Basic Information | |
---|---|
Family ID | F033808 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 176 |
Average Sequence Length | 36 residues |
Representative Sequence | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR |
Number of Associated Samples | 98 |
Number of Associated Scaffolds | 176 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 90.91 % |
% of genes near scaffold ends (potentially truncated) | 10.23 % |
% of genes from short scaffolds (< 2000 bps) | 63.07 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (79.545 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (15.341 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.386 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.614 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 176 Family Scaffolds |
---|---|---|
PF07235 | DUF1427 | 34.09 |
PF00154 | RecA | 13.07 |
PF01923 | Cob_adeno_trans | 9.66 |
PF12705 | PDDEXK_1 | 6.82 |
PF02075 | RuvC | 2.27 |
PF00011 | HSP20 | 1.70 |
PF03819 | MazG | 1.70 |
PF14579 | HHH_6 | 1.14 |
PF13662 | Toprim_4 | 0.57 |
PF10145 | PhageMin_Tail | 0.57 |
PF05050 | Methyltransf_21 | 0.57 |
PF04488 | Gly_transf_sug | 0.57 |
PF00436 | SSB | 0.57 |
PF01135 | PCMT | 0.57 |
PF03796 | DnaB_C | 0.57 |
PF08241 | Methyltransf_11 | 0.57 |
PF05257 | CHAP | 0.57 |
PF01930 | Cas_Cas4 | 0.57 |
PF00565 | SNase | 0.57 |
COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
---|---|---|---|
COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 34.09 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 13.07 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 2.27 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.70 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.57 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.57 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.57 |
COG1468 | CRISPR/Cas system-associated exonuclease Cas4, RecB family | Defense mechanisms [V] | 0.57 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.57 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.57 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.57 |
COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.93 % |
Unclassified | root | N/A | 13.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000736|JGI12547J11936_1005283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3513 | Open in IMG/M |
3300000756|JGI12421J11937_10083170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300001282|B570J14230_10191652 | Not Available | 567 | Open in IMG/M |
3300002161|JGI24766J26685_10000008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 46845 | Open in IMG/M |
3300005517|Ga0070374_10149819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
3300005527|Ga0068876_10029064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3449 | Open in IMG/M |
3300005527|Ga0068876_10037691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2989 | Open in IMG/M |
3300005527|Ga0068876_10071026 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
3300005527|Ga0068876_10077107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2003 | Open in IMG/M |
3300005527|Ga0068876_10119868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1560 | Open in IMG/M |
3300005527|Ga0068876_10129112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1494 | Open in IMG/M |
3300005527|Ga0068876_10202222 | Not Available | 1152 | Open in IMG/M |
3300005527|Ga0068876_10764665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300005528|Ga0068872_10182417 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
3300005528|Ga0068872_10411657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300005580|Ga0049083_10170085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300005581|Ga0049081_10185056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300005584|Ga0049082_10000347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12779 | Open in IMG/M |
3300005662|Ga0078894_10018668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5573 | Open in IMG/M |
3300005662|Ga0078894_10188656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1864 | Open in IMG/M |
3300005662|Ga0078894_10210821 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
3300005662|Ga0078894_10747944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 859 | Open in IMG/M |
3300005662|Ga0078894_10986663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300005662|Ga0078894_11004881 | Not Available | 717 | Open in IMG/M |
3300005662|Ga0078894_11213760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300005805|Ga0079957_1034807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3279 | Open in IMG/M |
3300006005|Ga0073910_1016373 | Not Available | 520 | Open in IMG/M |
3300006484|Ga0070744_10000976 | Not Available | 8474 | Open in IMG/M |
3300006484|Ga0070744_10012372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2531 | Open in IMG/M |
3300006639|Ga0079301_1120602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300007545|Ga0102873_1154274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300007559|Ga0102828_1051961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
3300007559|Ga0102828_1179205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300007590|Ga0102917_1136089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300007593|Ga0102918_1128571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 760 | Open in IMG/M |
3300007597|Ga0102919_1043856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1393 | Open in IMG/M |
3300008052|Ga0102893_1170200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 634 | Open in IMG/M |
3300008055|Ga0108970_10898716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3068 | Open in IMG/M |
3300008107|Ga0114340_1002746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10130 | Open in IMG/M |
3300008107|Ga0114340_1005474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7364 | Open in IMG/M |
3300008107|Ga0114340_1033081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2356 | Open in IMG/M |
3300008107|Ga0114340_1063095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1584 | Open in IMG/M |
3300008107|Ga0114340_1100374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1159 | Open in IMG/M |
3300008107|Ga0114340_1105957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1723 | Open in IMG/M |
3300008107|Ga0114340_1139256 | Not Available | 911 | Open in IMG/M |
3300008107|Ga0114340_1178113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
3300008108|Ga0114341_10128097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1504 | Open in IMG/M |
3300008110|Ga0114343_1063038 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
3300008114|Ga0114347_1042551 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
3300008116|Ga0114350_1079027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
3300008116|Ga0114350_1154772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 633 | Open in IMG/M |
3300008120|Ga0114355_1137780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
3300008120|Ga0114355_1190604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300008259|Ga0114841_1047019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2119 | Open in IMG/M |
3300008262|Ga0114337_1125607 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
3300008953|Ga0104241_1000714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2662 | Open in IMG/M |
3300008962|Ga0104242_1008525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1821 | Open in IMG/M |
3300008962|Ga0104242_1054123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300008996|Ga0102831_1004704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5193 | Open in IMG/M |
3300009159|Ga0114978_10129326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
3300009159|Ga0114978_10168760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1399 | Open in IMG/M |
3300009159|Ga0114978_10635619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009183|Ga0114974_10003457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11890 | Open in IMG/M |
3300009183|Ga0114974_10006440 | Not Available | 8676 | Open in IMG/M |
3300009183|Ga0114974_10541565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300009183|Ga0114974_10787302 | Not Available | 511 | Open in IMG/M |
3300010354|Ga0129333_10688613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300011116|Ga0151516_10663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15963 | Open in IMG/M |
3300012012|Ga0153799_1000162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23531 | Open in IMG/M |
3300012017|Ga0153801_1031444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
3300012666|Ga0157498_1022136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300012779|Ga0138284_1349353 | Not Available | 561 | Open in IMG/M |
3300013004|Ga0164293_10656056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300013087|Ga0163212_1085585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1022 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10446127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10059717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3179 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10367150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300013295|Ga0170791_11427432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
3300013372|Ga0177922_10251216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300013372|Ga0177922_10574871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1022 | Open in IMG/M |
3300013372|Ga0177922_11108788 | Not Available | 845 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10123326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1786 | Open in IMG/M |
3300017723|Ga0181362_1059539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300017788|Ga0169931_10026531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7068 | Open in IMG/M |
3300017788|Ga0169931_10176361 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
3300019146|Ga0188881_10037715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300019146|Ga0188881_10044992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300019784|Ga0181359_1041412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1784 | Open in IMG/M |
3300019784|Ga0181359_1204924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300020048|Ga0207193_1035772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5580 | Open in IMG/M |
3300020048|Ga0207193_1057221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 3982 | Open in IMG/M |
3300020074|Ga0194113_10027824 | Not Available | 5995 | Open in IMG/M |
3300020074|Ga0194113_10049588 | Not Available | 4089 | Open in IMG/M |
3300020074|Ga0194113_10089840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2737 | Open in IMG/M |
3300020074|Ga0194113_10099005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2563 | Open in IMG/M |
3300020074|Ga0194113_11101340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300020084|Ga0194110_10301059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
3300020141|Ga0211732_1013266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020141|Ga0211732_1231842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
3300020141|Ga0211732_1284207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4543 | Open in IMG/M |
3300020151|Ga0211736_10136019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300020151|Ga0211736_10136504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2116 | Open in IMG/M |
3300020151|Ga0211736_10586991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300020151|Ga0211736_10966384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6088 | Open in IMG/M |
3300020159|Ga0211734_10139596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300020159|Ga0211734_10322587 | Not Available | 612 | Open in IMG/M |
3300020161|Ga0211726_10096231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2290 | Open in IMG/M |
3300020161|Ga0211726_10385521 | Not Available | 17182 | Open in IMG/M |
3300020179|Ga0194134_10017405 | All Organisms → Viruses → Predicted Viral | 4957 | Open in IMG/M |
3300020190|Ga0194118_10178704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
3300020196|Ga0194124_10206066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300020198|Ga0194120_10454039 | Not Available | 589 | Open in IMG/M |
3300020222|Ga0194125_10140618 | All Organisms → Viruses → Predicted Viral | 1865 | Open in IMG/M |
3300020519|Ga0208223_1000366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 11363 | Open in IMG/M |
3300020519|Ga0208223_1015125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
3300020533|Ga0208364_1001165 | Not Available | 5399 | Open in IMG/M |
3300020572|Ga0207909_1008242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2158 | Open in IMG/M |
3300021376|Ga0194130_10066038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2491 | Open in IMG/M |
3300021961|Ga0222714_10009917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 8303 | Open in IMG/M |
3300021961|Ga0222714_10033771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3761 | Open in IMG/M |
3300021961|Ga0222714_10276320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300021962|Ga0222713_10009045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9113 | Open in IMG/M |
3300021962|Ga0222713_10012879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7390 | Open in IMG/M |
3300021962|Ga0222713_10081486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2364 | Open in IMG/M |
3300021962|Ga0222713_10093353 | All Organisms → Viruses → Predicted Viral | 2172 | Open in IMG/M |
3300021962|Ga0222713_10137851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1700 | Open in IMG/M |
3300021962|Ga0222713_10297793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
3300021963|Ga0222712_10198404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
3300021963|Ga0222712_10213000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300021963|Ga0222712_10216106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1245 | Open in IMG/M |
3300021963|Ga0222712_10226890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1207 | Open in IMG/M |
3300021963|Ga0222712_10654096 | Not Available | 599 | Open in IMG/M |
3300021963|Ga0222712_10692323 | Not Available | 575 | Open in IMG/M |
3300022752|Ga0214917_10076837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 2064 | Open in IMG/M |
3300023174|Ga0214921_10013094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9793 | Open in IMG/M |
3300023174|Ga0214921_10020790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7008 | Open in IMG/M |
3300023174|Ga0214921_10084107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 2494 | Open in IMG/M |
3300023174|Ga0214921_10578311 | Not Available | 509 | Open in IMG/M |
3300024289|Ga0255147_1002477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4472 | Open in IMG/M |
3300024346|Ga0244775_10069684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 3017 | Open in IMG/M |
3300024346|Ga0244775_10206395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1647 | Open in IMG/M |
3300024346|Ga0244775_10247159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 1487 | Open in IMG/M |
3300027142|Ga0255065_1087715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300027499|Ga0208788_1124023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300027586|Ga0208966_1000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 64675 | Open in IMG/M |
3300027659|Ga0208975_1005815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4512 | Open in IMG/M |
3300027720|Ga0209617_10175530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300027759|Ga0209296_1000586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 31699 | Open in IMG/M |
3300027759|Ga0209296_1004956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 8610 | Open in IMG/M |
3300027759|Ga0209296_1293906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300027769|Ga0209770_10081824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1344 | Open in IMG/M |
3300027793|Ga0209972_10020553 | All Organisms → Viruses | 4053 | Open in IMG/M |
3300027793|Ga0209972_10086629 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
3300027793|Ga0209972_10105868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
3300027805|Ga0209229_10000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 91329 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1285726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300028025|Ga0247723_1001664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12647 | Open in IMG/M |
3300028025|Ga0247723_1031753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1654 | Open in IMG/M |
3300028025|Ga0247723_1033092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
3300028025|Ga0247723_1097059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300031758|Ga0315907_10146773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 2000 | Open in IMG/M |
3300031758|Ga0315907_10520492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300031758|Ga0315907_10998622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 604 | Open in IMG/M |
3300031784|Ga0315899_11180394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 665 | Open in IMG/M |
3300031857|Ga0315909_10312435 | Not Available | 1168 | Open in IMG/M |
3300031857|Ga0315909_10492209 | Not Available | 849 | Open in IMG/M |
3300031951|Ga0315904_10040392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5316 | Open in IMG/M |
3300031951|Ga0315904_10693206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 858 | Open in IMG/M |
3300032050|Ga0315906_11151251 | Not Available | 567 | Open in IMG/M |
3300033816|Ga0334980_0370730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300034063|Ga0335000_0048435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3054 | Open in IMG/M |
3300034073|Ga0310130_0001350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13580 | Open in IMG/M |
3300034093|Ga0335012_0083624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 1800 | Open in IMG/M |
3300034101|Ga0335027_0040908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay | 3809 | Open in IMG/M |
3300034116|Ga0335068_0006809 | Not Available | 7433 | Open in IMG/M |
3300034272|Ga0335049_0562459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.34% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.36% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.66% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 8.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.82% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.25% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.11% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.84% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.84% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.84% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.27% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.14% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.14% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.14% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.14% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.14% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.57% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.57% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.57% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.57% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.57% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.57% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12547J11936_10052838 | 3300000736 | Freshwater And Sediment | MELFLICGIAIGFLVGYPLGLFINKLDKDIKNDAR* |
JGI12421J11937_100831702 | 3300000756 | Freshwater And Sediment | MEMFLLCGIAIGFLIGYPMGLFIDKLDKRIKNGGR* |
B570J14230_101916521 | 3300001282 | Freshwater | VCIMELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR* |
JGI24766J26685_1000000820 | 3300002161 | Freshwater And Sediment | MEIFLLGMMIGFAVGYPMGLFVDKLDKKEKAKNGGR* |
Ga0070374_101498195 | 3300005517 | Freshwater Lake | MELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG* |
Ga0068876_100290643 | 3300005527 | Freshwater Lake | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKHGGR* |
Ga0068876_100376917 | 3300005527 | Freshwater Lake | MEMFLIAGIAIGFLIGYPFGLFIDKLDKKEKAKNVN* |
Ga0068876_100710266 | 3300005527 | Freshwater Lake | MEVFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR* |
Ga0068876_100771072 | 3300005527 | Freshwater Lake | MEMFLIAGIAIGFLIGYPLGLFVDKLDKREKAKNGGR* |
Ga0068876_101198682 | 3300005527 | Freshwater Lake | MEIFLLGIMIGFAVGYPMGLFIDKLDKREKAKNGGR* |
Ga0068876_101291124 | 3300005527 | Freshwater Lake | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKSGGR* |
Ga0068876_102022222 | 3300005527 | Freshwater Lake | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR* |
Ga0068876_107646653 | 3300005527 | Freshwater Lake | MEMFLLCGIAIGFLIGYPLGLFIDKLDKREKAKNGGR* |
Ga0068872_101824174 | 3300005528 | Freshwater Lake | MEMFLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR* |
Ga0068872_104116572 | 3300005528 | Freshwater Lake | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR* |
Ga0049083_101700853 | 3300005580 | Freshwater Lentic | MEMFFFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR* |
Ga0049081_101850563 | 3300005581 | Freshwater Lentic | MEMFLIAGISIGFLIGYPLGLFIDKLDKKEKAKNGGR* |
Ga0049082_1000034716 | 3300005584 | Freshwater Lentic | MEIFLFSGIAIGFLIGYPIGLFIDNLNKKENKKNGR* |
Ga0078894_100186687 | 3300005662 | Freshwater Lake | MNMFLLGLGIGFVIGYAMGLFIDKLDKREKAKNGGR* |
Ga0078894_101886566 | 3300005662 | Freshwater Lake | MEMFIMGIMIGFIVGYPTGLFIDKLDKREKAKSGGR* |
Ga0078894_102108212 | 3300005662 | Freshwater Lake | MEMFLLGMMIGFIIGYPVGLFIDKLDKRERAKNGR* |
Ga0078894_107479443 | 3300005662 | Freshwater Lake | ELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR* |
Ga0078894_109866632 | 3300005662 | Freshwater Lake | VIEVLLIGIMIGFIAGYPMGLFIDRLDKKEKAKNGGR* |
Ga0078894_110048811 | 3300005662 | Freshwater Lake | MEMFLLCGIAIGFLIGYPLGLFIDKLDKREKAKNVN* |
Ga0078894_112137602 | 3300005662 | Freshwater Lake | VEIFLISGIAIGFLIGYPLGLFIDKLDKKEKDKNGGR* |
Ga0079957_10348076 | 3300005805 | Lake | MTTLTIFILGSMVGFVVGYGFGLFIDKLDKKEKEKNGGR* |
Ga0073910_10163731 | 3300006005 | Sand | MEIFLFSGIAIGFLIGYPIGLFIDSLNKKENKKNGR* |
Ga0070744_100009762 | 3300006484 | Estuarine | MEMFLLGMMLGFIIGYPVGLFIDKLDKRERAKNGR* |
Ga0070744_100123723 | 3300006484 | Estuarine | MEMFFLCGIAVGFLIGYPMGLFIDKLDNRIKNGGR* |
Ga0079301_11206021 | 3300006639 | Deep Subsurface | MEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGGR* |
Ga0102873_11542742 | 3300007545 | Estuarine | MEMFLICGIAIGFLIGYPLGLFIDKWDKRIKNDRG* |
Ga0102828_10519613 | 3300007559 | Estuarine | MEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG* |
Ga0102828_11792053 | 3300007559 | Estuarine | MEMFLLGMMLGFIIGYPVGLVRDKLDKRERAKNGR* |
Ga0102917_11360894 | 3300007590 | Estuarine | MTTFLFGLLIGFAFGYPMGLFIDYLDKKEKRKQRVD |
Ga0102918_11285713 | 3300007593 | Estuarine | RKVCIMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG* |
Ga0102919_10438565 | 3300007597 | Estuarine | MELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG* |
Ga0102893_11702003 | 3300008052 | Estuarine | CIMELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG* |
Ga0108970_108987165 | 3300008055 | Estuary | MDILLLGIMIGFAIGYPMGLFIDKLDKREKAKHGG* |
Ga0114340_10027466 | 3300008107 | Freshwater, Plankton | MEMFLIAGIAIGFLIGYPFGLFIDKLDKKEKAKNGGR* |
Ga0114340_100547413 | 3300008107 | Freshwater, Plankton | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKHGGR* |
Ga0114340_10330812 | 3300008107 | Freshwater, Plankton | MEMFLIAGIAIGFLFGYPLGLFIDKLDKKEKAKNVN* |
Ga0114340_10630956 | 3300008107 | Freshwater, Plankton | MEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR* |
Ga0114340_11003744 | 3300008107 | Freshwater, Plankton | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVN* |
Ga0114340_11059575 | 3300008107 | Freshwater, Plankton | MEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGR* |
Ga0114340_11392563 | 3300008107 | Freshwater, Plankton | MEMFLIAGTAIGFLIGYPLGLFIDKLDKKEKAKNGGR* |
Ga0114340_11781135 | 3300008107 | Freshwater, Plankton | MEVFILGIMLGFVVGYPTGLFIDKLDKREKAKSGGR* |
Ga0114341_101280976 | 3300008108 | Freshwater, Plankton | MDLFILGILIGFALGYPLGLFIDKLDKKEKAKNGGR* |
Ga0114343_10630381 | 3300008110 | Freshwater, Plankton | MEIFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR* |
Ga0114347_10425513 | 3300008114 | Freshwater, Plankton | MEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKHGGR* |
Ga0114350_10790274 | 3300008116 | Freshwater, Plankton | MDIMSLFLIGAGIGFIVGYATGLFIDKLDKREKAKNAERA* |
Ga0114350_11547722 | 3300008116 | Freshwater, Plankton | MEMFFVCGIAVGFFIGYPFGLFINNLDKKEKAKNGGR* |
Ga0114355_11377801 | 3300008120 | Freshwater, Plankton | MDIMSLFLIGAGIGFIVGYATGLFIDKLDKREKAKNA |
Ga0114355_11906043 | 3300008120 | Freshwater, Plankton | MDIFILGIMIGFVIGYPMGLFIDKLDKREKAKNGGR* |
Ga0114841_10470195 | 3300008259 | Freshwater, Plankton | MEMFLIAGITIGFLIGYPLGLFIDKLDKREKAKNGGR* |
Ga0114337_11256071 | 3300008262 | Freshwater, Plankton | SWKAFIMEIFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR* |
Ga0104241_10007142 | 3300008953 | Freshwater | MDLFILGILIGFALGYPLGLFIDKLDKREKAKNGGR* |
Ga0104242_10085253 | 3300008962 | Freshwater | MEAIFLMEMFLICGIAIGFLIGYPLGLFIDQIDKRIKNDRG* |
Ga0104242_10541232 | 3300008962 | Freshwater | MEMFLLCGIAIGFLVGYPLGLFIDKLDKDIKNDRR* |
Ga0102831_10047049 | 3300008996 | Estuarine | MEMFLICGMAIGFLVGYPLGLFINKLDKDIKNDAR* |
Ga0114978_101293265 | 3300009159 | Freshwater Lake | MELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR* |
Ga0114978_101687603 | 3300009159 | Freshwater Lake | MEMFLLCGMAIGFLVGYPLGLFIDKLDKDIKNDRR* |
Ga0114978_106356193 | 3300009159 | Freshwater Lake | MEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG* |
Ga0114974_100034577 | 3300009183 | Freshwater Lake | MEMFFICGIAVGFLIGYPMGLFIDKLDKRIKNGGR* |
Ga0114974_1000644012 | 3300009183 | Freshwater Lake | MEIFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR* |
Ga0114974_105415651 | 3300009183 | Freshwater Lake | MEMFFVCGIAVGFLIGYPFGLFINNLDKKEKAKNGGR* |
Ga0114974_107873022 | 3300009183 | Freshwater Lake | MEMFLLCGIAIGFLIGYPMGLFINKLDKRIKNGGR* |
Ga0129333_106886132 | 3300010354 | Freshwater To Marine Saline Gradient | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKVKNGGR* |
Ga0151516_1066321 | 3300011116 | Freshwater | MEMFFLCGIALGFLIGYPLGLFIDKLDKRTKNGGR* |
Ga0153799_100016227 | 3300012012 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVGR* |
Ga0153801_10314445 | 3300012017 | Freshwater | MEMFLIAGTAIGFLIGYPLGLFIDKLDKREKAKNVGR* |
Ga0157498_10221364 | 3300012666 | Freshwater, Surface Ice | MEIFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR* |
Ga0138284_13493533 | 3300012779 | Freshwater Lake | MSMFFICGVAVGFLIGYPMGLFIDKLDKRIKNGGR* |
Ga0164293_106560563 | 3300013004 | Freshwater | MNMFLLGLGIGFVIGYAMGLFIDKLDKRERAKNDTR* |
Ga0163212_10855852 | 3300013087 | Freshwater | MTTMAIFLMGIGIGFVIGYPVGLFIDKLDKREKKKNDGR* |
(restricted) Ga0172367_104461272 | 3300013126 | Freshwater | MEMFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNDKR* |
(restricted) Ga0172373_100597175 | 3300013131 | Freshwater | MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGRR* |
(restricted) Ga0172373_103671502 | 3300013131 | Freshwater | MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR* |
Ga0170791_114274322 | 3300013295 | Freshwater | MEMFLLCGIAVGFLIGYPMGLFIDKLDKRIKNGGR* |
Ga0177922_102512163 | 3300013372 | Freshwater | MEMFFLCGIAIGFLIGYPLGLFIDKLDKREKAKNGGR* |
Ga0177922_105748712 | 3300013372 | Freshwater | MEMFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR* |
Ga0177922_111087883 | 3300013372 | Freshwater | SEVYIMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR* |
(restricted) Ga0172376_101233266 | 3300014720 | Freshwater | MDIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR* |
Ga0181362_10595394 | 3300017723 | Freshwater Lake | MEMFFLCGIAVGFLIRYPMGLFIDKLDKRIKNGGR |
Ga0169931_100265319 | 3300017788 | Freshwater | MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR |
Ga0169931_101763615 | 3300017788 | Freshwater | MEIFLISGIAIGFLIGYPLGLFIDKLDKKEKAKNGRR |
Ga0188881_100377154 | 3300019146 | Freshwater Lake | MEMFLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR |
Ga0188881_100449922 | 3300019146 | Freshwater Lake | MEIFLISGIAIGFLIGYPLGLFIDKLDKREKAKNVN |
Ga0181359_10414123 | 3300019784 | Freshwater Lake | MEMFFFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR |
Ga0181359_12049241 | 3300019784 | Freshwater Lake | MELFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG |
Ga0207193_10357729 | 3300020048 | Freshwater Lake Sediment | MEMFLLGMMLGFIIGYPVGLFIDKLDKRERAKNGR |
Ga0207193_10572215 | 3300020048 | Freshwater Lake Sediment | MEIFLLGMMLGFVVGYPIGLFIDKLDKRERAKNGRR |
Ga0194113_100278248 | 3300020074 | Freshwater Lake | METMFIFLTGICIGFVIGYPFGLFIDKLDKREKRKNGGR |
Ga0194113_100495886 | 3300020074 | Freshwater Lake | MEATFIFLTGIGIGFVIGYPVGLFIDKLDKKIKSRT |
Ga0194113_100898405 | 3300020074 | Freshwater Lake | METMFIFLAGIGVGFVIGYPVGLFIDKLDKREKRKNGG |
Ga0194113_100990053 | 3300020074 | Freshwater Lake | METMFIFLTGIGIGFVIGYPVGLFIDKLDKREKKKNDGR |
Ga0194113_111013401 | 3300020074 | Freshwater Lake | METMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGG |
Ga0194110_103010595 | 3300020084 | Freshwater Lake | METMFIFLAGIGIGFVIGYPVGLFIDKLDKREKRKNGGR |
Ga0211732_10132662 | 3300020141 | Freshwater | MEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG |
Ga0211732_12318426 | 3300020141 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR |
Ga0211732_12842075 | 3300020141 | Freshwater | MEMFLLSGIAIGFLVGYPLGLFIDKLDKRIKNDRG |
Ga0211736_101360193 | 3300020151 | Freshwater | MEMFFLCGIAIGFLIGYPLGLFIDKLDKKEKAKNVN |
Ga0211736_101365046 | 3300020151 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNVK |
Ga0211736_105869914 | 3300020151 | Freshwater | MEMFLIAGISIGFLIGYPLGLFIDKLDKREKAKNGGR |
Ga0211736_109663848 | 3300020151 | Freshwater | MEMFLFSGIAIGFLIGYPFGLFIDKLDKKEKAKNGGR |
Ga0211734_101395961 | 3300020159 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNVN |
Ga0211734_103225872 | 3300020159 | Freshwater | MEVILLMEMFFLCGIAIGFLIGYPLGLFIDQIDKRIKNNGR |
Ga0211726_100962312 | 3300020161 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR |
Ga0211726_103855219 | 3300020161 | Freshwater | MEMFFLCGIAIGFLIGYPLGLFIDQIDKRIKNNGR |
Ga0194134_100174058 | 3300020179 | Freshwater Lake | METMFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGGR |
Ga0194118_101787045 | 3300020190 | Freshwater Lake | MFIFLAGIGIGFVIGYPVGLFIDKLDKREKRKNGGR |
Ga0194124_102060665 | 3300020196 | Freshwater Lake | METMLIFLTGICIGFVIGYPFGLFIDKLDKREKRKNF |
Ga0194120_104540393 | 3300020198 | Freshwater Lake | MFIFLTGIGIGFVIGYPVGLFIDKLDKREKRKNGGR |
Ga0194125_101406186 | 3300020222 | Freshwater Lake | MFIFLAGIGVGFVMGYPVGLFIDKLDKREKRKNGGR |
Ga0208223_10003665 | 3300020519 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKVKHGGR |
Ga0208223_10151256 | 3300020519 | Freshwater | VEIFLISGIAIGFLIGYPLGLFINKLDKKEKDKNGGR |
Ga0208364_10011652 | 3300020533 | Freshwater | MEMFLIAGIAIGFVIGYPLGLFIDKLDKKEKAKHGGR |
Ga0207909_10082424 | 3300020572 | Freshwater | VELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR |
Ga0194130_100660385 | 3300021376 | Freshwater Lake | TMLIFLTGICIGFVIGYPFGLFIDKLDKREKRKNGGR |
Ga0222714_100099173 | 3300021961 | Estuarine Water | MDLFILGILIGFALGYPLGLFIDKLDKKEKAKNGGR |
Ga0222714_100337717 | 3300021961 | Estuarine Water | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKSGGR |
Ga0222714_102763203 | 3300021961 | Estuarine Water | MEMFLVSGIAIGFLIGYPLGLFVDKLDKRIKDDRR |
Ga0222713_1000904517 | 3300021962 | Estuarine Water | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKDGGR |
Ga0222713_100128797 | 3300021962 | Estuarine Water | MDIFILGILVGFAFGYPMGLFIDKLDKREKAKNGGR |
Ga0222713_100814863 | 3300021962 | Estuarine Water | MEMFLICGIAIGFLIGYPLGLFIDKLDKDIKNDAR |
Ga0222713_100933534 | 3300021962 | Estuarine Water | MEVFILGIMLGFVVGYPTGLFIDKLDKREKAKSGGR |
Ga0222713_101378513 | 3300021962 | Estuarine Water | MEVFLLGMMIGFAVGYPMGLFIDKLDKREKVKSGGR |
Ga0222713_102977933 | 3300021962 | Estuarine Water | MEMFLICGIAIGFLIGYPLGLFIDKWDKRIKNDRG |
Ga0222712_101984041 | 3300021963 | Estuarine Water | MDLFILGILIGFACGYPIGLFIDKLDKKEKAKNGGR |
Ga0222712_102130006 | 3300021963 | Estuarine Water | MTTLTIFILGSMVGFVVGYGFGLFIDKLDKKEKEKNGGR |
Ga0222712_102161063 | 3300021963 | Estuarine Water | YCSKVYLMEIFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR |
Ga0222712_102268903 | 3300021963 | Estuarine Water | MEMFLICGMAIGFLVGYPLGLFINKLDKDIKNDAR |
Ga0222712_106540962 | 3300021963 | Estuarine Water | MEMFLLCGMAIGFLVGYPLGLFIDKLDKDIKNDRR |
Ga0222712_106923231 | 3300021963 | Estuarine Water | IMEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGGR |
Ga0214917_100768374 | 3300022752 | Freshwater | MEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDAR |
Ga0214921_100130943 | 3300023174 | Freshwater | MEMFLLCGIAIGFLVGYPLGLFIDKLDKDIKNDRR |
Ga0214921_1002079016 | 3300023174 | Freshwater | MEMFLICGMAIGFLVGYPLGLFIDKLDKDIKNDRG |
Ga0214921_100841075 | 3300023174 | Freshwater | MEMFLICGIAIGFLIGYPLGLFIDQIDKRIKNDRG |
Ga0214921_105783112 | 3300023174 | Freshwater | MEMFLICGIAIGFLVGYPLGLFIDKIDKDIKNGRR |
Ga0255147_10024775 | 3300024289 | Freshwater | MTMLAVFLLGIGVGFLIGYPFGLFINYLDKKEKSKNGR |
Ga0244775_100696843 | 3300024346 | Estuarine | MEMFFLCGIAVGFLIGYPMGLFIDKLDNRIKNGGR |
Ga0244775_102063952 | 3300024346 | Estuarine | MELFLICGIAIGFLIGYPLGLFIDKLDKDIKNDRG |
Ga0244775_102471596 | 3300024346 | Estuarine | MEVFILGAMLGFIIGYPMGLFIDKLDKRERTKNGR |
Ga0255065_10877152 | 3300027142 | Freshwater | MEMFLISGIAIGFVIGYPLGLFIDKLDKKEKAKHGGR |
Ga0208788_11240232 | 3300027499 | Deep Subsurface | MEMFLIAGIAIGFLIGYPLGLFIDKLDKRERAKNGGR |
Ga0208966_100001665 | 3300027586 | Freshwater Lentic | MEIFLFSGIAIGFLIGYPIGLFIDNLNKKENKKNGR |
Ga0208975_10058159 | 3300027659 | Freshwater Lentic | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKEKAKNGG |
Ga0209617_101755302 | 3300027720 | Freshwater And Sediment | MEMFLLCGIAIGFLIGYPMGLFIDKLDKRIKNGGR |
Ga0209296_100058612 | 3300027759 | Freshwater Lake | MEMFFICGVAVGFLIGYPMGLFIDKLDKRIKNGGR |
Ga0209296_10049562 | 3300027759 | Freshwater Lake | MEIFLFSGIAIGFLIGYPLGLFIDNLNKKENKKNGR |
Ga0209296_12939061 | 3300027759 | Freshwater Lake | MEMFFVCGIAVGFLIGYPFGLFINNLDKKEKAKNGGR |
Ga0209770_100818242 | 3300027769 | Freshwater Lake | MEMFLLGMMIGFIIGYPVGLFIDKLDKRERAKNGR |
Ga0209972_100205533 | 3300027793 | Freshwater Lake | MEVFILGAMLGFIIGYPMGLFIDKLDNRERTKNGR |
Ga0209972_100866294 | 3300027793 | Freshwater Lake | MEMLLLGMMIGFIVGYPTGLFIDKLDKREKAKSGGR |
Ga0209972_101058685 | 3300027793 | Freshwater Lake | MEMFLIAGTAIGFLIGYPLGLFIDKLDKKEKAKNGGR |
Ga0209229_1000000492 | 3300027805 | Freshwater And Sediment | MEIFLLGMMIGFAVGYPMGLFVDKLDKKEKAKNGGR |
(restricted) Ga0247837_12857263 | 3300027970 | Freshwater | MEMFFLCGIAVGFLIGYPLGLFIDKLDKREKAKNGGR |
Ga0247723_100166417 | 3300028025 | Deep Subsurface Sediment | MSMFLLGIMLGFVVGYAMGLFIDKLDKRERNKNGRR |
Ga0247723_10317532 | 3300028025 | Deep Subsurface Sediment | MEMFLIAGIAIGFLIGYPLGLFVDKLDKREKAKNGGR |
Ga0247723_10330923 | 3300028025 | Deep Subsurface Sediment | MEMFLFCGIAIGFLIGYPFGLFIDNLDKKEKAKNAIK |
Ga0247723_10970593 | 3300028025 | Deep Subsurface Sediment | MEIFLIAGIAIGFLIGYPLGLFIDKLDKREKAKDGGR |
Ga0315907_101467734 | 3300031758 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNVN |
Ga0315907_105204924 | 3300031758 | Freshwater | MEMFLIAGIAIGFLFGYPLGLFIDKLDKKEKAKNVN |
Ga0315907_109986222 | 3300031758 | Freshwater | MEMFFVCGIAVGFFIGYPFGLFINNLDKKEKAKNGGR |
Ga0315899_111803943 | 3300031784 | Freshwater | VCIMNMFLLGLGIGFVIGYAMGLFIDKLDKREKAKNGGR |
Ga0315909_103124353 | 3300031857 | Freshwater | MNEMFLVSGIAIGFIIGYPFGLFIDKLDKKEKAKNGGR |
Ga0315909_104922093 | 3300031857 | Freshwater | IFLLSGIAIGFLIGYPFGLFIDKLDKKDKAKNGGR |
Ga0315904_100403925 | 3300031951 | Freshwater | MDIMSLFLIGAGIGFIVGYATGLFIDKLDKKEKAKNAERA |
Ga0315904_106932063 | 3300031951 | Freshwater | MNVTLLITGIAIGFVMGYPFGLFINKLDKKEKAKNGGR |
Ga0315906_111512511 | 3300032050 | Freshwater | YLMEMFLIAGIAIGFLIGYPLGLFIDKLDKREKAKNGGR |
Ga0334980_0370730_381_494 | 3300033816 | Freshwater | VEIFLISGIAIGFLIGYPLGLFIDKLDKKEKDKNGGR |
Ga0335000_0048435_697_810 | 3300034063 | Freshwater | MEMFLLCGIAIGFLIGYPLGLFVNKLDKREKAKNGGR |
Ga0310130_0001350_6314_6424 | 3300034073 | Fracking Water | MELFMLGMTIGLAFGYSLGLFIDKLDKKEKAKNVGR |
Ga0335012_0083624_485_595 | 3300034093 | Freshwater | MNMFLLGLGIGFVIGYAMGLFIDKLDKRERAKNDTR |
Ga0335027_0040908_1229_1342 | 3300034101 | Freshwater | VEIFLISGIAIGFLIGYPLGLFIDKLDKKERDKNGGR |
Ga0335068_0006809_6922_7035 | 3300034116 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKKERAKNGGR |
Ga0335049_0562459_547_660 | 3300034272 | Freshwater | MEMFLIAGIAIGFLIGYPLGLFIDKLDKREKDKNGGR |
⦗Top⦘ |