NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033808

Metagenome / Metatranscriptome Family F033808

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033808
Family Type Metagenome / Metatranscriptome
Number of Sequences 176
Average Sequence Length 36 residues
Representative Sequence MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR
Number of Associated Samples 98
Number of Associated Scaffolds 176

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 90.91 %
% of genes near scaffold ends (potentially truncated) 10.23 %
% of genes from short scaffolds (< 2000 bps) 63.07 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (79.545 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(15.341 % of family members)
Environment Ontology (ENVO) Unclassified
(57.386 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(67.614 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.77%    β-sheet: 0.00%    Coil/Unstructured: 49.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 176 Family Scaffolds
PF07235DUF1427 34.09
PF00154RecA 13.07
PF01923Cob_adeno_trans 9.66
PF12705PDDEXK_1 6.82
PF02075RuvC 2.27
PF00011HSP20 1.70
PF03819MazG 1.70
PF14579HHH_6 1.14
PF13662Toprim_4 0.57
PF10145PhageMin_Tail 0.57
PF05050Methyltransf_21 0.57
PF04488Gly_transf_sug 0.57
PF00436SSB 0.57
PF01135PCMT 0.57
PF03796DnaB_C 0.57
PF08241Methyltransf_11 0.57
PF05257CHAP 0.57
PF01930Cas_Cas4 0.57
PF00565SNase 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 176 Family Scaffolds
COG4317Xanthosine utilization system component, XapX domainNucleotide transport and metabolism [F] 34.09
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 13.07
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 2.27
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 1.70
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.57
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.57
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.57
COG1468CRISPR/Cas system-associated exonuclease Cas4, RecB familyDefense mechanisms [V] 0.57
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.57
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.57
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.57
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.57
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 0.57
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.93 %
UnclassifiedrootN/A13.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1005283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes3513Open in IMG/M
3300000756|JGI12421J11937_10083170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300001282|B570J14230_10191652Not Available567Open in IMG/M
3300002161|JGI24766J26685_10000008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes46845Open in IMG/M
3300005517|Ga0070374_10149819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1210Open in IMG/M
3300005527|Ga0068876_10029064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3449Open in IMG/M
3300005527|Ga0068876_10037691All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2989Open in IMG/M
3300005527|Ga0068876_10071026All Organisms → cellular organisms → Bacteria2098Open in IMG/M
3300005527|Ga0068876_10077107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2003Open in IMG/M
3300005527|Ga0068876_10119868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1560Open in IMG/M
3300005527|Ga0068876_10129112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1494Open in IMG/M
3300005527|Ga0068876_10202222Not Available1152Open in IMG/M
3300005527|Ga0068876_10764665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300005528|Ga0068872_10182417All Organisms → Viruses → Predicted Viral1206Open in IMG/M
3300005528|Ga0068872_10411657All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300005580|Ga0049083_10170085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300005581|Ga0049081_10185056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage752Open in IMG/M
3300005584|Ga0049082_10000347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes12779Open in IMG/M
3300005662|Ga0078894_10018668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5573Open in IMG/M
3300005662|Ga0078894_10188656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1864Open in IMG/M
3300005662|Ga0078894_10210821All Organisms → Viruses → Predicted Viral1759Open in IMG/M
3300005662|Ga0078894_10747944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes859Open in IMG/M
3300005662|Ga0078894_10986663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage726Open in IMG/M
3300005662|Ga0078894_11004881Not Available717Open in IMG/M
3300005662|Ga0078894_11213760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300005805|Ga0079957_1034807All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3279Open in IMG/M
3300006005|Ga0073910_1016373Not Available520Open in IMG/M
3300006484|Ga0070744_10000976Not Available8474Open in IMG/M
3300006484|Ga0070744_10012372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2531Open in IMG/M
3300006639|Ga0079301_1120602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage791Open in IMG/M
3300007545|Ga0102873_1154274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage692Open in IMG/M
3300007559|Ga0102828_1051961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage954Open in IMG/M
3300007559|Ga0102828_1179205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300007590|Ga0102917_1136089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300007593|Ga0102918_1128571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes760Open in IMG/M
3300007597|Ga0102919_1043856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1393Open in IMG/M
3300008052|Ga0102893_1170200All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes634Open in IMG/M
3300008055|Ga0108970_10898716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3068Open in IMG/M
3300008107|Ga0114340_1002746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10130Open in IMG/M
3300008107|Ga0114340_1005474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7364Open in IMG/M
3300008107|Ga0114340_1033081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2356Open in IMG/M
3300008107|Ga0114340_1063095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1584Open in IMG/M
3300008107|Ga0114340_1100374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1159Open in IMG/M
3300008107|Ga0114340_1105957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1723Open in IMG/M
3300008107|Ga0114340_1139256Not Available911Open in IMG/M
3300008107|Ga0114340_1178113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1266Open in IMG/M
3300008108|Ga0114341_10128097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1504Open in IMG/M
3300008110|Ga0114343_1063038All Organisms → Viruses → Predicted Viral1387Open in IMG/M
3300008114|Ga0114347_1042551All Organisms → Viruses → Predicted Viral1979Open in IMG/M
3300008116|Ga0114350_1079027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1098Open in IMG/M
3300008116|Ga0114350_1154772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes633Open in IMG/M
3300008120|Ga0114355_1137780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage888Open in IMG/M
3300008120|Ga0114355_1190604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300008259|Ga0114841_1047019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2119Open in IMG/M
3300008262|Ga0114337_1125607All Organisms → Viruses → Predicted Viral1152Open in IMG/M
3300008953|Ga0104241_1000714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2662Open in IMG/M
3300008962|Ga0104242_1008525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1821Open in IMG/M
3300008962|Ga0104242_1054123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300008996|Ga0102831_1004704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5193Open in IMG/M
3300009159|Ga0114978_10129326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1642Open in IMG/M
3300009159|Ga0114978_10168760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1399Open in IMG/M
3300009159|Ga0114978_10635619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300009183|Ga0114974_10003457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes11890Open in IMG/M
3300009183|Ga0114974_10006440Not Available8676Open in IMG/M
3300009183|Ga0114974_10541565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300009183|Ga0114974_10787302Not Available511Open in IMG/M
3300010354|Ga0129333_10688613All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage880Open in IMG/M
3300011116|Ga0151516_10663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15963Open in IMG/M
3300012012|Ga0153799_1000162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes23531Open in IMG/M
3300012017|Ga0153801_1031444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage938Open in IMG/M
3300012666|Ga0157498_1022136All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage989Open in IMG/M
3300012779|Ga0138284_1349353Not Available561Open in IMG/M
3300013004|Ga0164293_10656056All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300013087|Ga0163212_1085585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1022Open in IMG/M
(restricted) 3300013126|Ga0172367_10446127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
(restricted) 3300013131|Ga0172373_10059717All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3179Open in IMG/M
(restricted) 3300013131|Ga0172373_10367150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300013295|Ga0170791_11427432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1306Open in IMG/M
3300013372|Ga0177922_10251216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300013372|Ga0177922_10574871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1022Open in IMG/M
3300013372|Ga0177922_11108788Not Available845Open in IMG/M
(restricted) 3300014720|Ga0172376_10123326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1786Open in IMG/M
3300017723|Ga0181362_1059539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300017788|Ga0169931_10026531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7068Open in IMG/M
3300017788|Ga0169931_10176361All Organisms → Viruses → Predicted Viral1867Open in IMG/M
3300019146|Ga0188881_10037715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300019146|Ga0188881_10044992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300019784|Ga0181359_1041412All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1784Open in IMG/M
3300019784|Ga0181359_1204924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300020048|Ga0207193_1035772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5580Open in IMG/M
3300020048|Ga0207193_1057221All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay3982Open in IMG/M
3300020074|Ga0194113_10027824Not Available5995Open in IMG/M
3300020074|Ga0194113_10049588Not Available4089Open in IMG/M
3300020074|Ga0194113_10089840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2737Open in IMG/M
3300020074|Ga0194113_10099005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2563Open in IMG/M
3300020074|Ga0194113_11101340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300020084|Ga0194110_10301059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1133Open in IMG/M
3300020141|Ga0211732_1013266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300020141|Ga0211732_1231842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
3300020141|Ga0211732_1284207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4543Open in IMG/M
3300020151|Ga0211736_10136019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300020151|Ga0211736_10136504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2116Open in IMG/M
3300020151|Ga0211736_10586991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300020151|Ga0211736_10966384All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6088Open in IMG/M
3300020159|Ga0211734_10139596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300020159|Ga0211734_10322587Not Available612Open in IMG/M
3300020161|Ga0211726_10096231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2290Open in IMG/M
3300020161|Ga0211726_10385521Not Available17182Open in IMG/M
3300020179|Ga0194134_10017405All Organisms → Viruses → Predicted Viral4957Open in IMG/M
3300020190|Ga0194118_10178704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1224Open in IMG/M
3300020196|Ga0194124_10206066All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1009Open in IMG/M
3300020198|Ga0194120_10454039Not Available589Open in IMG/M
3300020222|Ga0194125_10140618All Organisms → Viruses → Predicted Viral1865Open in IMG/M
3300020519|Ga0208223_1000366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay11363Open in IMG/M
3300020519|Ga0208223_1015125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1145Open in IMG/M
3300020533|Ga0208364_1001165Not Available5399Open in IMG/M
3300020572|Ga0207909_1008242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2158Open in IMG/M
3300021376|Ga0194130_10066038All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2491Open in IMG/M
3300021961|Ga0222714_10009917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay8303Open in IMG/M
3300021961|Ga0222714_10033771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3761Open in IMG/M
3300021961|Ga0222714_10276320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300021962|Ga0222713_10009045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9113Open in IMG/M
3300021962|Ga0222713_10012879All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7390Open in IMG/M
3300021962|Ga0222713_10081486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2364Open in IMG/M
3300021962|Ga0222713_10093353All Organisms → Viruses → Predicted Viral2172Open in IMG/M
3300021962|Ga0222713_10137851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1700Open in IMG/M
3300021962|Ga0222713_10297793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1029Open in IMG/M
3300021963|Ga0222712_10198404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1316Open in IMG/M
3300021963|Ga0222712_10213000All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1257Open in IMG/M
3300021963|Ga0222712_10216106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1245Open in IMG/M
3300021963|Ga0222712_10226890All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1207Open in IMG/M
3300021963|Ga0222712_10654096Not Available599Open in IMG/M
3300021963|Ga0222712_10692323Not Available575Open in IMG/M
3300022752|Ga0214917_10076837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay2064Open in IMG/M
3300023174|Ga0214921_10013094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes9793Open in IMG/M
3300023174|Ga0214921_10020790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7008Open in IMG/M
3300023174|Ga0214921_10084107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay2494Open in IMG/M
3300023174|Ga0214921_10578311Not Available509Open in IMG/M
3300024289|Ga0255147_1002477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4472Open in IMG/M
3300024346|Ga0244775_10069684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay3017Open in IMG/M
3300024346|Ga0244775_10206395All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1647Open in IMG/M
3300024346|Ga0244775_10247159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay1487Open in IMG/M
3300027142|Ga0255065_1087715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage522Open in IMG/M
3300027499|Ga0208788_1124023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage589Open in IMG/M
3300027586|Ga0208966_1000016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes64675Open in IMG/M
3300027659|Ga0208975_1005815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay4512Open in IMG/M
3300027720|Ga0209617_10175530All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300027759|Ga0209296_1000586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes31699Open in IMG/M
3300027759|Ga0209296_1004956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay8610Open in IMG/M
3300027759|Ga0209296_1293906All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage648Open in IMG/M
3300027769|Ga0209770_10081824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1344Open in IMG/M
3300027793|Ga0209972_10020553All Organisms → Viruses4053Open in IMG/M
3300027793|Ga0209972_10086629All Organisms → Viruses → Predicted Viral1601Open in IMG/M
3300027793|Ga0209972_10105868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1405Open in IMG/M
3300027805|Ga0209229_10000004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes91329Open in IMG/M
(restricted) 3300027970|Ga0247837_1285726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300028025|Ga0247723_1001664All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes12647Open in IMG/M
3300028025|Ga0247723_1031753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay1654Open in IMG/M
3300028025|Ga0247723_1033092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1607Open in IMG/M
3300028025|Ga0247723_1097059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage749Open in IMG/M
3300031758|Ga0315907_10146773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay2000Open in IMG/M
3300031758|Ga0315907_10520492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300031758|Ga0315907_10998622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes604Open in IMG/M
3300031784|Ga0315899_11180394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay665Open in IMG/M
3300031857|Ga0315909_10312435Not Available1168Open in IMG/M
3300031857|Ga0315909_10492209Not Available849Open in IMG/M
3300031951|Ga0315904_10040392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5316Open in IMG/M
3300031951|Ga0315904_10693206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes858Open in IMG/M
3300032050|Ga0315906_11151251Not Available567Open in IMG/M
3300033816|Ga0334980_0370730All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300034063|Ga0335000_0048435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3054Open in IMG/M
3300034073|Ga0310130_0001350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13580Open in IMG/M
3300034093|Ga0335012_0083624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay1800Open in IMG/M
3300034101|Ga0335027_0040908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay3809Open in IMG/M
3300034116|Ga0335068_0006809Not Available7433Open in IMG/M
3300034272|Ga0335049_0562459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage714Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake15.34%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.36%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton9.66%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water8.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.11%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.84%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.84%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.84%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment2.27%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.14%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.14%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.14%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.14%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.14%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.57%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.57%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.57%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.57%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.57%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.57%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.57%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006005Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006639Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300008052Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02EnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008953Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4EnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300011116Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015NovEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012779Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020196Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0mEnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300020222Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250mEnvironmentalOpen in IMG/M
3300020519Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300020533Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027970 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5mEnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300034063Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_100528383300000736Freshwater And SedimentMELFLICGIAIGFLVGYPLGLFINKLDKDIKNDAR*
JGI12421J11937_1008317023300000756Freshwater And SedimentMEMFLLCGIAIGFLIGYPMGLFIDKLDKRIKNGGR*
B570J14230_1019165213300001282FreshwaterVCIMELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
JGI24766J26685_10000008203300002161Freshwater And SedimentMEIFLLGMMIGFAVGYPMGLFVDKLDKKEKAKNGGR*
Ga0070374_1014981953300005517Freshwater LakeMELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG*
Ga0068876_1002906433300005527Freshwater LakeMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKHGGR*
Ga0068876_1003769173300005527Freshwater LakeMEMFLIAGIAIGFLIGYPFGLFIDKLDKKEKAKNVN*
Ga0068876_1007102663300005527Freshwater LakeMEVFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR*
Ga0068876_1007710723300005527Freshwater LakeMEMFLIAGIAIGFLIGYPLGLFVDKLDKREKAKNGGR*
Ga0068876_1011986823300005527Freshwater LakeMEIFLLGIMIGFAVGYPMGLFIDKLDKREKAKNGGR*
Ga0068876_1012911243300005527Freshwater LakeMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKSGGR*
Ga0068876_1020222223300005527Freshwater LakeMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0068876_1076466533300005527Freshwater LakeMEMFLLCGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0068872_1018241743300005528Freshwater LakeMEMFLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR*
Ga0068872_1041165723300005528Freshwater LakeMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0049083_1017008533300005580Freshwater LenticMEMFFFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR*
Ga0049081_1018505633300005581Freshwater LenticMEMFLIAGISIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0049082_10000347163300005584Freshwater LenticMEIFLFSGIAIGFLIGYPIGLFIDNLNKKENKKNGR*
Ga0078894_1001866873300005662Freshwater LakeMNMFLLGLGIGFVIGYAMGLFIDKLDKREKAKNGGR*
Ga0078894_1018865663300005662Freshwater LakeMEMFIMGIMIGFIVGYPTGLFIDKLDKREKAKSGGR*
Ga0078894_1021082123300005662Freshwater LakeMEMFLLGMMIGFIIGYPVGLFIDKLDKRERAKNGR*
Ga0078894_1074794433300005662Freshwater LakeELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0078894_1098666323300005662Freshwater LakeVIEVLLIGIMIGFIAGYPMGLFIDRLDKKEKAKNGGR*
Ga0078894_1100488113300005662Freshwater LakeMEMFLLCGIAIGFLIGYPLGLFIDKLDKREKAKNVN*
Ga0078894_1121376023300005662Freshwater LakeVEIFLISGIAIGFLIGYPLGLFIDKLDKKEKDKNGGR*
Ga0079957_103480763300005805LakeMTTLTIFILGSMVGFVVGYGFGLFIDKLDKKEKEKNGGR*
Ga0073910_101637313300006005SandMEIFLFSGIAIGFLIGYPIGLFIDSLNKKENKKNGR*
Ga0070744_1000097623300006484EstuarineMEMFLLGMMLGFIIGYPVGLFIDKLDKRERAKNGR*
Ga0070744_1001237233300006484EstuarineMEMFFLCGIAVGFLIGYPMGLFIDKLDNRIKNGGR*
Ga0079301_112060213300006639Deep SubsurfaceMEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGGR*
Ga0102873_115427423300007545EstuarineMEMFLICGIAIGFLIGYPLGLFIDKWDKRIKNDRG*
Ga0102828_105196133300007559EstuarineMEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG*
Ga0102828_117920533300007559EstuarineMEMFLLGMMLGFIIGYPVGLVRDKLDKRERAKNGR*
Ga0102917_113608943300007590EstuarineMTTFLFGLLIGFAFGYPMGLFIDYLDKKEKRKQRVD
Ga0102918_112857133300007593EstuarineRKVCIMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0102919_104385653300007597EstuarineMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0102893_117020033300008052EstuarineCIMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0108970_1089871653300008055EstuaryMDILLLGIMIGFAIGYPMGLFIDKLDKREKAKHGG*
Ga0114340_100274663300008107Freshwater, PlanktonMEMFLIAGIAIGFLIGYPFGLFIDKLDKKEKAKNGGR*
Ga0114340_1005474133300008107Freshwater, PlanktonMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKHGGR*
Ga0114340_103308123300008107Freshwater, PlanktonMEMFLIAGIAIGFLFGYPLGLFIDKLDKKEKAKNVN*
Ga0114340_106309563300008107Freshwater, PlanktonMEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR*
Ga0114340_110037443300008107Freshwater, PlanktonMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVN*
Ga0114340_110595753300008107Freshwater, PlanktonMEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGR*
Ga0114340_113925633300008107Freshwater, PlanktonMEMFLIAGTAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0114340_117811353300008107Freshwater, PlanktonMEVFILGIMLGFVVGYPTGLFIDKLDKREKAKSGGR*
Ga0114341_1012809763300008108Freshwater, PlanktonMDLFILGILIGFALGYPLGLFIDKLDKKEKAKNGGR*
Ga0114343_106303813300008110Freshwater, PlanktonMEIFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR*
Ga0114347_104255133300008114Freshwater, PlanktonMEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKHGGR*
Ga0114350_107902743300008116Freshwater, PlanktonMDIMSLFLIGAGIGFIVGYATGLFIDKLDKREKAKNAERA*
Ga0114350_115477223300008116Freshwater, PlanktonMEMFFVCGIAVGFFIGYPFGLFINNLDKKEKAKNGGR*
Ga0114355_113778013300008120Freshwater, PlanktonMDIMSLFLIGAGIGFIVGYATGLFIDKLDKREKAKNA
Ga0114355_119060433300008120Freshwater, PlanktonMDIFILGIMIGFVIGYPMGLFIDKLDKREKAKNGGR*
Ga0114841_104701953300008259Freshwater, PlanktonMEMFLIAGITIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0114337_112560713300008262Freshwater, PlanktonSWKAFIMEIFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0104241_100071423300008953FreshwaterMDLFILGILIGFALGYPLGLFIDKLDKREKAKNGGR*
Ga0104242_100852533300008962FreshwaterMEAIFLMEMFLICGIAIGFLIGYPLGLFIDQIDKRIKNDRG*
Ga0104242_105412323300008962FreshwaterMEMFLLCGIAIGFLVGYPLGLFIDKLDKDIKNDRR*
Ga0102831_100470493300008996EstuarineMEMFLICGMAIGFLVGYPLGLFINKLDKDIKNDAR*
Ga0114978_1012932653300009159Freshwater LakeMELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0114978_1016876033300009159Freshwater LakeMEMFLLCGMAIGFLVGYPLGLFIDKLDKDIKNDRR*
Ga0114978_1063561933300009159Freshwater LakeMEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG*
Ga0114974_1000345773300009183Freshwater LakeMEMFFICGIAVGFLIGYPMGLFIDKLDKRIKNGGR*
Ga0114974_10006440123300009183Freshwater LakeMEIFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR*
Ga0114974_1054156513300009183Freshwater LakeMEMFFVCGIAVGFLIGYPFGLFINNLDKKEKAKNGGR*
Ga0114974_1078730223300009183Freshwater LakeMEMFLLCGIAIGFLIGYPMGLFINKLDKRIKNGGR*
Ga0129333_1068861323300010354Freshwater To Marine Saline GradientMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKVKNGGR*
Ga0151516_10663213300011116FreshwaterMEMFFLCGIALGFLIGYPLGLFIDKLDKRTKNGGR*
Ga0153799_1000162273300012012FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVGR*
Ga0153801_103144453300012017FreshwaterMEMFLIAGTAIGFLIGYPLGLFIDKLDKREKAKNVGR*
Ga0157498_102213643300012666Freshwater, Surface IceMEIFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR*
Ga0138284_134935333300012779Freshwater LakeMSMFFICGVAVGFLIGYPMGLFIDKLDKRIKNGGR*
Ga0164293_1065605633300013004FreshwaterMNMFLLGLGIGFVIGYAMGLFIDKLDKRERAKNDTR*
Ga0163212_108558523300013087FreshwaterMTTMAIFLMGIGIGFVIGYPVGLFIDKLDKREKKKNDGR*
(restricted) Ga0172367_1044612723300013126FreshwaterMEMFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNDKR*
(restricted) Ga0172373_1005971753300013131FreshwaterMEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGRR*
(restricted) Ga0172373_1036715023300013131FreshwaterMEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0170791_1142743223300013295FreshwaterMEMFLLCGIAVGFLIGYPMGLFIDKLDKRIKNGGR*
Ga0177922_1025121633300013372FreshwaterMEMFFLCGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
Ga0177922_1057487123300013372FreshwaterMEMFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR*
Ga0177922_1110878833300013372FreshwaterSEVYIMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR*
(restricted) Ga0172376_1012332663300014720FreshwaterMDIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR*
Ga0181362_105953943300017723Freshwater LakeMEMFFLCGIAVGFLIRYPMGLFIDKLDKRIKNGGR
Ga0169931_1002653193300017788FreshwaterMEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0169931_1017636153300017788FreshwaterMEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGRR
Ga0188881_1003771543300019146Freshwater LakeMEMFLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR
Ga0188881_1004499223300019146Freshwater LakeMEIFLISGIAIGFLIGYPLGLFIDKLDKREKAKNVN
Ga0181359_104141233300019784Freshwater LakeMEMFFFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR
Ga0181359_120492413300019784Freshwater LakeMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG
Ga0207193_103577293300020048Freshwater Lake SedimentMEMFLLGMMLGFIIGYPVGLFIDKLDKRERAKNGR
Ga0207193_105722153300020048Freshwater Lake SedimentMEIFLLGMMLGFVVGYPIGLFIDKLDKRERAKNGRR
Ga0194113_1002782483300020074Freshwater LakeMETMFIFLTGICIGFVIGYPFGLFIDKLDKREKRKNGGR
Ga0194113_1004958863300020074Freshwater LakeMEATFIFLTGIGIGFVIGYPVGLFIDKLDKKIKSRT
Ga0194113_1008984053300020074Freshwater LakeMETMFIFLAGIGVGFVIGYPVGLFIDKLDKREKRKNGG
Ga0194113_1009900533300020074Freshwater LakeMETMFIFLTGIGIGFVIGYPVGLFIDKLDKREKKKNDGR
Ga0194113_1110134013300020074Freshwater LakeMETMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGG
Ga0194110_1030105953300020084Freshwater LakeMETMFIFLAGIGIGFVIGYPVGLFIDKLDKREKRKNGGR
Ga0211732_101326623300020141FreshwaterMEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG
Ga0211732_123184263300020141FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0211732_128420753300020141FreshwaterMEMFLLSGIAIGFLVGYPLGLFIDKLDKRIKNDRG
Ga0211736_1013601933300020151FreshwaterMEMFFLCGIAIGFLIGYPLGLFIDKLDKKEKAKNVN
Ga0211736_1013650463300020151FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNVK
Ga0211736_1058699143300020151FreshwaterMEMFLIAGISIGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0211736_1096638483300020151FreshwaterMEMFLFSGIAIGFLIGYPFGLFIDKLDKKEKAKNGGR
Ga0211734_1013959613300020159FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNVN
Ga0211734_1032258723300020159FreshwaterMEVILLMEMFFLCGIAIGFLIGYPLGLFIDQIDKRIKNNGR
Ga0211726_1009623123300020161FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0211726_1038552193300020161FreshwaterMEMFFLCGIAIGFLIGYPLGLFIDQIDKRIKNNGR
Ga0194134_1001740583300020179Freshwater LakeMETMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGGR
Ga0194118_1017870453300020190Freshwater LakeMFIFLAGIGIGFVIGYPVGLFIDKLDKREKRKNGGR
Ga0194124_1020606653300020196Freshwater LakeMETMLIFLTGICIGFVIGYPFGLFIDKLDKREKRKNF
Ga0194120_1045403933300020198Freshwater LakeMFIFLTGIGIGFVIGYPVGLFIDKLDKREKRKNGGR
Ga0194125_1014061863300020222Freshwater LakeMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGGR
Ga0208223_100036653300020519FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKVKHGGR
Ga0208223_101512563300020519FreshwaterVEIFLISGIAIGFLIGYPLGLFINKLDKKEKDKNGGR
Ga0208364_100116523300020533FreshwaterMEMFLIAGIAIGFVIGYPLGLFIDKLDKKEKAKHGGR
Ga0207909_100824243300020572FreshwaterVELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR
Ga0194130_1006603853300021376Freshwater LakeTMLIFLTGICIGFVIGYPFGLFIDKLDKREKRKNGGR
Ga0222714_1000991733300021961Estuarine WaterMDLFILGILIGFALGYPLGLFIDKLDKKEKAKNGGR
Ga0222714_1003377173300021961Estuarine WaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKSGGR
Ga0222714_1027632033300021961Estuarine WaterMEMFLVSGIAIGFLIGYPLGLFVDKLDKRIKDDRR
Ga0222713_10009045173300021962Estuarine WaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKDGGR
Ga0222713_1001287973300021962Estuarine WaterMDIFILGILVGFAFGYPMGLFIDKLDKREKAKNGGR
Ga0222713_1008148633300021962Estuarine WaterMEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR
Ga0222713_1009335343300021962Estuarine WaterMEVFILGIMLGFVVGYPTGLFIDKLDKREKAKSGGR
Ga0222713_1013785133300021962Estuarine WaterMEVFLLGMMIGFAVGYPMGLFIDKLDKREKVKSGGR
Ga0222713_1029779333300021962Estuarine WaterMEMFLICGIAIGFLIGYPLGLFIDKWDKRIKNDRG
Ga0222712_1019840413300021963Estuarine WaterMDLFILGILIGFACGYPIGLFIDKLDKKEKAKNGGR
Ga0222712_1021300063300021963Estuarine WaterMTTLTIFILGSMVGFVVGYGFGLFIDKLDKKEKEKNGGR
Ga0222712_1021610633300021963Estuarine WaterYCSKVYLMEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR
Ga0222712_1022689033300021963Estuarine WaterMEMFLICGMAIGFLVGYPLGLFINKLDKDIKNDAR
Ga0222712_1065409623300021963Estuarine WaterMEMFLLCGMAIGFLVGYPLGLFIDKLDKDIKNDRR
Ga0222712_1069232313300021963Estuarine WaterIMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0214917_1007683743300022752FreshwaterMEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDAR
Ga0214921_1001309433300023174FreshwaterMEMFLLCGIAIGFLVGYPLGLFIDKLDKDIKNDRR
Ga0214921_10020790163300023174FreshwaterMEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG
Ga0214921_1008410753300023174FreshwaterMEMFLICGIAIGFLIGYPLGLFIDQIDKRIKNDRG
Ga0214921_1057831123300023174FreshwaterMEMFLICGIAIGFLVGYPLGLFIDKIDKDIKNGRR
Ga0255147_100247753300024289FreshwaterMTMLAVFLLGIGVGFLIGYPFGLFINYLDKKEKSKNGR
Ga0244775_1006968433300024346EstuarineMEMFFLCGIAVGFLIGYPMGLFIDKLDNRIKNGGR
Ga0244775_1020639523300024346EstuarineMELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG
Ga0244775_1024715963300024346EstuarineMEVFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR
Ga0255065_108771523300027142FreshwaterMEMFLISGIAIGFVIGYPLGLFIDKLDKKEKAKHGGR
Ga0208788_112402323300027499Deep SubsurfaceMEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGGR
Ga0208966_1000016653300027586Freshwater LenticMEIFLFSGIAIGFLIGYPIGLFIDNLNKKENKKNGR
Ga0208975_100581593300027659Freshwater LenticMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGG
Ga0209617_1017553023300027720Freshwater And SedimentMEMFLLCGIAIGFLIGYPMGLFIDKLDKRIKNGGR
Ga0209296_1000586123300027759Freshwater LakeMEMFFICGVAVGFLIGYPMGLFIDKLDKRIKNGGR
Ga0209296_100495623300027759Freshwater LakeMEIFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR
Ga0209296_129390613300027759Freshwater LakeMEMFFVCGIAVGFLIGYPFGLFINNLDKKEKAKNGGR
Ga0209770_1008182423300027769Freshwater LakeMEMFLLGMMIGFIIGYPVGLFIDKLDKRERAKNGR
Ga0209972_1002055333300027793Freshwater LakeMEVFILGAMLGFIIGYPMGLFIDKLDNRERTKNGR
Ga0209972_1008662943300027793Freshwater LakeMEMLLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR
Ga0209972_1010586853300027793Freshwater LakeMEMFLIAGTAIGFLIGYPLGLFIDKLDKKEKAKNGGR
Ga0209229_10000004923300027805Freshwater And SedimentMEIFLLGMMIGFAVGYPMGLFVDKLDKKEKAKNGGR
(restricted) Ga0247837_128572633300027970FreshwaterMEMFFLCGIAVGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0247723_1001664173300028025Deep Subsurface SedimentMSMFLLGIMLGFVVGYAMGLFIDKLDKRERNKNGRR
Ga0247723_103175323300028025Deep Subsurface SedimentMEMFLIAGIAIGFLIGYPLGLFVDKLDKREKAKNGGR
Ga0247723_103309233300028025Deep Subsurface SedimentMEMFLFCGIAIGFLIGYPFGLFIDNLDKKEKAKNAIK
Ga0247723_109705933300028025Deep Subsurface SedimentMEIFLIAGIAIGFLIGYPLGLFIDKLDKREKAKDGGR
Ga0315907_1014677343300031758FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVN
Ga0315907_1052049243300031758FreshwaterMEMFLIAGIAIGFLFGYPLGLFIDKLDKKEKAKNVN
Ga0315907_1099862223300031758FreshwaterMEMFFVCGIAVGFFIGYPFGLFINNLDKKEKAKNGGR
Ga0315899_1118039433300031784FreshwaterVCIMNMFLLGLGIGFVIGYAMGLFIDKLDKREKAKNGGR
Ga0315909_1031243533300031857FreshwaterMNEMFLVSGIAIGFIIGYPFGLFIDKLDKKEKAKNGGR
Ga0315909_1049220933300031857FreshwaterIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR
Ga0315904_1004039253300031951FreshwaterMDIMSLFLIGAGIGFIVGYATGLFIDKLDKKEKAKNAERA
Ga0315904_1069320633300031951FreshwaterMNVTLLITGIAIGFVMGYPFGLFINKLDKKEKAKNGGR
Ga0315906_1115125113300032050FreshwaterYLMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR
Ga0334980_0370730_381_4943300033816FreshwaterVEIFLISGIAIGFLIGYPLGLFIDKLDKKEKDKNGGR
Ga0335000_0048435_697_8103300034063FreshwaterMEMFLLCGIAIGFLIGYPLGLFVNKLDKREKAKNGGR
Ga0310130_0001350_6314_64243300034073Fracking WaterMELFMLGMTIGLAFGYSLGLFIDKLDKKEKAKNVGR
Ga0335012_0083624_485_5953300034093FreshwaterMNMFLLGLGIGFVIGYAMGLFIDKLDKRERAKNDTR
Ga0335027_0040908_1229_13423300034101FreshwaterVEIFLISGIAIGFLIGYPLGLFIDKLDKKERDKNGGR
Ga0335068_0006809_6922_70353300034116FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKKERAKNGGR
Ga0335049_0562459_547_6603300034272FreshwaterMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKDKNGGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.