTESIHEITPAVEYAFEQYAKKGFYKA |
Ga0315907_110174882 | 3300031758 | Freshwater | MAKLKVTRADGQVQEFEITPLLEYSFEQYAKKGFHKALI |
Ga0315900_101403556 | 3300031787 | Freshwater | MAKLKVTRADGSVGEYPITPLVQYGFEMYAKKGFHKAFIEN |
Ga0315285_109630471 | 3300031885 | Sediment | MAKLKIVREDGSVLEGEITPAVEYLFELHHKMGFHRAFRDEEKQTMVYWLAWEIT |
Ga0315901_110480332 | 3300031963 | Freshwater | MASLKVTRADGTESIHEITPAVEYAFEQYAKKGFYL |
Ga0315284_121760892 | 3300032053 | Sediment | MAKLKITRTTGEIQEFEITPTIEYAFEQNKKKGIH |
Ga0316621_104323441 | 3300033488 | Soil | MAKLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKALIED |
Ga0334979_0050217_2_130 | 3300033996 | Freshwater | MAKLKVTRADGQVQEYEITPVLEYSFEIFAKKGFHKALIEDQK |
Ga0334986_0220752_2_118 | 3300034012 | Freshwater | MARLKIVRTDGSTLEGEISPAVEYSFEQWAKKGFHKAFR |
Ga0335002_0142054_3_107 | 3300034020 | Freshwater | MAKLKIVRTDGSVLEGEITPAVEYSFEQYAKKGFH |
Ga0335021_0046232_3_191 | 3300034023 | Freshwater | MAKLKIVRNDGSVLEGEITPAVEYSFEQWAKKGFHKAFRDDEMQSSVYWLAWEVTRRSGESVK |
Ga0334987_0512843_1_111 | 3300034061 | Freshwater | MARLKIVRTDGSVIEGEITPAVEYAFEQYAKKGFHQA |
Ga0334987_0683122_1_138 | 3300034061 | Freshwater | MARLKVTRADGQVQEFEITPVLEYSFEQYAKKGFHKALIEDQKQSD |
Ga0335019_0277638_1_144 | 3300034066 | Freshwater | MAKLKIVKIDGSIVEGEITPAVEYFFEQQTKMGFHKAFRDEEKQSHVY |
Ga0334990_0366308_3_116 | 3300034068 | Freshwater | MAKLKVTRADGSVGEYPITPLVQYGFEIYAKKGFHKAF |
Ga0310130_0279159_1_126 | 3300034073 | Fracking Water | MASLKVVRADGTESIHEITPAIEYAFEQYAKVGFYRAFREQQ |
Ga0335027_0404933_2_202 | 3300034101 | Freshwater | MAKLKIVRTDGSVLEGEISPAVEFEFEQHAKMGFHKAFRELERQQDVYFLAWVVTRRSGETVKPYGM |
Ga0335029_0321558_1_117 | 3300034102 | Freshwater | MAKLKVTRADNSVTEYEITPLIEYAFEQYAKKGFHKALI |
Ga0335036_0416525_671_859 | 3300034106 | Freshwater | MARLKIVRTDGSTLEGEISPAVEYSFEQWAKKGFHKAFRDDEMQTSVFWLAWEITRRSGETVK |
Ga0335036_0611876_547_657 | 3300034106 | Freshwater | MAKLKVTRADGSVGEYPITPLVQYGFEIYAKKGFHKA |
Ga0335066_0199476_1045_1185 | 3300034112 | Freshwater | MAKLKIVRQDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQSDV |
Ga0335053_0246186_1027_1149 | 3300034118 | Freshwater | MAKLKIVRNDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDE |
Ga0335060_0642010_3_119 | 3300034122 | Freshwater | MAKLKVTRADGSVGEYPITPLVQYGFEIYAKKGFHKAFI |
Ga0335017_0160383_1_177 | 3300034167 | Freshwater | MARLKIVRTDGSVIEGEITPAVEYSFELYAKKGFHRAFREDEMQTSVYWLASRLHEKRG |
Ga0335064_0201497_3_128 | 3300034357 | Freshwater | MAKLKIVRTDGSIIEGEITPAVEYSFEIFAKKGFHRAFREEE |
Ga0335064_0246255_1000_1134 | 3300034357 | Freshwater | MAKLKIVRLDGSVLEGEITPAVEYSFEQYAKKGFHKAFRDEEKQS |
⦗Top⦘ |