Basic Information | |
---|---|
Family ID | F034370 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 175 |
Average Sequence Length | 42 residues |
Representative Sequence | ARALFQDNPLAAFEGRPLPHVPEVEDEWPPPRRKRFFFF |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 175 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.57 % |
% of genes near scaffold ends (potentially truncated) | 98.29 % |
% of genes from short scaffolds (< 2000 bps) | 89.71 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.714 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.857 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.93% β-sheet: 0.00% Coil/Unstructured: 85.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 175 Family Scaffolds |
---|---|---|
PF02698 | DUF218 | 64.00 |
PF01370 | Epimerase | 12.57 |
PF16363 | GDP_Man_Dehyd | 4.00 |
PF03721 | UDPG_MGDP_dh_N | 2.29 |
PF02687 | FtsX | 1.14 |
PF03720 | UDPG_MGDP_dh_C | 1.14 |
PF12704 | MacB_PCD | 1.14 |
PF13414 | TPR_11 | 0.57 |
PF07883 | Cupin_2 | 0.57 |
PF00486 | Trans_reg_C | 0.57 |
PF01258 | zf-dskA_traR | 0.57 |
PF01491 | Frataxin_Cyay | 0.57 |
PF00953 | Glycos_transf_4 | 0.57 |
PF01740 | STAS | 0.57 |
PF02350 | Epimerase_2 | 0.57 |
PF01841 | Transglut_core | 0.57 |
PF11412 | DsbC | 0.57 |
COG ID | Name | Functional Category | % Frequency in 175 Family Scaffolds |
---|---|---|---|
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 64.00 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 64.00 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.29 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.29 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 2.29 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 2.29 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 2.29 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.57 |
COG1965 | Fe-S cluster assembly protein CyaY, frataxin homolog | Inorganic ion transport and metabolism [P] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.14 % |
Unclassified | root | N/A | 6.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002916|JGI25389J43894_1048687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300002917|JGI25616J43925_10369322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300004080|Ga0062385_10659448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300004092|Ga0062389_103190476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300004092|Ga0062389_104380566 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300004635|Ga0062388_101776831 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300005166|Ga0066674_10553896 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005167|Ga0066672_10025251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3173 | Open in IMG/M |
3300005167|Ga0066672_10752212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300005176|Ga0066679_11048631 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300005446|Ga0066686_10037629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2878 | Open in IMG/M |
3300005536|Ga0070697_100655801 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300005537|Ga0070730_10568985 | Not Available | 725 | Open in IMG/M |
3300005553|Ga0066695_10420197 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300005554|Ga0066661_10207322 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300005556|Ga0066707_10035883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2786 | Open in IMG/M |
3300005568|Ga0066703_10181456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1273 | Open in IMG/M |
3300005569|Ga0066705_10420419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
3300005591|Ga0070761_11035763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300005602|Ga0070762_10196033 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300005602|Ga0070762_10396654 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005602|Ga0070762_10968372 | Not Available | 582 | Open in IMG/M |
3300005764|Ga0066903_100864301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
3300006031|Ga0066651_10760210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300006163|Ga0070715_10237342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300006174|Ga0075014_100686698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 594 | Open in IMG/M |
3300006804|Ga0079221_10117042 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300006804|Ga0079221_11304100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300006871|Ga0075434_101835136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300006914|Ga0075436_100796947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300006914|Ga0075436_101074816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300007265|Ga0099794_10590561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300009038|Ga0099829_10156893 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
3300009088|Ga0099830_11244945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300009088|Ga0099830_11467040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300009089|Ga0099828_10476518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
3300009090|Ga0099827_10886648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300009137|Ga0066709_100907461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
3300009698|Ga0116216_10327071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300010343|Ga0074044_10606312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300010343|Ga0074044_11029045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300010343|Ga0074044_11046893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300010358|Ga0126370_10338037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
3300010358|Ga0126370_11276691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300010359|Ga0126376_10556358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
3300010360|Ga0126372_12341314 | Not Available | 584 | Open in IMG/M |
3300010379|Ga0136449_103328543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300011269|Ga0137392_10029083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3986 | Open in IMG/M |
3300011269|Ga0137392_11594531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300011270|Ga0137391_10156285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1987 | Open in IMG/M |
3300011271|Ga0137393_11577635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300012096|Ga0137389_10022465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4458 | Open in IMG/M |
3300012096|Ga0137389_10080372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2545 | Open in IMG/M |
3300012096|Ga0137389_10627115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300012202|Ga0137363_10613939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
3300012203|Ga0137399_10301119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1324 | Open in IMG/M |
3300012205|Ga0137362_11144363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300012206|Ga0137380_10001047 | All Organisms → cellular organisms → Bacteria | 21954 | Open in IMG/M |
3300012206|Ga0137380_10640927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
3300012208|Ga0137376_10471440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
3300012209|Ga0137379_10973172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300012356|Ga0137371_10882530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300012363|Ga0137390_10498121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
3300012363|Ga0137390_11062004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300012917|Ga0137395_10235864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1282 | Open in IMG/M |
3300012917|Ga0137395_10678537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300012918|Ga0137396_10806356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300012924|Ga0137413_10643802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300012925|Ga0137419_10090547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2093 | Open in IMG/M |
3300012925|Ga0137419_10952999 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300012925|Ga0137419_11795912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300012972|Ga0134077_10083746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
3300014654|Ga0181525_10132336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1371 | Open in IMG/M |
3300015053|Ga0137405_1264392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1356 | Open in IMG/M |
3300015054|Ga0137420_1363256 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
3300015241|Ga0137418_10098303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2636 | Open in IMG/M |
3300015242|Ga0137412_10615683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300016294|Ga0182041_11716214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300016319|Ga0182033_10333816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
3300016341|Ga0182035_11276842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300016445|Ga0182038_10451244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300017926|Ga0187807_1253812 | Not Available | 577 | Open in IMG/M |
3300017966|Ga0187776_10149288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
3300017999|Ga0187767_10085405 | Not Available | 852 | Open in IMG/M |
3300018012|Ga0187810_10446120 | Not Available | 548 | Open in IMG/M |
3300018433|Ga0066667_11963934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300018468|Ga0066662_10184459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1628 | Open in IMG/M |
3300019882|Ga0193713_1019188 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
3300019888|Ga0193751_1008161 | All Organisms → cellular organisms → Bacteria | 5643 | Open in IMG/M |
3300020199|Ga0179592_10248976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300020579|Ga0210407_10046138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3248 | Open in IMG/M |
3300020579|Ga0210407_10379959 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300020580|Ga0210403_10745442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300020580|Ga0210403_10885589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300020580|Ga0210403_11451471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300020581|Ga0210399_10726840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300020583|Ga0210401_11509022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300021046|Ga0215015_10514276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300021086|Ga0179596_10230712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
3300021086|Ga0179596_10484935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300021168|Ga0210406_10158114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1900 | Open in IMG/M |
3300021168|Ga0210406_10702307 | Not Available | 779 | Open in IMG/M |
3300021170|Ga0210400_10319807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
3300021170|Ga0210400_10373229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
3300021401|Ga0210393_10015197 | All Organisms → cellular organisms → Bacteria | 5954 | Open in IMG/M |
3300021401|Ga0210393_10659952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300021405|Ga0210387_10272546 | Not Available | 1484 | Open in IMG/M |
3300021433|Ga0210391_11348594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300021475|Ga0210392_11110469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300021476|Ga0187846_10450764 | Not Available | 527 | Open in IMG/M |
3300021477|Ga0210398_11467431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300021477|Ga0210398_11505948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300021478|Ga0210402_11484894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300021559|Ga0210409_10998859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300024251|Ga0247679_1057280 | Not Available | 653 | Open in IMG/M |
3300024331|Ga0247668_1019947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
3300025898|Ga0207692_11002773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300025905|Ga0207685_10238560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
3300025929|Ga0207664_10467142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
3300026035|Ga0207703_12257873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300026281|Ga0209863_10027866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 1718 | Open in IMG/M |
3300026333|Ga0209158_1172688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300026359|Ga0257163_1004357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1981 | Open in IMG/M |
3300026530|Ga0209807_1198114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
3300027313|Ga0207780_1051148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
3300027587|Ga0209220_1107222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300027635|Ga0209625_1101123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300027643|Ga0209076_1042006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
3300027671|Ga0209588_1270006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300027678|Ga0209011_1102210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300027698|Ga0209446_1083107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
3300027725|Ga0209178_1176881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300027737|Ga0209038_10138017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300027783|Ga0209448_10040128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
3300027842|Ga0209580_10209271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
3300027853|Ga0209274_10686048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300027857|Ga0209166_10000852 | All Organisms → cellular organisms → Bacteria | 28747 | Open in IMG/M |
3300027862|Ga0209701_10305265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
3300027882|Ga0209590_10601415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300027911|Ga0209698_10481900 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300028023|Ga0265357_1006420 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300028381|Ga0268264_11033290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300028906|Ga0308309_10022359 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
3300029636|Ga0222749_10765484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300029882|Ga0311368_11010039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300030841|Ga0075384_11177253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300030916|Ga0075386_11495210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300030991|Ga0073994_12267141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300030991|Ga0073994_12311596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
3300030991|Ga0073994_12373932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300031057|Ga0170834_100406084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300031128|Ga0170823_17125244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300031715|Ga0307476_11206279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300031720|Ga0307469_12305713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300031740|Ga0307468_100486077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300031753|Ga0307477_11128773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300031819|Ga0318568_10667746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300031831|Ga0318564_10326326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300031896|Ga0318551_10551919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300031896|Ga0318551_10809213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300031897|Ga0318520_10220579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
3300031910|Ga0306923_10407191 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
3300031954|Ga0306926_12346181 | Not Available | 590 | Open in IMG/M |
3300031962|Ga0307479_10233715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1813 | Open in IMG/M |
3300031962|Ga0307479_11021378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
3300031962|Ga0307479_11704078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300032025|Ga0318507_10282793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300032059|Ga0318533_11293818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300032076|Ga0306924_10166907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2524 | Open in IMG/M |
3300032180|Ga0307471_100265304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
3300032205|Ga0307472_101589470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300032805|Ga0335078_10462330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1643 | Open in IMG/M |
3300032892|Ga0335081_10738672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
3300032954|Ga0335083_10519761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.14% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.71% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.14% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.14% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.14% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.14% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.57% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.57% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.57% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030841 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25389J43894_10486872 | 3300002916 | Grasslands Soil | KARALFQDNPLAAFEGRPLPHIPEIEDESPPPRRKRFFFF* |
JGI25616J43925_103693221 | 3300002917 | Grasslands Soil | KFGAEKARALFVENPLAAFEGQPLPHVPEIVEPPPRKKRFFFF* |
Ga0062385_106594481 | 3300004080 | Bog Forest Soil | ARALFLENPMAAFEGRELPHVPQLPDEIDPPRRKRFFFF* |
Ga0062389_1031904762 | 3300004092 | Bog Forest Soil | FGKEKAEALFEENPLAAFEGQELPHVPEIPDESDEPRKKKFFFF* |
Ga0062389_1043805662 | 3300004092 | Bog Forest Soil | FGEEKARALFVENPMAAFEGRDLPHVPEVRDEIEIPRRKRFFFF* |
Ga0062388_1017768312 | 3300004635 | Bog Forest Soil | YDAVEAQFGKEKAEALFKENPLAAFEGQQLPHVPEVLDESNEPRKKRFFFF* |
Ga0066674_105538961 | 3300005166 | Soil | EKARALFHDNPLAAFEGQPLPHVPEIEDALRPRRKRFFFF* |
Ga0066672_100252514 | 3300005167 | Soil | RFGEEKARAPFQENPGAAFEGRELPHIPEVEEVWPSRRKRFFSL* |
Ga0066672_107522121 | 3300005167 | Soil | EEKARSLFVENPGAAFEGRDLPHVPEVEEAVAPQRRKRFFFF* |
Ga0066679_110486312 | 3300005176 | Soil | EKVAHRFGEEKARALFQENPQAAFEGRDLPHIPELPEGAAPRRRKRFFFF* |
Ga0066686_100376291 | 3300005446 | Soil | DRFGQEKARALFQDNPLAAFEGRELPHVPEVEDELPPPRRKRFFFF* |
Ga0070697_1006558011 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HDVVAEQFGDEKARALFFDNPMAAFEGRDLPHVPEIPDDKVSSRRKRFLFF* |
Ga0070730_105689852 | 3300005537 | Surface Soil | VENPLAAFEGRALPYTPEVADERPVKRRKRFFFF* |
Ga0066695_104201971 | 3300005553 | Soil | VVHQFGEEKARALFQDNPLAAFEGRGLPHIPEIEDELPPPRRKRFFFF* |
Ga0066661_102073223 | 3300005554 | Soil | ARALFQDNPLAAFEGRPLPHIPEVEDELPSPRRKRFFFF* |
Ga0066707_100358834 | 3300005556 | Soil | MAQALFVDNPLAAIEGRNLPFVPKVADERPTKPRKRFFFF* |
Ga0066703_101814561 | 3300005568 | Soil | ALFVTNPLAAFEGRPLPHVPEIVEEQAKKKWFLFF* |
Ga0066705_104204191 | 3300005569 | Soil | ALFQDNPLAAFEGRPLPHIPEVEDELPSPRRKRFFFF* |
Ga0070761_110357631 | 3300005591 | Soil | RALFVENPMAAFEGRELPHVPQPPDEIEPPRRKRFFFF* |
Ga0070762_101960333 | 3300005602 | Soil | AVREQFGEEKAQALFVENPMAAFEGRDLPHVPRLPDVFKVPRRKRFFFF* |
Ga0070762_103966541 | 3300005602 | Soil | EENALALFVDNPLAAFEGRELPHVPELRDGIDPPRRKRFFFF* |
Ga0070762_109683721 | 3300005602 | Soil | ALFFDNPMAAFEGRELPHVPEVAPDRKPGQKRKRFWFF* |
Ga0066903_1008643013 | 3300005764 | Tropical Forest Soil | KAEALFVENPLAVLEGRALPHLPEIVEEQAKKKRFLFF* |
Ga0066651_107602102 | 3300006031 | Soil | LFHDNPLAAFEGRPLPHVPEIEDVLPPRRKRFFFF* |
Ga0070715_102373421 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAQALFVDNPLAAFEGRNLPYVPEVADKRPAKPRKRFFFF* |
Ga0075014_1006866982 | 3300006174 | Watersheds | DRFGQEKARALFQDNPLAAFEGRELPHVPELEDETPPPRRKRFFFF* |
Ga0079221_101170421 | 3300006804 | Agricultural Soil | VENPRAAFEGRDLPHVPEVEEPVAQPRRKRFFFF* |
Ga0079221_113041002 | 3300006804 | Agricultural Soil | ALFVENPGAAFEGRDLPHVPEVEEPVAARRRKRFFFF* |
Ga0075434_1018351362 | 3300006871 | Populus Rhizosphere | QEKAEALFVENPLAAFEGRGLPHVPEVDGAELKRKKRFLFF* |
Ga0075436_1007969471 | 3300006914 | Populus Rhizosphere | ALFVENPLAAFEGRGLPHVPEISGVELKRKKRFLFF* |
Ga0075436_1010748161 | 3300006914 | Populus Rhizosphere | QGLFVDNPLAAFEGRTLPYVPEVTDELPTKRRKRFFFF* |
Ga0099794_105905612 | 3300007265 | Vadose Zone Soil | ARSLFLDNPLAAFEGRELPHVPEIQETPPRKRKRFFFF* |
Ga0099829_101568933 | 3300009038 | Vadose Zone Soil | EMVVDQFGEEKARALFLDNPLAAYEGQKLPHVPEVDDDTPPHRKRFFFF* |
Ga0099830_112449452 | 3300009088 | Vadose Zone Soil | QEKARALFQDNPLAAFEGRELPHVPEVEDELPPPRRKRFFFF* |
Ga0099830_114670402 | 3300009088 | Vadose Zone Soil | RALFQDNPLAAFEGRPLPHVPEVEAELAPPRRKRFFFF* |
Ga0099828_104765183 | 3300009089 | Vadose Zone Soil | VREQFGEKKARALFVENPMAAFEGRDLPHVPEIPDEQISPRRKRFFFF* |
Ga0099827_108866481 | 3300009090 | Vadose Zone Soil | VVVDRFGQEKAHALFRDNPLAAFEGRQLPHVPEVDELPPPRRKRFFFF* |
Ga0066709_1009074612 | 3300009137 | Grasslands Soil | AHPLFVDNPLAALEGRNLPFVPKVADERPTKPRKRFFFF* |
Ga0116216_103270711 | 3300009698 | Peatlands Soil | QENPFAAFEGRELPHVPELEDESPPPRRKRFFFF* |
Ga0074044_106063121 | 3300010343 | Bog Forest Soil | MRGRPLRLQPAFDLVREEYGAEMARGLFVENPMAAFEGRELPYVPQPPEEKDLPRRKRFFFF* |
Ga0074044_110290451 | 3300010343 | Bog Forest Soil | ALFVENPLAAFEGRDLPHVPELQDEIEVPRRKRFFFF* |
Ga0074044_110468931 | 3300010343 | Bog Forest Soil | GKEKAEALFVENPLAAFEGQELPHVPEVASESSEPRKKRFFFF* |
Ga0126370_103380371 | 3300010358 | Tropical Forest Soil | RLQTAFDVVADRYGVETARALFVENPGAAFEGRELPHVPDVADAIAQPRRKRFLFF* |
Ga0126370_112766911 | 3300010358 | Tropical Forest Soil | AYDLVADRYSWETARALFVENPGAAFEGRDLPYVPDVEEPVAPRRRKRFFFF* |
Ga0126376_105563581 | 3300010359 | Tropical Forest Soil | FGAVKADALFMENPLAAFEGQPLPYVPEIQDEHPKKKRFIFF* |
Ga0126372_123413141 | 3300010360 | Tropical Forest Soil | TAKALFVINPLAAFEGRALPYVPEVADEHPSKRRKRFFFF* |
Ga0136449_1033285432 | 3300010379 | Peatlands Soil | GEEKARALFVENPRAAFEGWDLPHVPQLPDEFPMPRRKRFFFF* |
Ga0137392_100290837 | 3300011269 | Vadose Zone Soil | ARALFQDNPLAAFEGRPLPHVPEVEDEWPPPRRKRFFFF* |
Ga0137392_115945311 | 3300011269 | Vadose Zone Soil | ARALFQDNPLAAFEGRELPHVPEVKDELPPRRKRFFFF* |
Ga0137391_101562851 | 3300011270 | Vadose Zone Soil | KQFGEEKARALFTDNPLAAFEGRDLPHVPEIPDERVPPRRKRFLFF* |
Ga0137393_115776351 | 3300011271 | Vadose Zone Soil | FVENPRAAFEGRDLPHIPEVEEATAPPGRKRFFFF* |
Ga0137389_100224651 | 3300012096 | Vadose Zone Soil | FQDNPLAAFEGRQLPHIPEVEDELPRPRRKHFFFF* |
Ga0137389_100803724 | 3300012096 | Vadose Zone Soil | EQFGDEKARDLFLENPLAAFEGRDLPYVPEIPDAKISPRRRRFFFF* |
Ga0137389_106271152 | 3300012096 | Vadose Zone Soil | CLQPAYDAVVDRFGQEKARALFQDNPLSAFEGRELPHVPEVEDELPPRRKRFFFF* |
Ga0137388_114561611 | 3300012189 | Vadose Zone Soil | RPLRLQSAFDVVAGQFGQEKARALFLDNPLAAYEGRELPHVPEFEVSPPRKKRFFFF* |
Ga0137363_106139392 | 3300012202 | Vadose Zone Soil | ARALFHDNPLAAFEGRELPHVPEVEDELPLPRRKRFFFF* |
Ga0137399_103011191 | 3300012203 | Vadose Zone Soil | RALFLDNPLAAFDGGELPHVPEVQDESSPPRRKRFFFF* |
Ga0137362_111443631 | 3300012205 | Vadose Zone Soil | RALFLDNPLAAFEGRDLPHVPELQDESSLTRKKRFFFF* |
Ga0137380_1000104719 | 3300012206 | Vadose Zone Soil | FGEEKARALFQENPQAAFEGRDLPHIPELPEGAAPRRRKRFFFF* |
Ga0137380_106409271 | 3300012206 | Vadose Zone Soil | RALFLENPLAAFEGRELPHVPEVEQELPSARRKRFFFF* |
Ga0137376_104714401 | 3300012208 | Vadose Zone Soil | EKARALFIDNPLAAFEGRDLPHVPDIPDERVPPRRKKFLFF* |
Ga0137379_109731721 | 3300012209 | Vadose Zone Soil | ARALFLENPLAAFEGRELPHVPEVEQELPSARRKRFFFF* |
Ga0137371_108825301 | 3300012356 | Vadose Zone Soil | FGEEKAEALFVTNPLAAFEGRSLPHVPEIVEEQARKKWFLFF* |
Ga0137390_104981213 | 3300012363 | Vadose Zone Soil | ARALFQENPLAAFEGRELPHVPEVENELLPRRRKRFFFF* |
Ga0137390_110620041 | 3300012363 | Vadose Zone Soil | AEKARALFVENPLAAFEGQPLPHVPEIVEPPPRKKRFFFF* |
Ga0137395_102358642 | 3300012917 | Vadose Zone Soil | FGQEKARALFHDNPLAAFEGRELPHVPEVEDELPLPRRKRFFFF* |
Ga0137395_106785372 | 3300012917 | Vadose Zone Soil | LFVENPLAAFEGRPLPHVPEVFEEQVKKKRFIFF* |
Ga0137396_108063562 | 3300012918 | Vadose Zone Soil | EFGPEKARALFLDNPLAAFEGRDLPHVPELQDESSPTRKKRFFFF* |
Ga0137413_106438021 | 3300012924 | Vadose Zone Soil | RFGQEKARALFHDNPLAAFEGRELPHVPEVEDELPLPRRKRFFFF* |
Ga0137419_100905471 | 3300012925 | Vadose Zone Soil | KARALFLDNPLAAFEGRDLPHVPELQDESSPTRKKRFLFF* |
Ga0137419_109529991 | 3300012925 | Vadose Zone Soil | LFLDNPLAAFDGGELPHVPEVQDESSLPRRKRFFFF* |
Ga0137419_117959121 | 3300012925 | Vadose Zone Soil | VDQFGEETARALFHDNPLAAFEGRPLPHVPEVEDASPPRRKRFFFF* |
Ga0134077_100837463 | 3300012972 | Grasslands Soil | FQENPQAAFEGRDLPHIPELPEGAAPRRRKRFFFF* |
Ga0181525_101323361 | 3300014654 | Bog | ANKFNTETAEALFVSNPRAAFEGQELPHVPEVAEESPEPRKKRFLFF* |
Ga0137405_12643921 | 3300015053 | Vadose Zone Soil | GVVRDKTNPLAAFEGRPLPHVPEIVEEQARKKWFLFF* |
Ga0137420_13632561 | 3300015054 | Vadose Zone Soil | LQPAYDAVSKQFGEEKARALFIDNPLAAFEGRDLPHVRIFPTKGSATPKKFLFF* |
Ga0137418_100983034 | 3300015241 | Vadose Zone Soil | LFQDNALAAFERQPLPHISDVQYELPRPRRKRFFFF* |
Ga0137412_106156832 | 3300015242 | Vadose Zone Soil | LFIDNPLAAFEGRDLPHVPDIPDERVPPRRKKFLFF* |
Ga0182041_117162141 | 3300016294 | Soil | LLLENPLAAFEGRPLPHVPELSVPERKKWKRFLFF |
Ga0182033_103338161 | 3300016319 | Soil | ARALLLENPLAAFEGRPLPHVPELAPIPAPRKRKRFLFF |
Ga0182035_112768421 | 3300016341 | Soil | EAEALFADNPLAAFEGRALPHVPEILAERAKKRRFLFFRRS |
Ga0182038_104512441 | 3300016445 | Soil | LLLENPLAAFEGRPLPHVPELAPIPAPRKRKRFLFF |
Ga0187807_12538122 | 3300017926 | Freshwater Sediment | RRGPEAARALFHDNPLAAWEGEPLPWVPEPETAPSPERSRRRFFFF |
Ga0187776_101492881 | 3300017966 | Tropical Peatland | AKALLIDNPLAAFEGRALPHVPEIAPDPLPQKRRRFFFF |
Ga0187767_100854051 | 3300017999 | Tropical Peatland | ARALFVENPLAAFDGRPLPHAPPVVEAGPRRKRFFFF |
Ga0187810_104461202 | 3300018012 | Freshwater Sediment | EEKARSLFVDNPLAAFDGRSLPHVPEVPDDLTRPRRKRFFFF |
Ga0066667_119639341 | 3300018433 | Grasslands Soil | DVVLDQFGEEKARALFHDNPLAAFEGQPLPHVPEIEDALPPRRKRFFFF |
Ga0066662_101844593 | 3300018468 | Grasslands Soil | LFLENPLAAFEGRDLPHVPEVEEEAPSPKRKRFLFF |
Ga0193713_10191881 | 3300019882 | Soil | KARALFVENPLAAFEGRELPHVPELEKEAPVRKKKFFLF |
Ga0193751_10081616 | 3300019888 | Soil | VKKAFGEGKARALFIDNPKAAFEGRDLPHVPELQDERAQSPRKRFLFF |
Ga0179592_102489762 | 3300020199 | Vadose Zone Soil | ALFVENPLAAFEGRPLPHVPEVFEEQVKKKRFIFF |
Ga0210407_100461381 | 3300020579 | Soil | KARLLFLDNPLAALEGRELPHVPEIQETPSPKRRKRFFFF |
Ga0210407_103799593 | 3300020579 | Soil | KQFGEGKALALFVENPMAALEGRDLPHVPELPDEVDLPRRKRFFFF |
Ga0210403_107454422 | 3300020580 | Soil | LFVGNPMAAFEGSDLPYVPELRDEMDPPRRKRFFFF |
Ga0210403_108855892 | 3300020580 | Soil | EKVRALFLDNPLAAFEGRELPHVPEIEEENPPRRKRFFFF |
Ga0210403_114514712 | 3300020580 | Soil | QALLVDNPLAAFEGRPLPHLPEVAPAYVTPKRKRFLFF |
Ga0210399_107268401 | 3300020581 | Soil | GAVEKEFGEEKARALFIDNPKAAFEGRDLPHVPELEDERAQPAKKRFLFF |
Ga0210401_115090221 | 3300020583 | Soil | KARALFLDNPLAAFEGRELPYVPEIEEEKPPRRKRFFFF |
Ga0215015_105142762 | 3300021046 | Soil | RRPLRLQAAYDVVREQFGEKKARALFVENPMAAFEGRDLPHVPEIPDEQVSPRRKRFFFF |
Ga0179596_102307122 | 3300021086 | Vadose Zone Soil | KARALFIDNPLAAFEGRDLPHVPDIPDERVPPRRKKFLFF |
Ga0179596_104849352 | 3300021086 | Vadose Zone Soil | ALFRDNPLAAFEGRQLPHVPEIEDESPPPRRKRFFFF |
Ga0210406_101581141 | 3300021168 | Soil | VQEQFGEEKSRALFVENPMAALEGRDLPHVPEVHDEREIPRRKRFFFF |
Ga0210406_107023072 | 3300021168 | Soil | FDNPMAAFEGRELPHVPEVAPDRKPGQKRKRFWFF |
Ga0210400_103198071 | 3300021170 | Soil | KAHALFIDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF |
Ga0210400_103732293 | 3300021170 | Soil | KARALFVENPLAAFEGRDLPHVPEIPDEKASPRRKKFLFF |
Ga0210393_100151971 | 3300021401 | Soil | LFVENPMAAFEGRDLPHVPEVHDEREIPRRKRFFFF |
Ga0210393_106599521 | 3300021401 | Soil | QFGEAKALALFVENPMAAFEGRNLPHVPELPDEVDLPRRKRFFFF |
Ga0210387_102725461 | 3300021405 | Soil | RALFVDNPMAAFEGRDLPHVPEIAPDGKPKQRKRFWFF |
Ga0210391_113485941 | 3300021433 | Soil | PAFDFVRGQFGEEKARALFTENPRAAYEGRDLPHVPQLPDEFELPRRKRFFFF |
Ga0210392_111104692 | 3300021475 | Soil | RGLFVDNPLAAFEGRELPFVREVEDEAAQPLRKRFFFF |
Ga0187846_104507641 | 3300021476 | Biofilm | PAFDAVCAKFGEEKARALFIANPMAAFEGCPLPHVPDVQDPIQWTRRKRFFFF |
Ga0210398_114674312 | 3300021477 | Soil | KPAYDVVCEQFGADKARALFVENPMAAFEGRELPHVPELPDEFTPPRRKRFLFF |
Ga0210398_115059481 | 3300021477 | Soil | LFVENPMAAFEGRDLPHVPELADEADLPRRKRFFFF |
Ga0210402_114848942 | 3300021478 | Soil | EQFGEEKARALFIDNPLAAFEGRDLPHVPDIPDERVPPRRKRFLFF |
Ga0210409_109988591 | 3300021559 | Soil | AQALFVENPIAAFEGRDLPHVPEFTPPEKKENAARRKRFWFF |
Ga0247679_10572802 | 3300024251 | Soil | AQFGGETAQALFVDNPLAAFEGRNLPFVPEVADERPAKPRKRFFFF |
Ga0247668_10199473 | 3300024331 | Soil | DEMAEALFVENPLAAFEGRALPHVPEIVEEEPKKKRFLFF |
Ga0207692_110027732 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GPEKAEALFVSNPLAAFEGRPLPHVPEITAEQIKKKRFFFF |
Ga0207685_102385602 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAQALFVDNPLAAFEGRNLPYVPEVADKRPAKPRKRFFFF |
Ga0207664_104671421 | 3300025929 | Agricultural Soil | QALFVDNPLAAFEGRDLPYIPEIPDEKVSPRRKRFFFF |
Ga0207703_122578731 | 3300026035 | Switchgrass Rhizosphere | GQEKAEALFVENPLAAFEGRGLPHVPEVDGAELKRKKRFLFF |
Ga0209863_100278663 | 3300026281 | Prmafrost Soil | FGKGKARALFVDNPRAAFEGRDLPHVPELEDERVRQPRKRFLFF |
Ga0209158_11726882 | 3300026333 | Soil | RFGQEKARALFQDNPLAAFEGRELPHVPEVEDELPPPRRKRFFFF |
Ga0257163_10043573 | 3300026359 | Soil | EKARALFIENPLAAFEGRDLPHVPEIPDEKVPPRRKKFLFF |
Ga0209807_11981142 | 3300026530 | Soil | DQFGEEKARALFHDNPLAAFEGQPLPHVPEIEDALPPRRKRFFFF |
Ga0207780_10511481 | 3300027313 | Tropical Forest Soil | QALFVENPMAAFEGLPLPHIPEILQETRLEKRKRFFFF |
Ga0209220_11072221 | 3300027587 | Forest Soil | KARALFWENPLAAFEGRELPHVPEVEEEVLPPRRKRFFFF |
Ga0209625_11011231 | 3300027635 | Forest Soil | RAAFEVVAKAFGEDKGRALFVDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF |
Ga0209076_10420063 | 3300027643 | Vadose Zone Soil | ARALFQDNPLAAFEGQQLPHIPEVEDELPPPRRKRFFFF |
Ga0209588_12700061 | 3300027671 | Vadose Zone Soil | VSKQFGGEKARALFVENPLAAFEGRDLPHVPEIPEGKASPRRKKFLFF |
Ga0209011_11022101 | 3300027678 | Forest Soil | ALFVDNPKAAFDGRDLPHVPELEDETAQPRRKRFLFF |
Ga0209446_10831072 | 3300027698 | Bog Forest Soil | AYDVVLEQLGEGKARALFVENPMAAFEGRDLPHVPELPDENALPKRKRFFFF |
Ga0209178_11768812 | 3300027725 | Agricultural Soil | QFGEEKARALFLENPMAAFEGRALPHVPELPDHIGVPRRKRFFFF |
Ga0209038_101380171 | 3300027737 | Bog Forest Soil | ALFVDNPMAAFEGRDLPYFPELPDEFNRPRRKRFFFF |
Ga0209448_100401281 | 3300027783 | Bog Forest Soil | LKLRAAYDVVLEQLGEGKARALFVENPMAAFEGRDLPHVPELPDENALPKRKRFFFF |
Ga0209580_102092711 | 3300027842 | Surface Soil | ENPMAAFEGRDLPHLPQLPDETDVPRRKRFFFFWSL |
Ga0209274_106860481 | 3300027853 | Soil | RALFVENPMAAFEGRELPHVPQPPDEIEPPRRKRFFFF |
Ga0209166_100008521 | 3300027857 | Surface Soil | ADRFGEEKARALFVENPGAAFEGRDLPHVPEVEEPVAQPKRRRFFFF |
Ga0209701_103052652 | 3300027862 | Vadose Zone Soil | RALFQDNPLAAFEGRPLPHVPEVEAELAPPRRKRFFFF |
Ga0209590_106014152 | 3300027882 | Vadose Zone Soil | LFQDNPLAAFEGRQLPHVPEVDELPPPRRKRFFFF |
Ga0209698_104819001 | 3300027911 | Watersheds | NTRGRPLKLQPAYDVVGRKFGEEKARALFVENPMAAFEGRSLPQVPDVPDDITRPRRKRFFFF |
Ga0265357_10064201 | 3300028023 | Rhizosphere | FDVVCEQFGEDKARALFVDNPMAAFEGRDLPHVPELPDEFTPPRRKRFFFF |
Ga0268264_110332902 | 3300028381 | Switchgrass Rhizosphere | KAEALFVENPLAAFEGRGLPHMPEISATSLKRKRFLFF |
Ga0308309_100223591 | 3300028906 | Soil | EEVARALFVDNPMAAFEGRDLPHVPGVRDKIDVPRRKRFFFF |
Ga0222749_107654841 | 3300029636 | Soil | EEKARALFIENPLAAFEGRDLPHVPDIPDERVPPRRKRFLFF |
Ga0311368_110100392 | 3300029882 | Palsa | AKFNRETAEALFVSNPRAAFEGQELPHVPELAEESPGPRKKRFLFF |
Ga0075384_111772531 | 3300030841 | Soil | PAFEVVAKAFGEEKARALFVDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF |
Ga0075386_114952101 | 3300030916 | Soil | KEFGKQKAQALFVDNPRAAFEGLDLPHVPELEEEPEHRKKRFLFF |
Ga0073994_122671411 | 3300030991 | Soil | EDKARALFIDNPKAAFEGRDLPHVPELQDERVQSPRKRFLFF |
Ga0073994_123115961 | 3300030991 | Soil | KARALFQDNPLAAFEGRELPHIPEVEDELPPPRRKRFFFF |
Ga0073994_123739321 | 3300030991 | Soil | EDKARALFIDNPKAAFEGLDLPHVPELQDERVQSPRKRFLFF |
Ga0170834_1004060842 | 3300031057 | Forest Soil | ARALFVENPMAAFEGRDLPHVPQLPETTGGPRRKRFFFF |
Ga0170823_171252442 | 3300031128 | Forest Soil | LFHDNPLAAFEGRELPHVPEVEDELPPPRRRRFFFF |
Ga0307476_112062791 | 3300031715 | Hardwood Forest Soil | DKSRALFVENPMAAFEGRDLPHVPDVRDEREIPRRKRFFFF |
Ga0307469_123057131 | 3300031720 | Hardwood Forest Soil | RRRPLRLQAAHDVVAEQFGDEKARALFFDNPMAAFEGRDLPHVPEIPDDKVSSRRKRFLL |
Ga0307468_1004860771 | 3300031740 | Hardwood Forest Soil | REQLGEEKARALFVENPMAALEGRDLPHVPQLPETTGAPRRKRFFFF |
Ga0307477_111287731 | 3300031753 | Hardwood Forest Soil | ALFLENPLAAFEGRDLPYVPEIPEENTSPRRKRFFFF |
Ga0318568_106677462 | 3300031819 | Soil | KAEALLVDNPLAAFEGHGLPHIPEVSDRPKKKRFLFF |
Ga0318564_103263262 | 3300031831 | Soil | ALLLENPLAAFEGRPLPHVPELSVPERKKWKRFLFF |
Ga0318551_105519192 | 3300031896 | Soil | EKAEALFVENPLAAFEGRALPHVPEIREAPVKKKRFLFF |
Ga0318551_108092131 | 3300031896 | Soil | RALLLENPLAAFEGRPLPHVPERAPIPAPRKRKRFLFF |
Ga0318520_102205793 | 3300031897 | Soil | GKAEALFVDNPLAAFEGHGLPHIPEVSDPPKKKRFLFF |
Ga0306923_104071911 | 3300031910 | Soil | ARALLLENPLAAFEGRPLPHVPELVPIPAPRKRKRFLFF |
Ga0306926_123461812 | 3300031954 | Soil | KTAQALFVDNPLAAFEGRTLPYMPEAAERPAGRRKRFFFF |
Ga0307479_102337151 | 3300031962 | Hardwood Forest Soil | VVVDQFGEETARALFHDNPLAAFEGRPLPCVPEIEDALPVPRRKRFFFF |
Ga0307479_110213782 | 3300031962 | Hardwood Forest Soil | RDLFLENPLAAFEGRDLPYVPEIPDAKISPRRRRFFFF |
Ga0307479_117040782 | 3300031962 | Hardwood Forest Soil | VRQFGEEKARALFQDNPLAAFEGRALPHIPEIEDELPPPRRKRFFFF |
Ga0318507_102827931 | 3300032025 | Soil | GKAEALLVDNPLAAFEGHGLPHIPEVSDRPKKKRFLFF |
Ga0318533_112938181 | 3300032059 | Soil | FVENPLAVLEGRALPHVPEIREARAKKKRFRFFWA |
Ga0306924_101669074 | 3300032076 | Soil | RALLLEYPLAAFEGRPLPHVPELSVPERKKWKRFLFF |
Ga0307471_1002653041 | 3300032180 | Hardwood Forest Soil | AFDLVREQFGEEKARALFVENPMAAFEGRDLPHVPQLPETTGAPRRKRFFFF |
Ga0307472_1015894701 | 3300032205 | Hardwood Forest Soil | YDVVVDQFGREKARALFVDNPLAAFEGGELPHVPEVEDKSSAPRKKRFFFF |
Ga0335078_104623301 | 3300032805 | Soil | MGEETAKALFLENPRAALEGLDLPYVPELTSESAGPRRKRFFFF |
Ga0335081_107386723 | 3300032892 | Soil | PAYEVIREQVGEQTARALLLENPKAALEGRDLPYVPDLSDTADAAPRKRFFFF |
Ga0335083_105197611 | 3300032954 | Soil | GEEVAQALFVDNPLAAFEGRTLPYVPQVADSKEIKPRKRFFFF |
⦗Top⦘ |