Basic Information | |
---|---|
Family ID | F033634 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 177 |
Average Sequence Length | 41 residues |
Representative Sequence | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 177 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 77.97 % |
% of genes near scaffold ends (potentially truncated) | 31.64 % |
% of genes from short scaffolds (< 2000 bps) | 80.79 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (66.667 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (23.729 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.932 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.831 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 177 Family Scaffolds |
---|---|---|
PF01464 | SLT | 3.39 |
PF03592 | Terminase_2 | 2.26 |
PF02794 | HlyC | 1.69 |
PF01476 | LysM | 1.69 |
PF00583 | Acetyltransf_1 | 1.13 |
PF00145 | DNA_methylase | 0.56 |
PF13361 | UvrD_C | 0.56 |
PF00565 | SNase | 0.56 |
PF06737 | Transglycosylas | 0.56 |
COG ID | Name | Functional Category | % Frequency in 177 Family Scaffolds |
---|---|---|---|
COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 2.26 |
COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 66.67 % |
All Organisms | root | All Organisms | 33.33 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 23.73% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 22.60% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.99% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.34% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.65% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.39% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.82% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.82% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.26% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.69% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.69% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.69% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.69% |
Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.69% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.13% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.13% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.56% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.56% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.56% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.56% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.56% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.56% |
Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.56% |
Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.56% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.56% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019699 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_1-2_MG | Environmental | Open in IMG/M |
3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020168 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020184 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100111959 | 3300000101 | Marine | MFHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP* |
DelMOSum2010_100617523 | 3300000101 | Marine | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWVTP* |
DelMOSum2010_101233242 | 3300000101 | Marine | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLLITP* |
DelMOWin2010_100881673 | 3300000117 | Marine | MYHAIETLIKWCRGRQTTVLDDVLGGXALFAMLFILLLITP* |
DelMOWin2010_102625761 | 3300000117 | Marine | RQLMFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWVTP* |
OpTDRAFT_102985713 | 3300000928 | Freshwater And Marine | MCHAIETLIXXXXXXXXXXTTVLDDILGGIALFAMLFILLLVTP* |
JGI24006J15134_100154467 | 3300001450 | Marine | MYHGIETLIKWVRGNYTSTLEDILGAVALFAMLFILLWVTP* |
JGI24003J15210_100045695 | 3300001460 | Marine | MCHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP* |
JGI24003J15210_100827021 | 3300001460 | Marine | VQRLMYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP* |
JGI24003J15210_101270611 | 3300001460 | Marine | MYHGIETLIKWVRGNYTSMLEDILGAVALFAMLFILLLVTP* |
JGI24003J15210_101436452 | 3300001460 | Marine | MYHAIETLIKWCRGHKTTVLDDILGGIALFAMLFLLLLVTP* |
JGI24004J15324_100249395 | 3300001472 | Marine | MYHAIETLIKWCRGHKTTVLDDILGGIALFAMLFILLWVTP* |
JGI25132J35274_11152061 | 3300002483 | Marine | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILIWMTP* |
Water_1033876 | 3300002930 | Estuary Water | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP* |
JGI26082J51739_100822772 | 3300003617 | Marine | VQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP* |
Ga0068515_1269502 | 3300004829 | Marine Water | MYHAIETLIKWCRGQQTSVLGDILGGVALFAMLFLALAITT* |
Ga0074648_10070766 | 3300005512 | Saline Water And Sediment | MYHAIDTLIKWCRGQSTSVLEDVLGGIALFAMLFILLLLTP* |
Ga0074648_10324056 | 3300005512 | Saline Water And Sediment | MYHAIETLIKWCRGHSTSVLGDILGGVALFALLFLALAITT* |
Ga0074648_10509704 | 3300005512 | Saline Water And Sediment | MYHAIDTLIRWIKRRPTTILGDILGGVALFAMLFIALAITT* |
Ga0075474_100133556 | 3300006025 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLITP* |
Ga0075474_100428163 | 3300006025 | Aqueous | MFHAIETLIKWCRGRQTTVLEDVLGCVALFAMLFILLGVTT* |
Ga0075474_101821662 | 3300006025 | Aqueous | MYHAIETLVKWCRGQSTSVLGDILGGVALFAMLFILLGVTT* |
Ga0075474_102529061 | 3300006025 | Aqueous | ETLIKWCRGRQTTVLDDVLGGIALFAILFILLWMTP* |
Ga0075478_100157865 | 3300006026 | Aqueous | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP* |
Ga0075478_100935972 | 3300006026 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLWVTP* |
Ga0075466_10658853 | 3300006029 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP* |
Ga0098054_10378921 | 3300006789 | Marine | MCHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP* |
Ga0098054_10386814 | 3300006789 | Marine | MYHAIDTLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP* |
Ga0070749_100492274 | 3300006802 | Aqueous | MYHAIETLIRWINRKPTTTLEDILGGVALFVMLFIALSILT* |
Ga0070749_100711341 | 3300006802 | Aqueous | MYHAIETLIKWCRGQWTSVLSDVLGGVALFAMLFLALAITT* |
Ga0070749_101201814 | 3300006802 | Aqueous | MYHAIETLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT* |
Ga0070749_102196113 | 3300006802 | Aqueous | MFHAIETLIKWCRGRQTTVLEDILGGIALFAMLFILLGVTT* |
Ga0070749_102533723 | 3300006802 | Aqueous | MYHAIETLIKWCRGQSTSVLSDVLGGVALFAMLFLALAITT* |
Ga0070749_102608482 | 3300006802 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLWVTP* |
Ga0070749_104337832 | 3300006802 | Aqueous | MYHAIETLIKWCRGQSTSVLDDILDGVALFAMLFLALAITT* |
Ga0070749_107096243 | 3300006802 | Aqueous | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP* |
Ga0070749_107481752 | 3300006802 | Aqueous | MYHAIETLTRWIQRKPTTVLGDILGGIALFAMLFILVSITT* |
Ga0070754_100877494 | 3300006810 | Aqueous | MYHAIDTLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT* |
Ga0070754_103468642 | 3300006810 | Aqueous | MYHAIDTLIRWIKRRPTTVLGDILGGVALFAMLFIALSIFT* |
Ga0075481_101219464 | 3300006868 | Aqueous | HAIETLIKWCRGQWTSVLGDVLGGVALFAMLFILLGVTT* |
Ga0075479_103494922 | 3300006870 | Aqueous | YHAIDTLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT* |
Ga0070750_100722463 | 3300006916 | Aqueous | MFHAIETLIKWCRGRQTTVLEDILGGVALFAMLFILLGVTT* |
Ga0070750_101153144 | 3300006916 | Aqueous | MYHAIETLIKWCRGQWTSVLGDVLGGVALFAMLFLALAITT* |
Ga0070750_104038652 | 3300006916 | Aqueous | MYHAIETLIKWCRGQSTSVLGDVLGGVALFAMLFILLGVTT* |
Ga0070746_102608771 | 3300006919 | Aqueous | VRTVLMYHAIDTLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT* |
Ga0070748_11459141 | 3300006920 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILSAVALFAMLFILLLITP* |
Ga0098060_11946162 | 3300006921 | Marine | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLWVTP* |
Ga0098045_11378961 | 3300006922 | Marine | MYHAIDTLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP* |
Ga0070745_13285722 | 3300007344 | Aqueous | MYHAIETLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT* |
Ga0070752_10832241 | 3300007345 | Aqueous | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFIL |
Ga0102945_10965111 | 3300007609 | Pond Water | MYHAIETLSKWIRGRRTEVLEDILGAFALFAMLFIGLFFAAALGG* |
Ga0102823_11640222 | 3300007692 | Estuarine | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLLVTP* |
Ga0102951_11718732 | 3300007725 | Water | RSVLMYHAIETLIKWCRGRQTTVLDDVLGAVALFAMLFILLLITP* |
Ga0075480_104753582 | 3300008012 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLWVAP* |
Ga0102963_10736523 | 3300009001 | Pond Water | MYHAIETLTRWIQRKPTTVLGDILGGITLFAMLFFLVSITT* |
Ga0102963_13139512 | 3300009001 | Pond Water | MYHAIETLIRWIQGKHTSPLDDILGGVALFAMLFILVSITT* |
Ga0115566_103421962 | 3300009071 | Pelagic Marine | MFHAVETLIKWCRGRQTTVLDDILGAVALFAMLFILLWVTP* |
Ga0115549_10502184 | 3300009074 | Pelagic Marine | HAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLWVTP* |
Ga0102814_100687435 | 3300009079 | Estuarine | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIF |
Ga0114918_104966332 | 3300009149 | Deep Subsurface | MYHAIETLIKWCRGRQTTVLDDVLGCIALFAILFVMLWVTP* |
Ga0115545_10818231 | 3300009433 | Pelagic Marine | MYHAVETLIKWCRGRQTTVLDDILGAVALFAMLFILLWVTP* |
Ga0115565_102524481 | 3300009467 | Pelagic Marine | TLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP* |
Ga0098049_11251781 | 3300010149 | Marine | YHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP* |
Ga0098049_12422912 | 3300010149 | Marine | AIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP* |
Ga0129348_10203465 | 3300010296 | Freshwater To Marine Saline Gradient | MYHAIDTLIKWCRGQSTSVLSDVLGGVALFAMLFLALAITT* |
Ga0182078_103654792 | 3300016747 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDILGGVALFAMLFIL |
Ga0181412_10842613 | 3300017714 | Seawater | LMYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLLVTP |
Ga0181404_11643542 | 3300017717 | Seawater | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLLVTP |
Ga0181381_10750622 | 3300017726 | Seawater | MYHAIETLIKWCRGHKTTVLDDILGGIALFAMLFILLLVTP |
Ga0181392_11646391 | 3300017749 | Seawater | FRSRRMARRVQRLMYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0181422_10101735 | 3300017762 | Seawater | MARRVQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFIFLLITP |
Ga0181410_10776392 | 3300017763 | Seawater | MARRVQRLMYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLLVTP |
Ga0181406_12409252 | 3300017767 | Seawater | RCGSSMARRVQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFIFLLITP |
Ga0181424_103528322 | 3300017786 | Seawater | MYHAIETLIKWCRGRQSTVLDDILGGIALFAMLFILLWVTP |
Ga0181565_102515703 | 3300017818 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDVLGGVALFAMLFILLGVTT |
Ga0181565_106198072 | 3300017818 | Salt Marsh | MFHAIETLIKWCRGRQTTVLEDVLGCVALFAMLFILLGVTT |
Ga0181565_107508902 | 3300017818 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT |
Ga0181552_100552005 | 3300017824 | Salt Marsh | MFHAIETLIKWCRGRQTTVLEDILGGVALFAMLFILLGVTT |
Ga0181584_100890344 | 3300017949 | Salt Marsh | MYHAIETLTRWIQRKPTTVLGDILGGVALFAMLFILLGVTT |
Ga0181584_102309433 | 3300017949 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDILGGVALFAMLFLALAITT |
Ga0181577_100742657 | 3300017951 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLEDVLGGVALFAMLFILLGVTT |
Ga0181577_104635781 | 3300017951 | Salt Marsh | MYHAIETLIKWCRGHSTSVLGDILGGVALFAMLFI |
Ga0181577_106985812 | 3300017951 | Salt Marsh | AIETLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT |
Ga0181577_108940792 | 3300017951 | Salt Marsh | HAIETLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT |
Ga0181577_109364492 | 3300017951 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLGDVLGGVALFALLFLALAITT |
Ga0181583_102112624 | 3300017952 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT |
Ga0181580_108799171 | 3300017956 | Salt Marsh | AIDTLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT |
Ga0181582_105798893 | 3300017958 | Salt Marsh | MYHAIETLIKWCRGQSTSVLSDILGGVALFALLFLALAITA |
Ga0181590_110807462 | 3300017967 | Salt Marsh | MYHAIETLVKWCRGQSTSVLGDILGGVALFAMLFILLGVTT |
Ga0181585_104739533 | 3300017969 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLGDILGGVALFAMLFILLGVTT |
Ga0181585_105349812 | 3300017969 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLADVLGGVALFAMLFILLGVTT |
Ga0181569_102127061 | 3300017986 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDVLGGVALFALLFI |
Ga0181569_108879742 | 3300017986 | Salt Marsh | RYQMYHAIETLTRWIQRKPTTVLGDILGGVALFAMLFILLGVTT |
Ga0181569_110199452 | 3300017986 | Salt Marsh | MFHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLWMTP |
Ga0181572_102837252 | 3300018049 | Salt Marsh | MYHAIETLIKWCRGQSTSVLSDILGGVALFALLFLALAITT |
Ga0181561_101704711 | 3300018410 | Salt Marsh | VQRIMFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0181560_100892682 | 3300018413 | Salt Marsh | MFHAIETLIKWCRGRQTTVLDDILGGVALFAMLFILLWMTP |
Ga0181559_101732513 | 3300018415 | Salt Marsh | MYHAIETLIKWCRGHSTSVLGDILGGVALFAMLFILLGVTT |
Ga0181553_103544802 | 3300018416 | Salt Marsh | MLHAIETLIKWCRGRQTTVLDDILGGVALFAMLFILLWMTP |
Ga0181567_103699282 | 3300018418 | Salt Marsh | MYHAIETLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT |
Ga0181591_111426961 | 3300018424 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLGDVLGGVALFAMLFILLGVTT |
Ga0181564_100423706 | 3300018876 | Salt Marsh | MFHAIEPLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0181562_103243731 | 3300019459 | Salt Marsh | MFHAIETLIKWCRGRQTTVLDDILGGVALFAMLFITLSITT |
Ga0193985_10456722 | 3300019699 | Sediment | MYHAIETLIKWCRGQSTSVLSDVLGGVALFAMLFLALAITT |
Ga0181555_13191271 | 3300020051 | Salt Marsh | MFHAIETLIKWCRGRQTTVLEDVLGCVALFAMLFI |
Ga0181588_101144933 | 3300020168 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDVLGGVALFAMLFLALAITT |
Ga0181573_102742611 | 3300020184 | Salt Marsh | ETLIKWCRGQSTSVLGDVLGGVALFAMLFILLGVTT |
Ga0206131_100876041 | 3300020185 | Seawater | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLWVTP |
Ga0181578_100938711 | 3300020189 | Salt Marsh | MYHAIETLTRWIQRKPTTVLGDILGGVALFAMLFLALAITT |
Ga0211504_10586803 | 3300020347 | Marine | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0211505_10942523 | 3300020352 | Marine | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFIFLLITP |
Ga0211677_101912722 | 3300020385 | Marine | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP |
Ga0211659_101471551 | 3300020404 | Marine | MYHAIETLIKWCRGRQTAVLDDILGGIALFAMLFILLLVTP |
Ga0211576_106646452 | 3300020438 | Marine | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLL |
Ga0211577_103281532 | 3300020469 | Marine | MYHAIETLIKWCRGRQTTALDDVLGGIALFAMLFILLLVTP |
Ga0213858_104410842 | 3300021356 | Seawater | MYHAIDTLIKWCRGQSTSVLSDVLGGVALFAMLFLALAITT |
Ga0213860_102722731 | 3300021368 | Seawater | MYHAIDTLIKWCRGQSTSVLADVLGGVALFAMLFILLGVT |
Ga0213865_102023774 | 3300021373 | Seawater | RVCQLMFHAIETLIKWCRGRQTTVLDDILGGVALFAMLFILLWMTP |
Ga0213864_102141711 | 3300021379 | Seawater | KGHALMYHAIDTLIKWCRGQSTSVLADVLGGIALFAMLFILLGVTT |
Ga0213868_101322062 | 3300021389 | Seawater | MFHAIETLIKWCRGRQTTVLDDILGGIALFAMLFITLSITT |
Ga0222717_100145418 | 3300021957 | Estuarine Water | MFHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP |
Ga0222717_100417834 | 3300021957 | Estuarine Water | MCHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP |
Ga0222717_101220424 | 3300021957 | Estuarine Water | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLVTP |
Ga0222717_105398492 | 3300021957 | Estuarine Water | ARRVQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFIFLLVTP |
Ga0222718_100241799 | 3300021958 | Estuarine Water | MYHAIETLIKWCRGRQTTVLDDVLGAVALFAMLFILLLITP |
Ga0222718_100362114 | 3300021958 | Estuarine Water | MYHAIETLIKWCRGQSTSVLEDILGGVALFAMLFILLGITT |
Ga0222718_100833871 | 3300021958 | Estuarine Water | MARRVQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP |
Ga0222718_103750363 | 3300021958 | Estuarine Water | GSSMARRVQRLMYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0222716_100441006 | 3300021959 | Estuarine Water | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFIFLLVTP |
Ga0222716_105241522 | 3300021959 | Estuarine Water | MARRVQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLVTP |
Ga0222715_100298045 | 3300021960 | Estuarine Water | MARRVQRLMYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFIFLLVTP |
Ga0222715_102384181 | 3300021960 | Estuarine Water | MYHAIDTLIRWIKRRPTTVLGDILGGIALFAMLFIALSIFT |
Ga0222714_106539982 | 3300021961 | Estuarine Water | SSMARRVQRLMYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0196883_10105764 | 3300022050 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLITP |
Ga0212028_10326431 | 3300022071 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFI |
Ga0224906_10257884 | 3300022074 | Seawater | MFHAIETLIKWCRGRQTTVLEDILGCVALFAMLFILLGVTT |
Ga0224906_11582311 | 3300022074 | Seawater | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLWVTP |
Ga0196899_10277563 | 3300022187 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLWVTP |
Ga0224502_101463161 | 3300022218 | Sediment | MYHAIETLIKWCRGRQTTVLDDILGAVALFAMLFIFLLITP |
Ga0255783_103762052 | 3300022923 | Salt Marsh | RRVCQLMFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0255781_101305302 | 3300022934 | Salt Marsh | MYHAIETLIKWCRGQSTSVLGDVLGGVALFALLFILLGVTT |
Ga0255780_102897641 | 3300022935 | Salt Marsh | MYHAIDTLIKWCRGQSTSVLGDILGGVALFAMLFLALAITT |
Ga0255774_103128631 | 3300023087 | Salt Marsh | ARRRREAHQGRTKGHALMYHAIDTLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT |
(restricted) Ga0233411_100882981 | 3300023112 | Seawater | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLLITP |
Ga0255760_102640731 | 3300023115 | Salt Marsh | LMYHAIETLIKWCRGQSTSVLSDILGGVALFALLFLALAITA |
Ga0255768_106161571 | 3300023180 | Salt Marsh | QGRTKGHALMYHAIDTLIKWCRGQSTSVLSDVLGGVALFAMLFILLGVTT |
(restricted) Ga0255048_100962314 | 3300024518 | Seawater | MARRVQRLMYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLLVTP |
Ga0208667_10004914 | 3300025070 | Marine | MYHAIDTLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0208298_10259981 | 3300025084 | Marine | MCHAIETLIKWCRGRQTTVLDDILGAVALFAMLFILLLITP |
Ga0208792_10023326 | 3300025085 | Marine | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMTP |
Ga0208159_10207724 | 3300025101 | Marine | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP |
Ga0209535_10178238 | 3300025120 | Marine | MYHGIETLIKWVRGNYTSTLEDILGAVALFAMLFILLWVTP |
Ga0209535_10473022 | 3300025120 | Marine | MYHAIETLIKWCRGHKTTVLDDILGGIALFAMLFLLLLVTP |
Ga0209535_10532552 | 3300025120 | Marine | MYHGIETLIKWVRGNYTSMLEDILGAVALFAMLFILLLVTP |
Ga0208919_10529765 | 3300025128 | Marine | VQRLMYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP |
Ga0209336_101404782 | 3300025137 | Marine | MYHAIETLIKWCRGHKTTVLDDILGGIALFAMLFILLWVTP |
Ga0209645_10459423 | 3300025151 | Marine | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILIWMTP |
Ga0208643_11312951 | 3300025645 | Aqueous | QERAKGNALMFHAIETLIKWCRGRQTTVLEDVLGCVALFAMLFILLGVTT |
Ga0208428_10180476 | 3300025653 | Aqueous | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFI |
Ga0208428_10474721 | 3300025653 | Aqueous | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWM |
Ga0208428_11119823 | 3300025653 | Aqueous | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLLITP |
Ga0208899_10241737 | 3300025759 | Aqueous | MFHAIETLIKWCRGRQTTVLEDILGGIALFAMLFILLGVTT |
Ga0208899_10344961 | 3300025759 | Aqueous | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLLI |
Ga0208899_11388281 | 3300025759 | Aqueous | MYHAIETLIKWCRGQWTSVLGDVLGGVALFAMLFLALAITT |
Ga0208899_12565923 | 3300025759 | Aqueous | IETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVTP |
Ga0208767_10453361 | 3300025769 | Aqueous | MYHAIETLIKWCRGQWTSVLSDVLGGVALFAMLFLALAITT |
Ga0209555_103482992 | 3300025879 | Marine | MYHAIETLIKWCRGRQTTVLDDILGAVALFSMLFILLLITP |
Ga0208544_102691512 | 3300025887 | Aqueous | NALMFHAIETLIKWCRGRQTTVLEDVLGCVALFAMLFILLGVTT |
Ga0209630_100555526 | 3300025892 | Pelagic Marine | MFHAVETLIKWCRGRQTTVLDDILGAVALFAMLFILLWVTP |
Ga0208304_100931614 | 3300027751 | Estuarine | MYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLLVTP |
(restricted) Ga0233413_100542731 | 3300027996 | Seawater | MARRVQRLMYHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLL |
Ga0307488_104859492 | 3300031519 | Sackhole Brine | MYHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFVLLLITP |
Ga0307488_107740971 | 3300031519 | Sackhole Brine | MFHAIETLIKWCRGRQTTVLDDILGGIALFAMLFIFLLVTP |
Ga0307380_101776792 | 3300031539 | Soil | MYHAIETLIKWCRGRQTTVLDDVLGCIALFAILFVMLWVTP |
Ga0307379_101383631 | 3300031565 | Soil | AIETLIKWCRGRQTTVLDDVLGCIALFAILFVMLWVTP |
Ga0307489_111237331 | 3300031569 | Sackhole Brine | MFHAIETLIKWCRGRQTTVLDDILGGIALFAMLFILLLVT |
Ga0348335_044189_2_121 | 3300034374 | Aqueous | MFHAIETLIKWCRGRQTTVLDDVLGGIALFAMLFILLWMT |
⦗Top⦘ |