Metagenome / Metatranscriptome Family F034018

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F034018
Family Type	Metagenome / Metatranscriptome
Number of Sequences	175
Average Sequence Length	44 residues
Representative Sequence	VLRTKDMITKLLDGLEMFLGVGVMFLNSSNLQMPGGTHIYRPPSP
Number of Associated Samples	88
Number of Associated Scaffolds	175

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	25.15 %
% of genes near scaffold ends (potentially truncated)	85.71 %
% of genes from short scaffolds (< 2000 bps)	97.14 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (86.286 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (81.143 % of family members)
Environment Ontology (ENVO)	Unclassified (96.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (74.286 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.10% β-sheet: 0.00% Coil/Unstructured: 58.90%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 175 Family Scaffolds
PF00067	p450	0.57

COG ID	Name	Functional Category	% Frequency in 175 Family Scaffolds
COG2124	Cytochrome P450	Defense mechanisms [V]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
All Organisms	root	All Organisms	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
cellular organisms	root	All Organisms → cellular organisms	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	13.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	12.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	12.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	12.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	12.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	11.43 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	11.43 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	10.86 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.57 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	86.29 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	10.86 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.57 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.57 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005347\|Ga0070668_101843080	Not Available	557	Open in IMG/M
3300005445\|Ga0070708_101894493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	553	Open in IMG/M
3300005843\|Ga0068860_102441908	Not Available	543	Open in IMG/M
3300009972\|Ga0105137_105949	Not Available	609	Open in IMG/M
3300009975\|Ga0105129_102973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	877	Open in IMG/M
3300009976\|Ga0105128_117777	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	542	Open in IMG/M
3300009976\|Ga0105128_120722	Not Available	514	Open in IMG/M
3300009980\|Ga0105135_103700	Not Available	934	Open in IMG/M
3300009980\|Ga0105135_108680	Not Available	746	Open in IMG/M
3300009980\|Ga0105135_110852	Not Available	700	Open in IMG/M
3300009981\|Ga0105133_103045	Not Available	963	Open in IMG/M
3300009981\|Ga0105133_120498	Not Available	583	Open in IMG/M
3300009990\|Ga0105132_117036	Not Available	684	Open in IMG/M
3300009990\|Ga0105132_124348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	617	Open in IMG/M
3300009992\|Ga0105120_1011321	Not Available	879	Open in IMG/M
3300009992\|Ga0105120_1013299	Not Available	835	Open in IMG/M
3300009992\|Ga0105120_1028234	Not Available	654	Open in IMG/M
3300009995\|Ga0105139_1022976	Not Available	949	Open in IMG/M
3300009995\|Ga0105139_1024708	Not Available	927	Open in IMG/M
3300009995\|Ga0105139_1100580	Not Available	556	Open in IMG/M
3300010371\|Ga0134125_11811948	Not Available	664	Open in IMG/M
3300010371\|Ga0134125_13015748	Not Available	510	Open in IMG/M
3300010401\|Ga0134121_10884085	Not Available	866	Open in IMG/M
3300015270\|Ga0182183_1045029	Not Available	639	Open in IMG/M
3300015284\|Ga0182101_1065427	Not Available	584	Open in IMG/M
3300015284\|Ga0182101_1083623	Not Available	536	Open in IMG/M
3300015290\|Ga0182105_1011864	Not Available	1013	Open in IMG/M
3300015293\|Ga0182103_1048960	Not Available	644	Open in IMG/M
3300015297\|Ga0182104_1050974	Not Available	681	Open in IMG/M
3300015297\|Ga0182104_1081036	Not Available	582	Open in IMG/M
3300015310\|Ga0182162_1048761	Not Available	717	Open in IMG/M
3300015310\|Ga0182162_1097111	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	561	Open in IMG/M
3300015310\|Ga0182162_1109639	Not Available	536	Open in IMG/M
3300015311\|Ga0182182_1097901	Not Available	546	Open in IMG/M
3300015311\|Ga0182182_1102635	Not Available	537	Open in IMG/M
3300015312\|Ga0182168_1104820	Not Available	559	Open in IMG/M
3300015312\|Ga0182168_1136564	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	503	Open in IMG/M
3300015313\|Ga0182164_1051910	Not Available	723	Open in IMG/M
3300015313\|Ga0182164_1073155	Not Available	641	Open in IMG/M
3300015315\|Ga0182120_1057828	Not Available	702	Open in IMG/M
3300015315\|Ga0182120_1135769	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	508	Open in IMG/M
3300015316\|Ga0182121_1115750	Not Available	554	Open in IMG/M
3300015318\|Ga0182181_1023279	Not Available	862	Open in IMG/M
3300015318\|Ga0182181_1053249	Not Available	657	Open in IMG/M
3300015318\|Ga0182181_1059708	Not Available	633	Open in IMG/M
3300015319\|Ga0182130_1049388	Not Available	724	Open in IMG/M
3300015319\|Ga0182130_1052778	Not Available	709	Open in IMG/M
3300015319\|Ga0182130_1076259	Not Available	626	Open in IMG/M
3300015319\|Ga0182130_1104476	Not Available	558	Open in IMG/M
3300015320\|Ga0182165_1060978	Not Available	707	Open in IMG/M
3300015324\|Ga0182134_1049268	Not Available	759	Open in IMG/M
3300015324\|Ga0182134_1140364	Not Available	514	Open in IMG/M
3300015326\|Ga0182166_1107420	Not Available	566	Open in IMG/M
3300015327\|Ga0182114_1084484	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	656	Open in IMG/M
3300015327\|Ga0182114_1155547	Not Available	511	Open in IMG/M
3300015328\|Ga0182153_1025574	Not Available	947	Open in IMG/M
3300015328\|Ga0182153_1152348	Not Available	504	Open in IMG/M
3300015329\|Ga0182135_1089235	Not Available	626	Open in IMG/M
3300015329\|Ga0182135_1089972	Not Available	624	Open in IMG/M
3300015330\|Ga0182152_1076711	Not Available	663	Open in IMG/M
3300015330\|Ga0182152_1098579	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	603	Open in IMG/M
3300015330\|Ga0182152_1156593	Not Available	500	Open in IMG/M
3300015332\|Ga0182117_1042239	Not Available	875	Open in IMG/M
3300015333\|Ga0182147_1047692	Not Available	823	Open in IMG/M
3300015333\|Ga0182147_1075607	Not Available	697	Open in IMG/M
3300015333\|Ga0182147_1138084	Not Available	548	Open in IMG/M
3300015333\|Ga0182147_1150474	Not Available	529	Open in IMG/M
3300015334\|Ga0182132_1058713	Not Available	767	Open in IMG/M
3300015334\|Ga0182132_1062803	Not Available	749	Open in IMG/M
3300015335\|Ga0182116_1152467	Not Available	542	Open in IMG/M
3300015335\|Ga0182116_1176958	Not Available	504	Open in IMG/M
3300015336\|Ga0182150_1081559	Not Available	667	Open in IMG/M
3300015336\|Ga0182150_1149042	Not Available	526	Open in IMG/M
3300015336\|Ga0182150_1150687	Not Available	524	Open in IMG/M
3300015337\|Ga0182151_1049995	Not Available	795	Open in IMG/M
3300015337\|Ga0182151_1068928	Not Available	710	Open in IMG/M
3300015337\|Ga0182151_1147865	Not Available	528	Open in IMG/M
3300015338\|Ga0182137_1157631	Not Available	531	Open in IMG/M
3300015338\|Ga0182137_1161772	Not Available	525	Open in IMG/M
3300015339\|Ga0182149_1079017	Not Available	694	Open in IMG/M
3300015339\|Ga0182149_1159316	Not Available	522	Open in IMG/M
3300015340\|Ga0182133_1124421	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	608	Open in IMG/M
3300015348\|Ga0182115_1200007	Not Available	640	Open in IMG/M
3300015348\|Ga0182115_1214737	Not Available	615	Open in IMG/M
3300015348\|Ga0182115_1224916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	599	Open in IMG/M
3300015349\|Ga0182185_1091880	Not Available	863	Open in IMG/M
3300015349\|Ga0182185_1120137	Not Available	767	Open in IMG/M
3300015349\|Ga0182185_1123485	Not Available	758	Open in IMG/M
3300015349\|Ga0182185_1146999	Not Available	700	Open in IMG/M
3300015349\|Ga0182185_1180227	Not Available	636	Open in IMG/M
3300015349\|Ga0182185_1220798	Not Available	575	Open in IMG/M
3300015349\|Ga0182185_1236679	Not Available	555	Open in IMG/M
3300015350\|Ga0182163_1038297	Not Available	1303	Open in IMG/M
3300015352\|Ga0182169_1158695	Not Available	739	Open in IMG/M
3300015352\|Ga0182169_1223478	Not Available	614	Open in IMG/M
3300015353\|Ga0182179_1142057	Not Available	744	Open in IMG/M
3300015353\|Ga0182179_1187162	Not Available	656	Open in IMG/M
3300015353\|Ga0182179_1194792	Not Available	644	Open in IMG/M
3300015353\|Ga0182179_1257033	Not Available	564	Open in IMG/M
3300015354\|Ga0182167_1076471	Not Available	1199	Open in IMG/M
3300015354\|Ga0182167_1164322	Not Available	818	Open in IMG/M
3300015354\|Ga0182167_1186891	Not Available	760	Open in IMG/M
3300015354\|Ga0182167_1241616	Not Available	653	Open in IMG/M
3300015354\|Ga0182167_1248170	Not Available	642	Open in IMG/M
3300015354\|Ga0182167_1286956	Not Available	587	Open in IMG/M
3300017412\|Ga0182199_1073623	Not Available	744	Open in IMG/M
3300017412\|Ga0182199_1116199	Not Available	629	Open in IMG/M
3300017412\|Ga0182199_1129202	Not Available	604	Open in IMG/M
3300017412\|Ga0182199_1169063	Not Available	543	Open in IMG/M
3300017412\|Ga0182199_1189286	Not Available	519	Open in IMG/M
3300017422\|Ga0182201_1004086	Not Available	1575	Open in IMG/M
3300017422\|Ga0182201_1060915	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	677	Open in IMG/M
3300017422\|Ga0182201_1136740	Not Available	513	Open in IMG/M
3300017432\|Ga0182196_1064261	Not Available	684	Open in IMG/M
3300017432\|Ga0182196_1073935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	652	Open in IMG/M
3300017435\|Ga0182194_1081279	Not Available	639	Open in IMG/M
3300017435\|Ga0182194_1106421	Not Available	579	Open in IMG/M
3300017435\|Ga0182194_1156148	Not Available	501	Open in IMG/M
3300017445\|Ga0182198_1055767	Not Available	815	Open in IMG/M
3300017445\|Ga0182198_1084912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	703	Open in IMG/M
3300017445\|Ga0182198_1128500	Not Available	602	Open in IMG/M
3300017445\|Ga0182198_1176397	Not Available	532	Open in IMG/M
3300017447\|Ga0182215_1170492	Not Available	507	Open in IMG/M
3300017691\|Ga0182212_1145348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	540	Open in IMG/M
3300017693\|Ga0182216_1017152	Not Available	1293	Open in IMG/M
3300028050\|Ga0268328_1042770	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	609	Open in IMG/M
3300028061\|Ga0268314_1019449	Not Available	721	Open in IMG/M
3300028063\|Ga0268350_1063035	Not Available	534	Open in IMG/M
3300028152\|Ga0268336_1016030	Not Available	618	Open in IMG/M
3300028152\|Ga0268336_1029125	Not Available	514	Open in IMG/M
3300028153\|Ga0268320_1016805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	602	Open in IMG/M
3300028153\|Ga0268320_1026150	Not Available	527	Open in IMG/M
3300028381\|Ga0268264_11186328	Not Available	773	Open in IMG/M
3300028475\|Ga0268327_1027316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	505	Open in IMG/M
3300028477\|Ga0268309_1009495	Not Available	639	Open in IMG/M
3300032465\|Ga0214493_1060266	Not Available	901	Open in IMG/M
3300032465\|Ga0214493_1074161	Not Available	810	Open in IMG/M
3300032467\|Ga0214488_1115829	Not Available	573	Open in IMG/M
3300032468\|Ga0214482_1033645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	977	Open in IMG/M
3300032469\|Ga0214491_1093682	Not Available	723	Open in IMG/M
3300032469\|Ga0214491_1153738	Not Available	535	Open in IMG/M
3300032502\|Ga0214490_1068119	Not Available	814	Open in IMG/M
3300032502\|Ga0214490_1160232	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	506	Open in IMG/M
3300032589\|Ga0214500_1077485	Not Available	937	Open in IMG/M
3300032591\|Ga0214484_1054438	Not Available	846	Open in IMG/M
3300032698\|Ga0214485_1059290	Not Available	735	Open in IMG/M
3300032698\|Ga0214485_1087594	Not Available	589	Open in IMG/M
3300032698\|Ga0214485_1113295	Not Available	502	Open in IMG/M
3300032699\|Ga0214494_1066578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	689	Open in IMG/M
3300032699\|Ga0214494_1084684	Not Available	599	Open in IMG/M
3300032758\|Ga0314746_1077652	Not Available	771	Open in IMG/M
3300032758\|Ga0314746_1135071	Not Available	554	Open in IMG/M
3300032761\|Ga0314733_1043996	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	853	Open in IMG/M
3300032791\|Ga0314748_1011937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1617	Open in IMG/M
3300032823\|Ga0314723_1075211	Not Available	639	Open in IMG/M
3300032824\|Ga0314735_1064453	Not Available	692	Open in IMG/M
3300032844\|Ga0314743_1001325	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	3520	Open in IMG/M
3300032844\|Ga0314743_1108841	Not Available	632	Open in IMG/M
3300032875\|Ga0314737_1039895	Not Available	817	Open in IMG/M
3300032915\|Ga0314749_1012240	Not Available	1618	Open in IMG/M
3300032934\|Ga0314741_1098081	Not Available	677	Open in IMG/M
3300032934\|Ga0314741_1156867	Not Available	506	Open in IMG/M
3300032959\|Ga0314738_1066813	Not Available	646	Open in IMG/M
3300033523\|Ga0314768_1147041	Not Available	828	Open in IMG/M
3300033523\|Ga0314768_1231060	Not Available	648	Open in IMG/M
3300033526\|Ga0314761_1081527	Not Available	719	Open in IMG/M
3300033526\|Ga0314761_1088132	Not Available	690	Open in IMG/M
3300033534\|Ga0314757_1086932	Not Available	753	Open in IMG/M
3300033534\|Ga0314757_1108081	Not Available	671	Open in IMG/M
3300033534\|Ga0314757_1180732	Not Available	505	Open in IMG/M
3300033542\|Ga0314769_1219832	Not Available	638	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.71%
Environmental	Environmental	2.29%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.71%
Terrestrial	Environmental → Terrestrial	2.29%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.29%
Unclassified	Host-Associated → Plants → Unclassified	9.71%
Soil	Environmental → Terrestrial → Soil	2.29%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.14%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.29%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	9.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.14%
Loam	Environmental → Terrestrial → Soil → Loam	0.57%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.29%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	9.71%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.14%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	81.14%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	9.71%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.14%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.14%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032468	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032589	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032698	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032791	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032875	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032959	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033542	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070668_1018430802	3300005347	Switchgrass Rhizosphere	INTLKCVLRTNDMITKILDGLEMFLGMSVMFLNFNNYKMAGGWHIYSPPSQENR*
Ga0070708_1018944932	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MITKLLDGLEMFLGVGVMFLNSSKLQMAGETHIYRPPNG*
Ga0068860_1024419081	3300005843	Switchgrass Rhizosphere	MITKLLDGLEMFLGVSVMFLNSSNLQMTGGWHIYSPPSP*
Ga0105137_1059491	3300009972	Switchgrass Associated	MTKDMITKLLDGLEVFLDVGVMPLNSSNLDMAGGWHIYSPPSRTSR*
Ga0105129_1029731	3300009975	Switchgrass Associated	MITKLLDVLEMFLGVGVMFLNSSILEMPGGTHIYS
Ga0105128_1177772	3300009976	Switchgrass Associated	MNTKLLDGLEWFFGVYVTSLNSNNLQMAGGCHIYR
Ga0105128_1207221	3300009976	Switchgrass Associated	YEVVLKTKDMITNLLDGLEVFLDVGVMCLNSNNLEMPGGWHIYSPPSP*
Ga0105135_1037001	3300009980	Switchgrass Associated	MTKDMITKLLDGLEMFLGMGVMFLNSSNVEMPGGYHIYSLPSP*
Ga0105135_1086802	3300009980	Switchgrass Associated	SQGVLRAKDMNTKLLDGLEMFLGVFVTFLNSSKLQMAGGCHIYSQPSP*
Ga0105135_1108521	3300009980	Switchgrass Associated	MITKLLDGLEVFLDVGVMSLNSNNLEMPGETHIYRPPSP*
Ga0105133_1030451	3300009981	Switchgrass Associated	PSTNTLKCVLRTKDMITKHLDSLEMFLGVGVMFLNSINLQMAGGWHIYRTPSP*
Ga0105133_1204981	3300009981	Switchgrass Associated	PSTNTLKCVLRTKDMINKHLDGLEMFLGVFEACSNSGNLEMPGGWHIYSPPSP*
Ga0105132_1170361	3300009990	Switchgrass Associated	PSTNTLKGVLRTKDMITKLLDGLEMFLGVGVMFLNSSNLQMPGG*
Ga0105132_1243481	3300009990	Switchgrass Associated	MINKHLDGLEIFLGVFEPCSNSNNLQMIGGCHIYVYIY
Ga0105120_10113211	3300009992	Switchgrass Associated	VLRTKDLITKLLDGLEVFLGVCLMTWNSSKLQVAGETHIYRPPS*
Ga0105120_10132991	3300009992	Switchgrass Associated	TLKCVLRTKDMINKHLDGLEMFLGVGVMFLNSSKLQMIGGWHIYRPPRP*
Ga0105120_10282341	3300009992	Switchgrass Associated	IYTQHSQSVLRTKGMNTKLLDGLEMFLGVGVMFLNSSKLQMAGG*
Ga0105139_10229761	3300009995	Switchgrass Associated	DMITKLLDGLEVFLNVGVMSLNSSNLEMPGGWHIYSPPSP*
Ga0105139_10247081	3300009995	Switchgrass Associated	HHKGTNTLKCVLRTKDMINKHLDGLEIFLGVGVMFLNSSNLQMPGGWHIYSPPSS*
Ga0105139_11005801	3300009995	Switchgrass Associated	NTHKVVLRTKDLITMLLDGLEMFLGVSVTSRNSSKLQMTGGWHIYRPPR*
Ga0134125_118119481	3300010371	Terrestrial Soil	MMTKLLDGLEVFLDVVVMSLTSSNLEMPEGWHIYSPSSP*
Ga0134125_130157481	3300010371	Terrestrial Soil	MITKLLDGLEMFLGVGVMFLNSSSLEMPAGTHIYMPPS*
Ga0134121_108840851	3300010401	Terrestrial Soil	DMINKHLDGLEMFLSVFEVCSNSSNLQMTGGSHIYRPPSP*
Ga0182183_10450291	3300015270	Switchgrass Phyllosphere	INKHLDGLEMFLGVFEGCSNTSNLQMIGGSQIYRPSRP*
Ga0182101_10654271	3300015284	Switchgrass Phyllosphere	RTKDMITKILDGLEVFLGVNVTSRKSSNLQMPEGWHIYSPPSP*
Ga0182101_10836231	3300015284	Switchgrass Phyllosphere	STNTLKCVLRTKDVINKNLDGLEMFLGVFEACSNSSNLQMAGGWHIYRPPSP*
Ga0182105_10118643	3300015290	Switchgrass Phyllosphere	KDMSAKLLDGLEIFLGMFVTSLNSSKLQMAGGWYIYRPRSE*
Ga0182103_10489601	3300015293	Switchgrass Phyllosphere	STNTLKDVLRTKDMITKLLDGLEMFLNVGMMSLNSSNLEMPRGTHIYSPPSP*
Ga0182104_10509741	3300015297	Switchgrass Phyllosphere	TQHSQSVMRAKDKSAKLLDGLEMFLGVFMTSLNSSKLQMAGGWHIYRLVSP*
Ga0182104_10810362	3300015297	Switchgrass Phyllosphere	LRAKYMSAKLLDGLEMFLGVFVTSLNSSKLQMAKRWHIYRPPSE*
Ga0182162_10487611	3300015310	Switchgrass Phyllosphere	LAVNTDKPSTNTLKYVLRNKDMITKLLDGLEMFLGVGVMILNSSNSKMAGGWHIYSPPS*
Ga0182162_10971111	3300015310	Switchgrass Phyllosphere	MITKLLDGLEMFLDVGVMFLNSSNFQMTRGWHIYRPPREESRWGFPA
Ga0182162_11096391	3300015310	Switchgrass Phyllosphere	MITKLLDGLEIFLGVGVIFLNSSNLQIAGGTHIYRPPSG
Ga0182182_10979011	3300015311	Switchgrass Phyllosphere	LTLKNVLRTKDMITMLLDGLEMFLGVGVMFLNSSNLQMPGGTHIYRPPSP*
Ga0182182_11026351	3300015311	Switchgrass Phyllosphere	LNTLKYVLRTKNMITKLLDGLEMFLGVFKTYSNSNNLQMTGRSHIYRSPSP*
Ga0182168_11048201	3300015312	Switchgrass Phyllosphere	DGLEVFLDEGVMSLNSSNLQMAGRWHIYRPSSQESCY*
Ga0182168_11365641	3300015312	Switchgrass Phyllosphere	MNTKLLDGLKMFLGVCVMSLNSSKLQMSGGWHIYRPPS
Ga0182164_10519101	3300015313	Switchgrass Phyllosphere	PSTNTLKCVLRTKDMINKHLDGMEMFLGVFEACSNSNNLEMPEGWHIYSQPSP*
Ga0182164_10731551	3300015313	Switchgrass Phyllosphere	RTKDMNTKLLDDLEMFLGVGVMSLNSSKIQMTGGTHIYRPPSE*
Ga0182120_10578282	3300015315	Switchgrass Phyllosphere	AKDMNTKLLGDLEMFLGVFVTSLNSSNLQMAGGWYI*
Ga0182120_11357691	3300015315	Switchgrass Phyllosphere	VVPKLLDGLEVFLDVGVMFLNSSNLEKSGETHIYRPPSRE
Ga0182121_11157502	3300015316	Switchgrass Phyllosphere	MITKLLDGLEMFLGVFETCSNSSNLQMTGRSHIYRP
Ga0182181_10232791	3300015318	Switchgrass Phyllosphere	PITNTLKCVLRTKDVITKLLNGLEMFLSVGVMSWNSSKRQMAGGRHIYRTPSP*
Ga0182181_10532491	3300015318	Switchgrass Phyllosphere	STKAQGLANSLSKKLTFHNTLKSVLKTKDMNTKLLDGLEMFLGVGVMSLNSSNLEMPGGCHVYSPPSP*
Ga0182181_10597081	3300015318	Switchgrass Phyllosphere	HSQSVQRAKDMITKLMDGLELILSVYVTFLDSSKLPLAGGCHIYRPHT*
Ga0182130_10493882	3300015319	Switchgrass Phyllosphere	KDMITKLLNGLEMFLDVGVMFLNSSNLEMPGGWHI*
Ga0182130_10527782	3300015319	Switchgrass Phyllosphere	VLRTKDMNTKLLDGLEIFLGVFETCSNFSNLEMHGRWHIYSPPSP*
Ga0182130_10762591	3300015319	Switchgrass Phyllosphere	MLRAKDMITKLLDGLEMFLGVGVMFLNSSNSKMTGGSHVYR
Ga0182130_11044761	3300015319	Switchgrass Phyllosphere	TLKYVLRTKDIINKHLDGLEMFLGVFEACSNSSNLEMPGEWHIYSPQSP*
Ga0182165_10609781	3300015320	Switchgrass Phyllosphere	RTKDMINKHLDGLEMFLGVFEACSNSSKFQMAGGSHIYRPPSP*
Ga0182134_10492682	3300015324	Switchgrass Phyllosphere	NTLKCVLRTKDMITKLLDGLEMFLGVGVMFLNSSNLQMPGGWHIYSPPSP*
Ga0182134_11403641	3300015324	Switchgrass Phyllosphere	DMITKLLDGLEMFLGVGVMFLNSSKLQMTGGSHIYRPPSP*
Ga0182166_11074201	3300015326	Switchgrass Phyllosphere	VLRTKDMITKLLDGLEMFLGVGVMFLNSSNLQMPGGTHIYRPPSP*
Ga0182114_10844841	3300015327	Switchgrass Phyllosphere	MFNKHLNVLEMFLGVFEACSNSSNLQMTGGWHIYRPP
Ga0182114_11555471	3300015327	Switchgrass Phyllosphere	NTLKCVLRTKDMINKHLDGLEMFLGVGVMFLNSSKLQMTRGWHIYRPLRP*
Ga0182153_10255741	3300015328	Switchgrass Phyllosphere	VLRTKNLITKLLNGLEMFLSVGVMSWNSSKRQMAGGRHIYRTPSP*
Ga0182153_11523481	3300015328	Switchgrass Phyllosphere	LRTKDMINKNLDGLEMFLGVFEACSNSSKFQMTGGTHIYRPPRP*
Ga0182135_10892351	3300015329	Switchgrass Phyllosphere	SQSVLRAKDMNNKHLDGLEMFLRVFEACSNSSKLQMTRGHIYRPPSE*
Ga0182135_10899721	3300015329	Switchgrass Phyllosphere	LIRTKDMITKLLDGLEMFLNVCGTSSNSIKLQMAGGWHIYRPPS*
Ga0182152_10767112	3300015330	Switchgrass Phyllosphere	MITKLLDGLEVFLDVGVMSLNSSNLEMPGGTHIYRPPSP*
Ga0182152_10985791	3300015330	Switchgrass Phyllosphere	MITKILDGLEMFLGMSVMFLNFNNYKMAGGWHIYSPPSQENR*
Ga0182152_11565931	3300015330	Switchgrass Phyllosphere	KNVLRAKDMITKLLDGLEMFLGVGVMFLNSSNSKMAGG*
Ga0182117_10422391	3300015332	Switchgrass Phyllosphere	TKDMSAKLLDGLEMFLGVFVTSLNSSKLQMARRWHIYRPPSE*
Ga0182147_10476921	3300015333	Switchgrass Phyllosphere	LRTKDMNTKLLDGLEMFLGVCVMFLNSSNSKMAGGSHIYRPPSR*
Ga0182147_10756071	3300015333	Switchgrass Phyllosphere	HNTLKCVLRTKDMITKLLDGLEMFLGVVVLFLNSSNLEMPGGWYIYSPSSPWSRY*
Ga0182147_10783391	3300015333	Switchgrass Phyllosphere	TNTLKDVLRTKDLITKLLDGLEVFLGVCVMSWNSSKLQMAGGTHIYRPPT*
Ga0182147_11380842	3300015333	Switchgrass Phyllosphere	VLRAKDMITKLLDGLEMFLGVGVMFLNSSNSKMAGGWHIYRPPSEESR*
Ga0182147_11504741	3300015333	Switchgrass Phyllosphere	MITKLLDDLEVFLDVGVMSLNSSNLEMPGGTHIYRPPNP
Ga0182132_10567451	3300015334	Switchgrass Phyllosphere	FTQHSQSVLRAKDMSAKLLDGLEMFLGVFVTSLNSSNLQMAGGWHTYRPPS*
Ga0182132_10587131	3300015334	Switchgrass Phyllosphere	HSQGCAKDYKDMITKLLDGLEVFLDVGVMSLNSSNLYMAGGWHIYSPPSP*
Ga0182132_10628032	3300015334	Switchgrass Phyllosphere	DMSAKLLDDLEMLLGVFVTFLNSSYFQMARGWHIYKPPSE*
Ga0182116_11524671	3300015335	Switchgrass Phyllosphere	MITKLLDGLEMFLGVGVMFLNSSNSKMAGGWHIYRPPSEESR*
Ga0182116_11769581	3300015335	Switchgrass Phyllosphere	KLLDGLEMFLDVGVMFLNSSKLQMAGGTHIYRPPSE*
Ga0182150_10815592	3300015336	Switchgrass Phyllosphere	VLRAKDMNTKLLDGLEMFLGVGVMSLNSSNSEMARGTHIYRPPSE*
Ga0182150_11490421	3300015336	Switchgrass Phyllosphere	KDMITRILDGLEVFLDVGVMSLNSSNLQMIEGWHIYRTPSP*
Ga0182150_11506871	3300015336	Switchgrass Phyllosphere	SKELTFHNTLKSVLRTKDMIIKLLDGLEMFLDVVVMFLNSSNLQMTGGWHIYSPPRP*
Ga0182151_10499951	3300015337	Switchgrass Phyllosphere	KDMTTKLLDGLEVFLDVYGMSLNSSKLQMARGWHIYRPPC*
Ga0182151_10689282	3300015337	Switchgrass Phyllosphere	NTLKNVLRAKDMITMLLDGLEMFLGVGVMFLSSSNLEMPGGWHIYSPPSPWSH*
Ga0182151_11478651	3300015337	Switchgrass Phyllosphere	KDVLWTKDMTTKLLDGLEVFLDVYGVSLNSSKLQMAERWHIYRPPS*
Ga0182137_11576311	3300015338	Switchgrass Phyllosphere	MITKLLDGLEVFLDVGVMSLNSSNLEMPGGWHVYSPPSQ*
Ga0182137_11617721	3300015338	Switchgrass Phyllosphere	SQSVLRAKDMSAKLLDGLEMFLGVFVTSLNSNNLQMAGGWYI*
Ga0182149_10790171	3300015339	Switchgrass Phyllosphere	VLRAKDMNTKLLDVLEWFLGVYVTFLDSSKLQMAGVRRIYRPQVL*
Ga0182149_11593161	3300015339	Switchgrass Phyllosphere	MITKLLDVLEMFLGVGVMSLNSSNLEMHEGWHIYSPPSP*
Ga0182133_11244211	3300015340	Switchgrass Phyllosphere	LKNVLRTKDMNTKLLDGLEMFLGVGVMSLNSSKLQMTGETHIYRPPSE*
Ga0182115_12000072	3300015348	Switchgrass Phyllosphere	LLDGLEVFLDVGVMSLNSSNLEMPREWHIYSPPSPKSRL*
Ga0182115_12147371	3300015348	Switchgrass Phyllosphere	DMITKLLDGLQMFLGVSVMFLNYSNLQMTGGWHIYSPSSP*
Ga0182115_12249161	3300015348	Switchgrass Phyllosphere	MVTKLLDGLEVFLDVVVMSLTSSNLEMPEGGHIYSPP
Ga0182185_10918801	3300015349	Switchgrass Phyllosphere	DMNTELLDSLKMFLGVGVMFLNSSNLQMPGGWHIYSQPSL*
Ga0182185_11201371	3300015349	Switchgrass Phyllosphere	TKLLDGLEVFLGMGVMSWNSSKFQIVGGWHIYSPQI*
Ga0182185_11234851	3300015349	Switchgrass Phyllosphere	TNTLKDVLRTKDMITKLLDGLEMFLDVYGTSSNSSNLQMAGESHIYSLPS*
Ga0182185_11469992	3300015349	Switchgrass Phyllosphere	QNVLRAKDMSAKLLDGLEMFLGVFMTFLNSSKLQMAGGWHIYRPQVELAV*
Ga0182185_11802271	3300015349	Switchgrass Phyllosphere	TLKCVLRTKDMITKLLDGLEVFLDVGVVSLNSSNLEMPGGWHIHSPPTPQSRL*
Ga0182185_12207981	3300015349	Switchgrass Phyllosphere	KCVLRTKDMITKLLDGLEMFLGVGVMFLNSSNLQMPGG*
Ga0182185_12366791	3300015349	Switchgrass Phyllosphere	MTTKLLDGLEVFLDVHGVSLNSSKLQMAGGWHIYRPPS*
Ga0182163_10382971	3300015350	Switchgrass Phyllosphere	ITKLLDGLEVFLDVGVMSLNSSNLEMPGGTHIYRPPSP*
Ga0182169_11586951	3300015352	Switchgrass Phyllosphere	KDLITKLLDGLEVFLGVYGVFLNSSNFKMAGVRHIYRPSNL*
Ga0182169_12234782	3300015352	Switchgrass Phyllosphere	TKDMNIKLFDGLEMFLDVCVKSLNSSKLQMAGGWHIYRPPSE*
Ga0182179_11420571	3300015353	Switchgrass Phyllosphere	VLRTKYVITKLLDGLEVFLGMGVMSWNSSKFQIVGGWHIYSPQI*
Ga0182179_11871621	3300015353	Switchgrass Phyllosphere	LLDGLEMFLGVGVMFLNSSKLQMAGETHIYRPQNG*
Ga0182179_11947922	3300015353	Switchgrass Phyllosphere	TNTHKIVLNTKDMITKLLDGLEVFLDVGVMSLNSSNLEMPGETHIYRTPSS*
Ga0182179_12570331	3300015353	Switchgrass Phyllosphere	TKLLDGLEMFLGVGVMFLNSNNSKMAGGWHIYSPPSP*
Ga0182167_10764711	3300015354	Switchgrass Phyllosphere	MITKLLDGLEVFLDVGVMSLNSSNLEKSGETHIYRPPSRESRY*
Ga0182167_11643221	3300015354	Switchgrass Phyllosphere	TLKDVLRTKYVITKLLDGLEVFLGMGVMSWNSSKFQIVGGWHIYSPQI*
Ga0182167_11868912	3300015354	Switchgrass Phyllosphere	LRTKDMINKYLDGLEIFLGVFEACSKSSKLQMTGGWHIYRPPST*
Ga0182167_12416161	3300015354	Switchgrass Phyllosphere	SSTQHSQSVLRAKDMSAKFLNGLEMFLGVFVTSLNSSKL*
Ga0182167_12481701	3300015354	Switchgrass Phyllosphere	MITKLVDGLEMFLGVGVVFLNSSNLEMPGEWHIYSPPSP*
Ga0182167_12869561	3300015354	Switchgrass Phyllosphere	LKCVLRTKYIITNLLDGLEMFLGVGVMFLNSSSLEMPAGTHIYRPPS*
Ga0182199_10736231	3300017412	Switchgrass Phyllosphere	TNTLKCVLRTKNMINKHLDGLEMFLGVFEACSNSSKLQMTGRTHIYRPPRP
Ga0182199_11161991	3300017412	Switchgrass Phyllosphere	MITKLLDDLEVFLNVGVMSLNSSNLEMPGGTYIYMPPSP
Ga0182199_11292021	3300017412	Switchgrass Phyllosphere	MITKILDGLEMFLGMSVMFLNFNNYKMAGGWHIYSPPSQENR
Ga0182199_11690631	3300017412	Switchgrass Phyllosphere	KDMSAKLLDGLEMFLGVFVSSLNYSKLQMAGGWHIYRPPSP
Ga0182199_11892861	3300017412	Switchgrass Phyllosphere	TNTLLCALRIKDMITEHLDGLEMFLGVGVMFLNSSNLQMAGRWHIYRPPSPLSR
Ga0182201_10040861	3300017422	Switchgrass Phyllosphere	TLKCVLRTKDMINKHLDGLEMFLGVFEACSNSSNLQMTWGSHIYRPTRP
Ga0182201_10609151	3300017422	Switchgrass Phyllosphere	MITKLLDGLEIFMGVGVMFLSSSNLEMPGGWLICSPPSP
Ga0182201_11367401	3300017422	Switchgrass Phyllosphere	HLDGLEMFLGVFEACSNSSNLEMPGGWHIYSPPSP
Ga0182196_10642611	3300017432	Switchgrass Phyllosphere	TKDMITELLDGLELFLGVGVMFLNSNNLKMPGGTYIYRLPSP
Ga0182196_10739351	3300017432	Switchgrass Phyllosphere	MSAKLLDDLEMLLGVFVTFLNSNYFQMAGGCHIYRPPSRS
Ga0182194_10812791	3300017435	Switchgrass Phyllosphere	MINKHLDGLEMFLGVFEACSNYSNLEIPGGWHIYSPPSP
Ga0182194_11064211	3300017435	Switchgrass Phyllosphere	AKDMITKLLDILEMFLDVGVMFLNSSNSKMTGGSHIYRLPSP
Ga0182194_11561481	3300017435	Switchgrass Phyllosphere	MITKLFDGLEMFLGVGVMFLNSSKLQMAGGTHIYRPPS
Ga0182198_10557671	3300017445	Switchgrass Phyllosphere	STNTLKNVLRAKDMITKLLDGLEMFLGVGVMFLNSSKLQMTGGSHIYRPPSP
Ga0182198_10849121	3300017445	Switchgrass Phyllosphere	MINKHLDGLEMFLGVFEACSNSSNLQMTGETHIYRP
Ga0182198_11285001	3300017445	Switchgrass Phyllosphere	TNTLKDVLRTKDTITKLLDGLEMFLGVGVMFQNSNKLQMPGGWHMYRPSTQVSHY
Ga0182198_11763971	3300017445	Switchgrass Phyllosphere	NTLKSVLRTKDMITNLLDGLEMFLDVLVMFLNSSNLQMTGGWHIYRPPRP
Ga0182215_11704921	3300017447	Switchgrass Phyllosphere	KCVLRAKDMINKHLDGLEIFLGVFETCSNSSKLQMVGGWHIYRPPREESRWGFPA
Ga0182212_11453481	3300017691	Switchgrass Phyllosphere	MINKHLNGLGMFLGVFKACSNSSNLKIPGGWHIYS
Ga0182216_10171521	3300017693	Switchgrass Phyllosphere	ANLAQNTLKNVLRAKDMITKLLDGLEMFLGVGVMFLNSSNLQMAGG
Ga0268328_10427701	3300028050	Phyllosphere	MITKLLDGLEMFLGVGVMFLNSSNSKMAGGWYIYR
Ga0268314_10194491	3300028061	Phyllosphere	LGAKPSTYTLKYVLRTKDMITKPLHGLEVFLDVYGVFLNSSNLEMPGRTHINMPPSRESR
Ga0268350_10630352	3300028063	Phyllosphere	PSTNSLKDVLRTKDMITKLLDGLEVFLDVGVMSLNSSNLEMPGGWHVYSPPSP
Ga0268336_10160302	3300028152	Phyllosphere	TKLLDGMEMFLGVGVMFLNSSHLQMAGGWHIYKQPSS
Ga0268336_10291251	3300028152	Phyllosphere	ITKLLDGLEVFLDVGVMFLNSNNLEMPGGWHIYSPPSP
Ga0268320_10168051	3300028153	Phyllosphere	MINKHLDDLEMFLGVFEACSNSSNLQMTGGTHIYRPPSGE
Ga0268320_10261501	3300028153	Phyllosphere	MITKLLDGLEMFLGVGVMFLNSSNSKMAGGWHIYRPPSEENRWEP
Ga0268264_111863281	3300028381	Switchgrass Rhizosphere	KNVLRAKDMITKLLDALEMFLGVGMMFLNSSNLQMTGGSHIYSSPSP
Ga0268327_10273161	3300028475	Phyllosphere	MINKHLNGLQMFFGVFEACSNSSNLQMAGTWHIYRPPSGES
Ga0268309_10094951	3300028477	Phyllosphere	MINKHLNSLEMFLGVFEACSNSSNLQMAGEVHIYMP
Ga0214493_10602661	3300032465	Switchgrass Phyllosphere	TKDMITKFLDGLEMFLGVGVMFLNSSNLEILGGWHIYSPPSPYSRL
Ga0214493_10741611	3300032465	Switchgrass Phyllosphere	MITKLLDGLEMFLGVGVMFLNSSNFQMTGGWHIYRPPSEESRWGLPA
Ga0214488_11158291	3300032467	Switchgrass Phyllosphere	KKLTFHNTLKSVLKTKDMNTKLLDGLEMFLGVGVMFLNSSKLQMTGGLHIYRPPRP
Ga0214482_10336451	3300032468	Switchgrass Phyllosphere	MNTKLLDDLEMFLGVGVMSLNSSKLQMTEGTHIYRPPSE
Ga0214491_10936821	3300032469	Switchgrass Phyllosphere	NKHLDGLEMFLGVFETCSNSSKLQMTGEVHIYRPPSS
Ga0214491_11537381	3300032469	Switchgrass Phyllosphere	VLRAKDMITKLLDGLEMFLGVGVMFLNSSNLQMTGGWHIYRPPSE
Ga0214490_10681192	3300032502	Switchgrass Phyllosphere	STNTLKCVLRAKDFINKHFDGLEMFLGVFESCSNSGKLQMAGEIHIYRPPSL
Ga0214490_11602321	3300032502	Switchgrass Phyllosphere	LITKLLDGLEVFLGVGVMSWNSSKLQMTRGTHIYSPP
Ga0214500_10774851	3300032589	Switchgrass Phyllosphere	KDMITKLLDGLEIFLGVGVMFLNSRNSKMAEGWHIYSPPSP
Ga0214484_10544382	3300032591	Switchgrass Phyllosphere	KDMINKHLDGLEMFLGVFETCSNSSKLQMTGEVHIYRPPSS
Ga0214485_10592902	3300032698	Switchgrass Phyllosphere	NTLKCVLRAKDMINKHLDGLEIFLGVFESCSNSGKLQMAGEIHIYRPPSL
Ga0214485_10875942	3300032698	Switchgrass Phyllosphere	VLRTKDMITKHMEGLEMFLGVGVMFLNSSNSKMAGGWHIYSPPSPYSHL
Ga0214485_11132951	3300032698	Switchgrass Phyllosphere	MITKFLDGLEMFLGVGVMFLNSSNLEMPGGWHIYSPPSPYS
Ga0214494_10665781	3300032699	Switchgrass Phyllosphere	MITKLLDGLEMFLGVGVMFLNSSNFQMTGGWHIYRPPSEESR
Ga0214494_10846841	3300032699	Switchgrass Phyllosphere	LRAKDMITKLLDALEMFLGVGVMFLNSSNLQMTGGWHIYRPPSEESL
Ga0314746_10694741	3300032758	Switchgrass Phyllosphere	SLELLDGLEVFLGVGVMSWNSSKLQMTRGTHIYSPPS
Ga0314746_10776521	3300032758	Switchgrass Phyllosphere	DVLRTKDMMTKLLDGLEVFLDVGVMFLNSGNLEMPEGWHIYSPPSP
Ga0314746_11350711	3300032758	Switchgrass Phyllosphere	NTLKGVLRTKDMITKFLDGLEMFLGVGVMFLNSSNFQMTGEWHIYRSPSEESR
Ga0314733_10439961	3300032761	Switchgrass Phyllosphere	AKDMITKLLDGLEMFLSVGVMFLNSSNLQMPGGTHIY
Ga0314748_10119371	3300032791	Switchgrass Phyllosphere	DALEMFLGVGVMFLNSSNLQMTGGWHIYRPPSEESL
Ga0314744_10689022	3300032792	Switchgrass Phyllosphere	GGLEVFLGVGVMSYNSSTLQMAGVRRIYKPPTQSSH
Ga0314723_10752112	3300032823	Switchgrass Phyllosphere	KTKLLDGLEMFLGVCVMFLNSSNSKMAGGSHIYRPPSR
Ga0314735_10644531	3300032824	Switchgrass Phyllosphere	STNTLKCVLRAKDMINKHLDGLEMFLGVFETCSNSSKLEMTGKVHIYRPPSS
Ga0314743_10013256	3300032844	Switchgrass Phyllosphere	ITKLLDGLEMFLGVGVMFLNSSNLQMAGGWHIYRPPSP
Ga0314743_11088411	3300032844	Switchgrass Phyllosphere	MITKLLDDLEVFLDVGVMSLNSSNLEMPGGWHIYSPPR
Ga0314737_10398951	3300032875	Switchgrass Phyllosphere	NTLKDVLRTKDMMTKLLDGLEVFLDVGVMFLNSGNLEMPEGWHIYSPSSP
Ga0314749_10122401	3300032915	Switchgrass Phyllosphere	PSTKHSQGYALRTKYMITKYLDGLEMFKDVCGTSSNSRNLEMAGVTHIYSPPS
Ga0314741_10980812	3300032934	Switchgrass Phyllosphere	LKCVLRTKDMINKHLDGLEIFLGVFEAYSNSSNLQMTGGTHIYRPPRP
Ga0314741_11568671	3300032934	Switchgrass Phyllosphere	RTKDMITKLLDRLEIFLGVGVVFLNSSNSKMAGGCHIYSPPSP
Ga0314738_10668131	3300032959	Switchgrass Phyllosphere	LKYVLRTKDMINKHLDGLEMFLSVFEACSNSSNLEMPKGWHIYSPPSP
Ga0314768_11470412	3300033523	Switchgrass Phyllosphere	MITKFLDGLEMFLGVGVMFLNSSNFQMTGGWHIYRPPSEESRWGFPA
Ga0314768_12310601	3300033523	Switchgrass Phyllosphere	LRTKDMINKHLDGLEIFLGVFEAYSNSSNLQMTGGTHIYRPPRP
Ga0314761_10815272	3300033526	Switchgrass Phyllosphere	NKHLDGLEMFLGVFETCSNSSKHQMTGKVHIYRPASS
Ga0314761_10881321	3300033526	Switchgrass Phyllosphere	LITKLLDDLEVFLDVYKTSRNSSKLEMVGVRRIYSPKSWSRCSNG
Ga0314757_10869321	3300033534	Switchgrass Phyllosphere	LKCVLRTKDMINKHMDSLEIILGVFETCSNSSKLEMTGKVHIYRPPSS
Ga0314757_11080811	3300033534	Switchgrass Phyllosphere	MINKHLDGLEMFLGVFETCGNSSNLEMLGGWHIYSPPS
Ga0314757_11807321	3300033534	Switchgrass Phyllosphere	DMITKLLDGLEVFLDVGVMSLNSSNLEMPGGTHIYRPPSP
Ga0314769_12198321	3300033542	Switchgrass Phyllosphere	VLRTKDMITKLLDDLEMFLGVGVMFLNSSNLQMAGGWHIYRPPSP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F034018

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences