Basic Information | |
---|---|
Family ID | F033753 |
Family Type | Metagenome |
Number of Sequences | 176 |
Average Sequence Length | 46 residues |
Representative Sequence | KRTRCDALFAGAHMSHREGRPSAVVVSHAEEILRHTDIPVVIQP |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.15 % |
% of genes near scaffold ends (potentially truncated) | 97.16 % |
% of genes from short scaffolds (< 2000 bps) | 85.80 % |
Associated GOLD sequencing projects | 134 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.864 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.159 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.455 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.818 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.94% β-sheet: 22.22% Coil/Unstructured: 70.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF00075 | RNase_H | 78.41 |
PF00383 | dCMP_cyt_deam_1 | 11.93 |
PF00582 | Usp | 5.11 |
PF00180 | Iso_dh | 1.70 |
PF02803 | Thiolase_C | 0.57 |
PF09990 | DUF2231 | 0.57 |
PF12773 | DZR | 0.57 |
PF04978 | DUF664 | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.86 % |
Unclassified | root | N/A | 1.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002558|JGI25385J37094_10172496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 579 | Open in IMG/M |
3300002560|JGI25383J37093_10063691 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300002561|JGI25384J37096_10088778 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300002562|JGI25382J37095_10194442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 616 | Open in IMG/M |
3300002908|JGI25382J43887_10190414 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300002909|JGI25388J43891_1007974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2043 | Open in IMG/M |
3300004808|Ga0062381_10330271 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005166|Ga0066674_10537690 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 521 | Open in IMG/M |
3300005171|Ga0066677_10572544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 644 | Open in IMG/M |
3300005174|Ga0066680_10316739 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300005184|Ga0066671_10604317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 711 | Open in IMG/M |
3300005186|Ga0066676_10348866 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300005406|Ga0070703_10016314 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
3300005436|Ga0070713_101876868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 581 | Open in IMG/M |
3300005440|Ga0070705_101852435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 512 | Open in IMG/M |
3300005446|Ga0066686_10812610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 621 | Open in IMG/M |
3300005467|Ga0070706_100175333 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
3300005468|Ga0070707_100934891 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300005471|Ga0070698_100293575 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300005526|Ga0073909_10291350 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 739 | Open in IMG/M |
3300005542|Ga0070732_10587980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 676 | Open in IMG/M |
3300005547|Ga0070693_100826584 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 689 | Open in IMG/M |
3300005552|Ga0066701_10062727 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
3300005554|Ga0066661_10253180 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300005555|Ga0066692_10398448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 873 | Open in IMG/M |
3300005555|Ga0066692_10729836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 612 | Open in IMG/M |
3300005556|Ga0066707_10071400 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
3300005556|Ga0066707_10332329 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300005568|Ga0066703_10109396 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300005569|Ga0066705_10865483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
3300005574|Ga0066694_10580658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 522 | Open in IMG/M |
3300005576|Ga0066708_11020675 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 513 | Open in IMG/M |
3300005598|Ga0066706_10407032 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1083 | Open in IMG/M |
3300006031|Ga0066651_10590367 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300006755|Ga0079222_10934292 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 734 | Open in IMG/M |
3300006755|Ga0079222_11985455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
3300006791|Ga0066653_10702197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
3300006794|Ga0066658_10078134 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300006794|Ga0066658_10455137 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 696 | Open in IMG/M |
3300006796|Ga0066665_10467256 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300006797|Ga0066659_10138468 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
3300006845|Ga0075421_100232936 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
3300006845|Ga0075421_101777867 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300006903|Ga0075426_10476686 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300007004|Ga0079218_11858268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 678 | Open in IMG/M |
3300007255|Ga0099791_10204203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 932 | Open in IMG/M |
3300007788|Ga0099795_10287859 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
3300009012|Ga0066710_103210301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 628 | Open in IMG/M |
3300009012|Ga0066710_104557512 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
3300009038|Ga0099829_10396593 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300009038|Ga0099829_10905337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 732 | Open in IMG/M |
3300009038|Ga0099829_10921463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 725 | Open in IMG/M |
3300009090|Ga0099827_10744490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 847 | Open in IMG/M |
3300009098|Ga0105245_12986853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
3300009137|Ga0066709_100028569 | All Organisms → cellular organisms → Bacteria | 5848 | Open in IMG/M |
3300009137|Ga0066709_101669397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 906 | Open in IMG/M |
3300009147|Ga0114129_10711911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1289 | Open in IMG/M |
3300009553|Ga0105249_13315290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
3300010303|Ga0134082_10200965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 816 | Open in IMG/M |
3300010304|Ga0134088_10587277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 553 | Open in IMG/M |
3300010322|Ga0134084_10203934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
3300010323|Ga0134086_10257771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 666 | Open in IMG/M |
3300010325|Ga0134064_10273462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 634 | Open in IMG/M |
3300010333|Ga0134080_10602651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 535 | Open in IMG/M |
3300010335|Ga0134063_10691667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
3300010361|Ga0126378_11857317 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 685 | Open in IMG/M |
3300010364|Ga0134066_10073749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 935 | Open in IMG/M |
3300010400|Ga0134122_10125591 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
3300010400|Ga0134122_11690598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 660 | Open in IMG/M |
3300010403|Ga0134123_13644458 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 500 | Open in IMG/M |
3300011420|Ga0137314_1066499 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 875 | Open in IMG/M |
3300011430|Ga0137423_1115111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 804 | Open in IMG/M |
3300011443|Ga0137457_1014593 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300012189|Ga0137388_12041196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
3300012198|Ga0137364_10066463 | All Organisms → cellular organisms → Bacteria | 2454 | Open in IMG/M |
3300012198|Ga0137364_10357110 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300012199|Ga0137383_10050343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2976 | Open in IMG/M |
3300012200|Ga0137382_10294942 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300012203|Ga0137399_10641613 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300012204|Ga0137374_10678029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 777 | Open in IMG/M |
3300012206|Ga0137380_11459840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
3300012208|Ga0137376_10061239 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
3300012210|Ga0137378_11458196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 596 | Open in IMG/M |
3300012285|Ga0137370_10706862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 626 | Open in IMG/M |
3300012353|Ga0137367_10552450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 809 | Open in IMG/M |
3300012354|Ga0137366_10487903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 891 | Open in IMG/M |
3300012355|Ga0137369_10334160 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300012359|Ga0137385_11535800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 530 | Open in IMG/M |
3300012361|Ga0137360_11050613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 703 | Open in IMG/M |
3300012361|Ga0137360_11078488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 694 | Open in IMG/M |
3300012925|Ga0137419_10076504 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
3300012927|Ga0137416_11828437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
3300012929|Ga0137404_11785720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 572 | Open in IMG/M |
3300012972|Ga0134077_10131398 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300012972|Ga0134077_10449472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
3300012976|Ga0134076_10330370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 666 | Open in IMG/M |
3300014150|Ga0134081_10054462 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300014154|Ga0134075_10093894 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300014166|Ga0134079_10214260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 815 | Open in IMG/M |
3300015242|Ga0137412_10044293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3631 | Open in IMG/M |
3300015356|Ga0134073_10227515 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 633 | Open in IMG/M |
3300015358|Ga0134089_10440095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 562 | Open in IMG/M |
3300017654|Ga0134069_1018176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2092 | Open in IMG/M |
3300017659|Ga0134083_10459573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 564 | Open in IMG/M |
3300017997|Ga0184610_1260960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
3300018028|Ga0184608_10010300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3167 | Open in IMG/M |
3300018031|Ga0184634_10462384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
3300018064|Ga0187773_10315516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 878 | Open in IMG/M |
3300018431|Ga0066655_10296187 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300018433|Ga0066667_10831778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 788 | Open in IMG/M |
3300018468|Ga0066662_10002991 | All Organisms → cellular organisms → Bacteria | 8047 | Open in IMG/M |
3300018468|Ga0066662_10008697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5181 | Open in IMG/M |
3300021086|Ga0179596_10070285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1516 | Open in IMG/M |
3300022694|Ga0222623_10007035 | All Organisms → cellular organisms → Bacteria | 4007 | Open in IMG/M |
3300024246|Ga0247680_1014294 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300024330|Ga0137417_1484336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1622 | Open in IMG/M |
3300025165|Ga0209108_10462265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 614 | Open in IMG/M |
3300025311|Ga0209343_10806837 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
3300025322|Ga0209641_10109828 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2107 | Open in IMG/M |
3300025885|Ga0207653_10046285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1438 | Open in IMG/M |
3300025905|Ga0207685_10504699 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
3300026075|Ga0207708_10011243 | All Organisms → cellular organisms → Bacteria | 6662 | Open in IMG/M |
3300026277|Ga0209350_1138580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
3300026295|Ga0209234_1068317 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300026295|Ga0209234_1123689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
3300026296|Ga0209235_1107986 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300026296|Ga0209235_1122381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
3300026298|Ga0209236_1026433 | All Organisms → cellular organisms → Bacteria | 3161 | Open in IMG/M |
3300026307|Ga0209469_1051348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1299 | Open in IMG/M |
3300026308|Ga0209265_1037905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1490 | Open in IMG/M |
3300026309|Ga0209055_1200097 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 611 | Open in IMG/M |
3300026309|Ga0209055_1207772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 599 | Open in IMG/M |
3300026310|Ga0209239_1106144 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300026313|Ga0209761_1186614 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300026317|Ga0209154_1111991 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300026324|Ga0209470_1013238 | All Organisms → cellular organisms → Bacteria | 4781 | Open in IMG/M |
3300026325|Ga0209152_10108467 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300026328|Ga0209802_1130138 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300026329|Ga0209375_1249693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 596 | Open in IMG/M |
3300026332|Ga0209803_1358469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
3300026334|Ga0209377_1346613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 501 | Open in IMG/M |
3300026335|Ga0209804_1181620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 908 | Open in IMG/M |
3300026480|Ga0257177_1030370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 796 | Open in IMG/M |
3300026529|Ga0209806_1221602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 645 | Open in IMG/M |
3300026537|Ga0209157_1105981 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1325 | Open in IMG/M |
3300026540|Ga0209376_1104545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1441 | Open in IMG/M |
3300026548|Ga0209161_10249424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 925 | Open in IMG/M |
3300026551|Ga0209648_10213666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1460 | Open in IMG/M |
3300026557|Ga0179587_11182695 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
3300027273|Ga0209886_1062267 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 591 | Open in IMG/M |
3300027273|Ga0209886_1082561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
3300027573|Ga0208454_1005179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3713 | Open in IMG/M |
3300027643|Ga0209076_1024691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1650 | Open in IMG/M |
3300027787|Ga0209074_10413904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 568 | Open in IMG/M |
3300027842|Ga0209580_10425285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 662 | Open in IMG/M |
3300027846|Ga0209180_10130969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1440 | Open in IMG/M |
3300027846|Ga0209180_10443140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 732 | Open in IMG/M |
3300027882|Ga0209590_10220677 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300027882|Ga0209590_10324982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 990 | Open in IMG/M |
3300028811|Ga0307292_10350150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 623 | Open in IMG/M |
3300028814|Ga0307302_10139272 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300028814|Ga0307302_10334218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 746 | Open in IMG/M |
3300028828|Ga0307312_10330514 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300031152|Ga0307501_10100470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 730 | Open in IMG/M |
3300031226|Ga0307497_10242459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 801 | Open in IMG/M |
3300031720|Ga0307469_10647798 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300031754|Ga0307475_11496225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 518 | Open in IMG/M |
3300031949|Ga0214473_12335102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 511 | Open in IMG/M |
3300032174|Ga0307470_10619473 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 812 | Open in IMG/M |
3300032180|Ga0307471_101152656 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300032954|Ga0335083_10660358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 854 | Open in IMG/M |
3300033412|Ga0310810_10541187 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300034164|Ga0364940_0132762 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 712 | Open in IMG/M |
3300034165|Ga0364942_0202372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 648 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.16% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.27% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.27% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.70% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.70% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.14% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.14% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.14% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.57% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.57% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25385J37094_101724961 | 3300002558 | Grasslands Soil | VAGVVRRTRCDALFAGAHVPHGGERPSVVVSHAEEILRHTDIPVVIQP* |
JGI25383J37093_100636913 | 3300002560 | Grasslands Soil | IRCDALFAGAHMEIREGRPSGVVVSHAEEILRHTDIPVVIQP* |
JGI25384J37096_100887783 | 3300002561 | Grasslands Soil | TPGAAVARVIERTKCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIEP* |
JGI25382J37095_101944421 | 3300002562 | Grasslands Soil | KCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIEP* |
JGI25382J43887_101904141 | 3300002908 | Grasslands Soil | VIQETRCDALFAGAHVGRRDVTVSHAEEILLHTDIPVVIQP* |
JGI25388J43891_10079741 | 3300002909 | Grasslands Soil | IKRTQCDSLFAGAHMSHVDGRPSAIVVSHAEEILRHTDIPVVIQP* |
Ga0062381_103302711 | 3300004808 | Wetland Sediment | VARVVARTNCDALFVGAHVPHHGKVTVSHAEEILLHTDIPVVIQP* |
Ga0066674_105376901 | 3300005166 | Soil | RCDALFAGAHMSHSEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066677_105725441 | 3300005171 | Soil | EAVAQVIQRTQCDALFAGAHVGERHAVTVSHAEEILLHTDIPVVIQP* |
Ga0066680_103167391 | 3300005174 | Soil | GTPGEAVARVIQRTQCDALFVGAHVGSGGGGAGRRSDVTVSHAEEILGHTDIPVVIQP* |
Ga0066671_106043171 | 3300005184 | Soil | QVIKRTQCDSLFAGAHMSHVDGRPSAIVVSHAEEILRHTDIPVVIQP* |
Ga0066676_103488663 | 3300005186 | Soil | PGEVVARVIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQP* |
Ga0070703_100163144 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | IRCDALFAGAHMSHAEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0070713_1018768681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NVVKRTRCDALFAGAHMSHREGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0070705_1018524351 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ARVIKRIRCDALFAGAHMSHVEGRPSEVVVSHAEEILRHTDIPVVIQP* |
Ga0066686_108126102 | 3300005446 | Soil | PGEVVADVVRRTRCDALFAGAHVPHGHERPSVVVSHAEDILRSTDIPVVIQP* |
Ga0070706_1001753331 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TKCDALFAGAHVTHGRTSKVSVSHAEQILRHTDIPVVIQP* |
Ga0070707_1009348911 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VERTKCDALFAGAHVTRGRTSKVTVSHAEEILRHTDIPVVVQP* |
Ga0070698_1002935751 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKVVARTNCDALFAGAHVTRGRTSKVTVSHAEEILRHTDIPVIVQP* |
Ga0073909_102913501 | 3300005526 | Surface Soil | PGTPGAAVARVIERTKCDALFAGAHVASQGGRGKRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0070732_105879802 | 3300005542 | Surface Soil | KPGEVVATVVRRAGADCLFAGAHVPRASERPSVVVSHAEDILRHTDLPVIVQP* |
Ga0070693_1008265841 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEAVARVIRLTQCDALFAGAHIGKRLAVTVSHAEEILLHTDIPVVIQP* |
Ga0066701_100627274 | 3300005552 | Soil | PGEVVARVIKRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066661_102531803 | 3300005554 | Soil | AAVARVIERTKCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0066692_103984483 | 3300005555 | Soil | RVIKRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066692_107298362 | 3300005555 | Soil | GEVVARVIKRIRCDALFAGAHMEIRQGRPSGVVVSHAEEILLHTDIPVVIQP* |
Ga0066707_100714004 | 3300005556 | Soil | PGEVVARVIKRIRCDALFAGAHMNHVEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066707_103323291 | 3300005556 | Soil | THCDALFAGAHMTHQQGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066703_101093964 | 3300005568 | Soil | SRVIQRIQCDALFAGAHVGSGRRSEVTVSHAEEILLHTDIPVVIQP* |
Ga0066705_108654831 | 3300005569 | Soil | RVIKRTRCDALFAGAHLSHQHGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066694_105806581 | 3300005574 | Soil | QRTECDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0066708_110206751 | 3300005576 | Soil | LFAGAHMTHVDGRPSAVVVSHAEEILLHTDIPVVIQP* |
Ga0066706_104070324 | 3300005598 | Soil | GEVVARVIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQP* |
Ga0066651_105903672 | 3300006031 | Soil | GTPGEAVARVIQRTECDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0079222_109342921 | 3300006755 | Agricultural Soil | ANVVKRTRCDALFAGAHMSHREGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0079222_119854552 | 3300006755 | Agricultural Soil | FAGAHMSHRDGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066653_107021972 | 3300006791 | Soil | HVEPGKPGEVVARMIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQP* |
Ga0066658_100781344 | 3300006794 | Soil | RCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0066658_104551372 | 3300006794 | Soil | FAGAHMTHVDGRPSAVVVSHAEEILLHTDIPVVIQP* |
Ga0066665_104672563 | 3300006796 | Soil | FAGAHMSHVEGRPSEVVVSHAEEILRHTDIPVVIQP* |
Ga0066659_101384681 | 3300006797 | Soil | QCDSLFAGAHMSHVDGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0075421_1002329365 | 3300006845 | Populus Rhizosphere | QRTQCDALFAGAHVTHGRTSKVTVSHAEEILRHTDIPVVVQP* |
Ga0075421_1017778671 | 3300006845 | Populus Rhizosphere | GQVVAAVVQRTGCDALFGGAHVVRGRTSGVTVSHAEEILRHTDIPVVIQP* |
Ga0075426_104766861 | 3300006903 | Populus Rhizosphere | KPGEVVAQVIKRTRCDALFAGAHLTHQHGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0079218_118582681 | 3300007004 | Agricultural Soil | QTKCDALFAGAHVGKRAAVTVSHAEEILLHTDIPVVIQP* |
Ga0099791_102042031 | 3300007255 | Vadose Zone Soil | KRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0099795_102878592 | 3300007788 | Vadose Zone Soil | ECDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0066710_1032103011 | 3300009012 | Grasslands Soil | TPGEVVARVVKRIRCDALFAGAHVTRQEGRPSGVVVSHAEEILRYTDIPVVIQP |
Ga0066710_1045575122 | 3300009012 | Grasslands Soil | VIAATKCDALFAGAHVPRERTSVPTASHAEEILRNTDIPVVIQP |
Ga0099829_103965933 | 3300009038 | Vadose Zone Soil | FAGAHMSHADGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0099829_109053372 | 3300009038 | Vadose Zone Soil | TKCDALFAGAHVPRERSSAPSASHAEEILRTTDIPVVIQP* |
Ga0099829_109214632 | 3300009038 | Vadose Zone Soil | SPGEVVARVIARTTCDALFAGAHLERRSGRTSQPVVSHAEEILRHTDIPVVIQP* |
Ga0099827_107444901 | 3300009090 | Vadose Zone Soil | QCDALFAGAHVSGVGRRTAVTVSHAEEILLHTDIPVVIQP* |
Ga0105245_129868531 | 3300009098 | Miscanthus Rhizosphere | PADAVARVIRLTQCDALFAGAHIGKRLAVTVSHAEEILLHTDIPVVIQP* |
Ga0066709_1000285698 | 3300009137 | Grasslands Soil | FAGAHVGSGEGRRSDVRVSHAEEILLHTDIPVVIQP* |
Ga0066709_1016693973 | 3300009137 | Grasslands Soil | GAHMSHEEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0114129_107119111 | 3300009147 | Populus Rhizosphere | DALFAGAHVGQREVVTVSHAEEILLRTDIPVVIQP* |
Ga0105249_133152902 | 3300009553 | Switchgrass Rhizosphere | PGEAVARVVQRTGCDALFAGAHVGERAQVTASHAEEILLHTDIPVVIEP* |
Ga0134082_102009653 | 3300010303 | Grasslands Soil | FAGAHMSHVDGRPSAVIVSHAEEILRHTDIPVVIQP* |
Ga0134088_105872771 | 3300010304 | Grasslands Soil | VARVIQQTQCDALFAGAHVGKRNAVTVSHAEEILLHTDIPVVIQP* |
Ga0134084_102039341 | 3300010322 | Grasslands Soil | AVARVIARTQCDALFAGAHVGERQAVTVSHAEDILLHTDIPVVIQP* |
Ga0134086_102577711 | 3300010323 | Grasslands Soil | ALFAGAHMSHVEGRPSEVVVSHAEEILRHTDIPVVIQP* |
Ga0134064_102734621 | 3300010325 | Grasslands Soil | LFAGAHMSHVDGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0134080_106026511 | 3300010333 | Grasslands Soil | KRTRCDALFAGAHLSHQHGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0134063_106916671 | 3300010335 | Grasslands Soil | AGAHLSHEHGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0126378_118573171 | 3300010361 | Tropical Forest Soil | LGKPGEIVAAVVAKAGADCLFAGAHVPRSTDRPSQVISHAEEILRHTDLPVIVQP* |
Ga0134066_100737491 | 3300010364 | Grasslands Soil | QCDALFAGAHVGERQAVTVSHAEDILLHTDIPVVIQP* |
Ga0134122_101255911 | 3300010400 | Terrestrial Soil | ARVIERTKCDALFAGAHVASTGGRGKRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0134122_116905981 | 3300010400 | Terrestrial Soil | DALFAGAHVGKRNAVTVSHAEEILLHTDIPVVIQP* |
Ga0134123_136444581 | 3300010403 | Terrestrial Soil | THVEPGTPGAAVARVIERTKCDALFAGAHVASTGGRGKRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0137314_10664993 | 3300011420 | Soil | RVAFGSHMEAGAPGVVIARVVERIGCDALFAGAHLEQREGRASVASVSHVEEILLHTGIPVVVQP* |
Ga0137423_11151113 | 3300011430 | Soil | ALFAGAHLEQREGRASVASVSHVEEILLHTGIPVVVQP* |
Ga0137457_10145934 | 3300011443 | Soil | IGCDALFAGAHLEQREGRASVASVSHVEEILLHTGIPVVVQP* |
Ga0137388_120411961 | 3300012189 | Vadose Zone Soil | KCDALFAGAHVPRERVSVPTASHAEEILRNTDIPVVIQP* |
Ga0137364_100664635 | 3300012198 | Vadose Zone Soil | VARVIKRIRCDALFAGAHMSHVDGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0137364_103571101 | 3300012198 | Vadose Zone Soil | DALFAGAHMSHVEGRPSEVVVSHAEEILRHTDIPVVIQP* |
Ga0137383_100503435 | 3300012199 | Vadose Zone Soil | AAVVRRTRCDALFAGAHVPRGGERPSIVVSHAEEILRHTDIPVVIQP* |
Ga0137382_102949423 | 3300012200 | Vadose Zone Soil | EVVARVIKSTGCDALFAGAHVTRENGRPSGVVVSHAEEILRHTDIPVVIQP* |
Ga0137399_106416131 | 3300012203 | Vadose Zone Soil | KCDALFAGAHVGEGQAVTVSHAEEILLHTDIPVVIQP* |
Ga0137374_106780291 | 3300012204 | Vadose Zone Soil | FVTHVEPGTPGAAVARIIERTKCDALFAGAHVASTGGRGKRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0137380_114598401 | 3300012206 | Vadose Zone Soil | RVIQQTQCDALFAGAHVSGEGRRTAVTVSHAEEILLHTDIPVVIQP* |
Ga0137376_100612396 | 3300012208 | Vadose Zone Soil | VIKRIRCDALFAGAHMSHVEGRPSEVVVSHAEEILRHTGIPVVIQP* |
Ga0137378_114581961 | 3300012210 | Vadose Zone Soil | TPGEAVARVIQRTQCDALFAGAHVGSGGGRRSDVTVSHAEEILGRTDIPVVIQP* |
Ga0137370_107068621 | 3300012285 | Vadose Zone Soil | TPGAAVARVIERTQCDALFAGAHVGSGRRSDVKVSHAEEILLHTDIPVVIQP* |
Ga0137367_105524501 | 3300012353 | Vadose Zone Soil | ALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0137366_104879033 | 3300012354 | Vadose Zone Soil | RRTRCDALFAGAHVPRGGDRPSIVVSHAVEILRHTDIPVVIQP* |
Ga0137369_103341601 | 3300012355 | Vadose Zone Soil | QVIKRIRCDALFAGAHMSHVAGQGSAVVVSNAEEILRHTDIPVVIQP* |
Ga0137385_115358001 | 3300012359 | Vadose Zone Soil | ALFAGAHVTHQDGRPSGVVVSHAEEILRHTDIPVVVQP* |
Ga0137360_110506131 | 3300012361 | Vadose Zone Soil | EVVARVIKRTGCDALFAGAHVTREDGRPSGVVVSHAEEILRHTDIPVVIQP* |
Ga0137360_110784881 | 3300012361 | Vadose Zone Soil | ARVIERTQCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0137419_100765041 | 3300012925 | Vadose Zone Soil | KCDALFAGAHVGSGRRSDVTVSHAEEILLNTDIPVVIQP* |
Ga0137416_118284371 | 3300012927 | Vadose Zone Soil | TKCDALFAGAHVTRGRTSKVTVSHAEQILRHTDIPVVVQP* |
Ga0137404_117857202 | 3300012929 | Vadose Zone Soil | KCDALFAGAHVASTGGLGKRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0134077_101313981 | 3300012972 | Grasslands Soil | ALFAGAHLSHEHGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0134077_104494721 | 3300012972 | Grasslands Soil | VARAIQRTQCDALFAGAHVGKRNAVTVSHAEEILLHTDIPVVIQP* |
Ga0134076_103303702 | 3300012976 | Grasslands Soil | HLEPGTPGAAVARVIERTKCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPMVIQP* |
Ga0134081_100544623 | 3300014150 | Grasslands Soil | GKPGEVVARVIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQP* |
Ga0134075_100938943 | 3300014154 | Grasslands Soil | TRCDALFVGAHLSHQPGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0134079_102142603 | 3300014166 | Grasslands Soil | TQCDSLFAGAHMSHVDGRPSAIVVSHAEEILRHTDIPVVIQP* |
Ga0137412_100442938 | 3300015242 | Vadose Zone Soil | FVTHVEPGTPGAAVARVIERTKCDALFAGAHVASTGGLGKRRSDVTVSHAEEILLHTDIPVVIQP* |
Ga0134073_102275152 | 3300015356 | Grasslands Soil | ALFVGAHMSHEPGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0134089_104400951 | 3300015358 | Grasslands Soil | AGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP* |
Ga0134069_10181764 | 3300017654 | Grasslands Soil | VEPGKPGEVVARVIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQP |
Ga0134083_104595732 | 3300017659 | Grasslands Soil | VVADVVRRTRCDALFAGAHVPHGHERPSVVVSHAEEILRSTDIPVVIQL |
Ga0184610_12609601 | 3300017997 | Groundwater Sediment | LFAGAHVGSGRRSDVTVSHAEEILQHTDIPVVIQP |
Ga0184608_100103007 | 3300018028 | Groundwater Sediment | CDALFAGAHVGSGRHSDVKVSHAEDILLHTDIPVVIEP |
Ga0184634_104623841 | 3300018031 | Groundwater Sediment | EAVARVVERTKCDALFAGAHVGHGSEVTVSNSEEILRHTDIPVVIQP |
Ga0187773_103155161 | 3300018064 | Tropical Peatland | ARVIERVGCDALFAGAHLEPERRGKGGAAVRVSHAEEILLHAVIPVAIQP |
Ga0066655_102961871 | 3300018431 | Grasslands Soil | ALFAGAHMSHSEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0066667_108317782 | 3300018433 | Grasslands Soil | HVEPGKPGEVVARVIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQP |
Ga0066662_1000299110 | 3300018468 | Grasslands Soil | VARVIARTKCDALFAGAHLERRSGRPSQPVVSHAEEILRHTDIPVVIQP |
Ga0066662_100086977 | 3300018468 | Grasslands Soil | GFVPPVEAGKPGQVASRVPQRPRGASLFAGANLSHEEGRPSGVVVSHAEEILRPTDIPVVIQP |
Ga0179596_100702851 | 3300021086 | Vadose Zone Soil | LFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0222623_100070351 | 3300022694 | Groundwater Sediment | VVAGTKCDALFAGAHVTRGRTSKVTVSHAEQILRLTDIPVVIQP |
Ga0247680_10142943 | 3300024246 | Soil | VANVVKRTRCDALFAGAHMSHREGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0137417_14843363 | 3300024330 | Vadose Zone Soil | VARVIKRIRCDALFAGAHMSHVEGRPAPWSYRTRGILRHTDIPVVIQP |
Ga0209108_104622651 | 3300025165 | Soil | GKPGEVVARVIKRTRCDALFAGAHVPRAGRPSVVVSHAEEILRHTDLPVVIQP |
Ga0209343_108068371 | 3300025311 | Groundwater | ARTNCDALFAGAHVTRGRTSKVTVSHAEEILRHTDIPVVVQP |
Ga0209641_101098284 | 3300025322 | Soil | VVARVIKRIRCDALFAGAHMTQRPGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0207653_100462854 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | IRCDALFAGAHMSHAEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0207685_105046991 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | THIEPGTPGEAVARVIQQTQCDALFAGAHVGQRNDVTVSHAEDILLHTDIPVVIEP |
Ga0207708_100112431 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RLTQCDALFAVAHIGKRLAVTVSHAEEILLHTDIPVVIQP |
Ga0209350_11385801 | 3300026277 | Grasslands Soil | GEVVAAVVRRTRCDALFAGAHVPRGGERPSIVVSHAEEILRHTDIPVVIQP |
Ga0209234_10683173 | 3300026295 | Grasslands Soil | EPGKPGAVVAQVIKRIRCDALFAGAHMEIREGRPSGVVVSHAEEILRHTDIPVVIQP |
Ga0209234_11236893 | 3300026295 | Grasslands Soil | HCDALFAGAHMEIREGRPSGVVVSHAEEILRHTDIPVVIQP |
Ga0209235_11079863 | 3300026296 | Grasslands Soil | VVAQVIKRIRCDALFAGAHMEIREGRPSGVVVSHAEEILRHTDIPVVIQP |
Ga0209235_11223813 | 3300026296 | Grasslands Soil | RCDALFAGAHMSHSEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209236_10264336 | 3300026298 | Grasslands Soil | ERTKCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIEP |
Ga0209469_10513481 | 3300026307 | Soil | RTQCDALFAGAHVGSGRHSDVKVSHAEEILLHTDIPVVIQP |
Ga0209265_10379054 | 3300026308 | Soil | GTPGEVVARVIQRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209055_12000972 | 3300026309 | Soil | ALFVGAHLERQTGRPSQPVVSHAEQILRQTDLPVVIQP |
Ga0209055_12077722 | 3300026309 | Soil | RTKCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIQP |
Ga0209239_11061443 | 3300026310 | Grasslands Soil | RVIKRIRCDALFAGAHMSHVDGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209761_11866143 | 3300026313 | Grasslands Soil | LFVGAHLSHQPGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209154_11119913 | 3300026317 | Soil | PGEVVARVIKRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209470_10132381 | 3300026324 | Soil | EPGTPGAAVARVIERTKCDALFAGAHVGSGEGRRSDVRVSHAEEILLHTDIPVVIQP |
Ga0209152_101084671 | 3300026325 | Soil | THVEPGRPGEVVARVIKQTRCDSLFAGAHMTHVDGRPSAVVVSHAEEILLHTDIPVVIQP |
Ga0209802_11301381 | 3300026328 | Soil | ARVIKRTRCDALFAGAHLSHQHGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209802_11668763 | 3300026328 | Soil | VGAHVGSGGGGAGRRSDVTVSHAEEILGHTDIPVVIQP |
Ga0209375_12496931 | 3300026329 | Soil | ALFAGAHMSHVEGRPSEVVVSHAEEILRHTDIPVVIQP |
Ga0209803_13584691 | 3300026332 | Soil | GEVVARVITRTKCDALFAGAHLERRSGRPSQPVVSHAEEILRHTDIPVVIQP |
Ga0209377_13466132 | 3300026334 | Soil | SPGEVVARVIARTKCDALFAGAHLERRSGRPSQPVVSHAEEILRHTDIPVVIQP |
Ga0209804_11816201 | 3300026335 | Soil | RCDALFVGAHLERQTGRPSQPVVSHAEQILRQTDLPVVIQP |
Ga0257177_10303702 | 3300026480 | Soil | VIARVIKRIRCDALFAGAHMEIRKGRPSGVVVSHAEEILRHTDIPVVIQP |
Ga0209806_12216022 | 3300026529 | Soil | GAAVARVIERTQCDALFAGAHVGSGRRSDVTVSHAEEILLHTDIPVVIEP |
Ga0209157_11059814 | 3300026537 | Soil | AGAHMEIREGRPSGVVVSHAEEILRHTDIPVVIQP |
Ga0209376_11045451 | 3300026540 | Soil | LFAGAHLSHQHGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209161_102494241 | 3300026548 | Soil | VTHVEPGKPGEVVARVIKQTRCDSLFAGAHMSQVAGRPSAVVISHAEEILQHTDLPVVIQ |
Ga0209648_102136661 | 3300026551 | Grasslands Soil | VVARVIKRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0179587_111826952 | 3300026557 | Vadose Zone Soil | LFAGAHMSHVEGRPSEVVVSHAEEILRHTDIPVVIQP |
Ga0209886_10622672 | 3300027273 | Groundwater Sand | VIKRIRCDALFAGAHMSQVAGRPSAIVVSHAEEILRHTDIPVVIQP |
Ga0209886_10825612 | 3300027273 | Groundwater Sand | KRIRCDSLFAGAHMSHVEGQGSAVVVSNAEEILRHTDIPVVIQP |
Ga0208454_10051791 | 3300027573 | Soil | VTFVTHLEHGTPGEAMARVIQRTKCDALFAGAHVGKWSAVTVSHAEEILLRTDIPVVIAP |
Ga0209076_10246911 | 3300027643 | Vadose Zone Soil | TPGEVVARVIKRTRCDALFAGAHLSHQHGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209074_104139042 | 3300027787 | Agricultural Soil | FAGAHMSHRDGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209580_104252851 | 3300027842 | Surface Soil | TVVRRAGADCLFAGAHVPRASERPSVVVSHAEDILRHTDLPVIVQP |
Ga0209180_101309694 | 3300027846 | Vadose Zone Soil | FAGAHMSHADGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0209180_104431401 | 3300027846 | Vadose Zone Soil | TKCDALFAGAHVPRERSSAPSASHAEEILRTTDIPVVIQP |
Ga0209590_102206773 | 3300027882 | Vadose Zone Soil | QTQCDALFAGAHVSGVGRRTAVTVSHAEEILLHTDIPVVIQP |
Ga0209590_103249821 | 3300027882 | Vadose Zone Soil | GTPGEVVARVIKRIRCDALFAGAHMSHVEGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0307320_102085133 | 3300028771 | Soil | GAHVASTGGRGKRRSDVTVSHAEEILLHTDIPVVIQP |
Ga0307292_103501501 | 3300028811 | Soil | PGAAVARVIERTQCDALFAGAHVGSGGRRSSDVTVSHAEEILLHTDIPVVIEP |
Ga0307302_101392721 | 3300028814 | Soil | VEVIARVIKRVGCDALFAGAHMEPREGRASVATVSHAEQILMRTDIPVVVQP |
Ga0307302_103342181 | 3300028814 | Soil | AGTKCDALFAGAHVTRGRTSKVTVSHAEQILRLTDIPVVIQP |
Ga0307312_103305143 | 3300028828 | Soil | FAGAHMSHVEGRPSAVIVSHAEEILRHTDIPVVIQP |
Ga0307501_101004701 | 3300031152 | Soil | TPGEAVARVIQRTQCDALFAGAHVSQRNAVTVSHAEEILLHTDIPVVIEP |
Ga0307497_102424591 | 3300031226 | Soil | GVAFVTHLEPGTPGEAMARVIQLTQCDSLFAGAHVGKRAAVTVSHAEEILLHTDIPVVIQ |
Ga0307469_106477981 | 3300031720 | Hardwood Forest Soil | VVQRAGADCLFAGAHVPRASERPSVVVSHAEDILRHTDLPVIIQP |
Ga0307475_114962252 | 3300031754 | Hardwood Forest Soil | KRTRCDALFAGAHMSHREGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0214473_123351022 | 3300031949 | Soil | TACDALFVGAHVPRGRDSGATAGNAAEILRHTDIPVVVQP |
Ga0307470_106194731 | 3300032174 | Hardwood Forest Soil | RTHCDSLFAGAHMTHVDGRPSAVVVSHAEEILRHTDIPVVIQP |
Ga0307471_1011526561 | 3300032180 | Hardwood Forest Soil | DALFAGAHVTRGRTSKVTVSHAEEILRHTDIPVVVQP |
Ga0335083_106603583 | 3300032954 | Soil | ERVGCDALFAGAHLEPERRGRGAVQVSHAEEILLHAVIPVVIQP |
Ga0310810_105411873 | 3300033412 | Soil | QCDALFAGAHVGSGRRSAVTVSHAEEILLHTDIPVVIQP |
Ga0364940_0132762_2_151 | 3300034164 | Sediment | GEAVARVVERTKCDALFAGAHVAPGGSLVTVSQAEEILRHTDIPVVIQP |
Ga0364942_0202372_472_615 | 3300034165 | Sediment | VARVVARTNCDALFAGAHVTRGRTSKVTVSHAEEILRHTDIPVVVQP |
⦗Top⦘ |