Basic Information | |
---|---|
Family ID | F034732 |
Family Type | Metagenome |
Number of Sequences | 174 |
Average Sequence Length | 48 residues |
Representative Sequence | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLLAI |
Number of Associated Samples | 128 |
Number of Associated Scaffolds | 174 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 56.90 % |
% of genes near scaffold ends (potentially truncated) | 33.91 % |
% of genes from short scaffolds (< 2000 bps) | 87.36 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.690 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.345 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.874 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.218 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.84% β-sheet: 0.00% Coil/Unstructured: 44.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 174 Family Scaffolds |
---|---|---|
PF08668 | HDOD | 20.11 |
PF02769 | AIRS_C | 12.07 |
PF12705 | PDDEXK_1 | 1.72 |
PF13177 | DNA_pol3_delta2 | 1.15 |
PF13091 | PLDc_2 | 0.57 |
PF00528 | BPD_transp_1 | 0.57 |
PF02132 | RecR | 0.57 |
PF13361 | UvrD_C | 0.57 |
COG ID | Name | Functional Category | % Frequency in 174 Family Scaffolds |
---|---|---|---|
COG0353 | Recombinational DNA repair protein RecR | Replication, recombination and repair [L] | 0.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.69 % |
Unclassified | root | N/A | 29.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_65406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1366 | Open in IMG/M |
3300004156|Ga0062589_101316427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 699 | Open in IMG/M |
3300004157|Ga0062590_100470473 | Not Available | 1059 | Open in IMG/M |
3300004480|Ga0062592_100924453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
3300004633|Ga0066395_10232581 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300004643|Ga0062591_100543909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1010 | Open in IMG/M |
3300005093|Ga0062594_100078690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1857 | Open in IMG/M |
3300005093|Ga0062594_100405831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1103 | Open in IMG/M |
3300005327|Ga0070658_10028709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 4467 | Open in IMG/M |
3300005327|Ga0070658_10208408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1651 | Open in IMG/M |
3300005328|Ga0070676_10004703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium → unclassified Methylibium → Methylibium sp. YR605 | 7217 | Open in IMG/M |
3300005328|Ga0070676_10030574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3072 | Open in IMG/M |
3300005328|Ga0070676_10052924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2389 | Open in IMG/M |
3300005328|Ga0070676_10220380 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300005329|Ga0070683_100165409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2098 | Open in IMG/M |
3300005331|Ga0070670_100036712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4216 | Open in IMG/M |
3300005331|Ga0070670_100076351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2879 | Open in IMG/M |
3300005331|Ga0070670_100475280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1109 | Open in IMG/M |
3300005331|Ga0070670_101362665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 650 | Open in IMG/M |
3300005333|Ga0070677_10144588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1100 | Open in IMG/M |
3300005333|Ga0070677_10234124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 904 | Open in IMG/M |
3300005333|Ga0070677_10759131 | Not Available | 551 | Open in IMG/M |
3300005335|Ga0070666_10095408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2047 | Open in IMG/M |
3300005335|Ga0070666_11181426 | Not Available | 570 | Open in IMG/M |
3300005338|Ga0068868_100435476 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300005338|Ga0068868_100504922 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300005338|Ga0068868_100989064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 769 | Open in IMG/M |
3300005339|Ga0070660_100248272 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300005344|Ga0070661_100912301 | Not Available | 725 | Open in IMG/M |
3300005344|Ga0070661_101917548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp. J223 | 504 | Open in IMG/M |
3300005355|Ga0070671_100178045 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
3300005356|Ga0070674_100011903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 5318 | Open in IMG/M |
3300005365|Ga0070688_100263778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1231 | Open in IMG/M |
3300005366|Ga0070659_101121803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 694 | Open in IMG/M |
3300005438|Ga0070701_10622353 | Not Available | 717 | Open in IMG/M |
3300005457|Ga0070662_100954949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 733 | Open in IMG/M |
3300005457|Ga0070662_100979776 | Not Available | 723 | Open in IMG/M |
3300005459|Ga0068867_100718833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 883 | Open in IMG/M |
3300005530|Ga0070679_100721188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 940 | Open in IMG/M |
3300005535|Ga0070684_100308542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1453 | Open in IMG/M |
3300005539|Ga0068853_101433616 | Not Available | 668 | Open in IMG/M |
3300005543|Ga0070672_100572912 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300005547|Ga0070693_100026963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 3107 | Open in IMG/M |
3300005547|Ga0070693_100212131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1264 | Open in IMG/M |
3300005564|Ga0070664_101021223 | Not Available | 777 | Open in IMG/M |
3300005834|Ga0068851_10796167 | Not Available | 587 | Open in IMG/M |
3300005995|Ga0066790_10092960 | Not Available | 1296 | Open in IMG/M |
3300006046|Ga0066652_100149445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1957 | Open in IMG/M |
3300006163|Ga0070715_10384353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 776 | Open in IMG/M |
3300006173|Ga0070716_100108925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1713 | Open in IMG/M |
3300006237|Ga0097621_101308663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 685 | Open in IMG/M |
3300006237|Ga0097621_102240564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
3300006358|Ga0068871_100301890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1406 | Open in IMG/M |
3300006881|Ga0068865_101426602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 619 | Open in IMG/M |
3300007076|Ga0075435_100889451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 776 | Open in IMG/M |
3300009094|Ga0111539_10904373 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300009098|Ga0105245_12629223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp. J223 | 556 | Open in IMG/M |
3300009137|Ga0066709_101992734 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300009148|Ga0105243_11472803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
3300009156|Ga0111538_10920311 | Not Available | 1107 | Open in IMG/M |
3300009174|Ga0105241_11431621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 663 | Open in IMG/M |
3300009176|Ga0105242_13089721 | Not Available | 516 | Open in IMG/M |
3300009553|Ga0105249_10475317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1292 | Open in IMG/M |
3300009553|Ga0105249_10517005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1241 | Open in IMG/M |
3300010037|Ga0126304_11267663 | Not Available | 506 | Open in IMG/M |
3300010337|Ga0134062_10272121 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300010361|Ga0126378_10294726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1724 | Open in IMG/M |
3300010371|Ga0134125_10391947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1540 | Open in IMG/M |
3300010400|Ga0134122_11386603 | Not Available | 716 | Open in IMG/M |
3300010403|Ga0134123_12228501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
3300012509|Ga0157334_1017711 | Not Available | 754 | Open in IMG/M |
3300012509|Ga0157334_1049994 | Not Available | 574 | Open in IMG/M |
3300012904|Ga0157282_10260508 | Not Available | 592 | Open in IMG/M |
3300012905|Ga0157296_10283190 | Not Available | 572 | Open in IMG/M |
3300012910|Ga0157308_10412590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 527 | Open in IMG/M |
3300012914|Ga0157297_10310429 | Not Available | 597 | Open in IMG/M |
3300012985|Ga0164308_10229573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1434 | Open in IMG/M |
3300012988|Ga0164306_10657796 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300013104|Ga0157370_10826894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
3300013296|Ga0157374_10597125 | Not Available | 1114 | Open in IMG/M |
3300013306|Ga0163162_10644467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1183 | Open in IMG/M |
3300013306|Ga0163162_12033214 | Not Available | 659 | Open in IMG/M |
3300013308|Ga0157375_10258491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1903 | Open in IMG/M |
3300013308|Ga0157375_10628645 | Not Available | 1231 | Open in IMG/M |
3300013308|Ga0157375_10754570 | Not Available | 1124 | Open in IMG/M |
3300014745|Ga0157377_10787505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 700 | Open in IMG/M |
3300014968|Ga0157379_11448704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 667 | Open in IMG/M |
3300014968|Ga0157379_12580694 | Not Available | 509 | Open in IMG/M |
3300014969|Ga0157376_10615905 | Not Available | 1082 | Open in IMG/M |
3300014969|Ga0157376_12120572 | Not Available | 600 | Open in IMG/M |
3300015371|Ga0132258_11217874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1903 | Open in IMG/M |
3300015371|Ga0132258_11956690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1475 | Open in IMG/M |
3300015373|Ga0132257_102503553 | Not Available | 670 | Open in IMG/M |
3300016270|Ga0182036_10962736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 702 | Open in IMG/M |
3300017792|Ga0163161_10899337 | Not Available | 750 | Open in IMG/M |
3300017965|Ga0190266_10652060 | Not Available | 648 | Open in IMG/M |
3300018476|Ga0190274_10584548 | Not Available | 1139 | Open in IMG/M |
3300018481|Ga0190271_10120442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2467 | Open in IMG/M |
3300018482|Ga0066669_11925917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300018920|Ga0190273_12053728 | Not Available | 531 | Open in IMG/M |
3300019362|Ga0173479_10824752 | Not Available | 516 | Open in IMG/M |
3300021082|Ga0210380_10040984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1991 | Open in IMG/M |
3300021082|Ga0210380_10330221 | Not Available | 695 | Open in IMG/M |
3300021445|Ga0182009_10007930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3547 | Open in IMG/M |
3300021445|Ga0182009_10254662 | Not Available | 872 | Open in IMG/M |
3300022756|Ga0222622_10258964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp. J223 | 1182 | Open in IMG/M |
3300023264|Ga0247772_1110111 | Not Available | 596 | Open in IMG/M |
3300025315|Ga0207697_10043900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1838 | Open in IMG/M |
3300025315|Ga0207697_10164480 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300025893|Ga0207682_10024606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2385 | Open in IMG/M |
3300025903|Ga0207680_10319949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1085 | Open in IMG/M |
3300025905|Ga0207685_10176206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 988 | Open in IMG/M |
3300025907|Ga0207645_10230207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
3300025911|Ga0207654_10511376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 849 | Open in IMG/M |
3300025919|Ga0207657_10799388 | Not Available | 729 | Open in IMG/M |
3300025919|Ga0207657_11331100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
3300025920|Ga0207649_10235403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1312 | Open in IMG/M |
3300025920|Ga0207649_10244700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1289 | Open in IMG/M |
3300025920|Ga0207649_10486458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 937 | Open in IMG/M |
3300025920|Ga0207649_10846007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 716 | Open in IMG/M |
3300025923|Ga0207681_10345702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1189 | Open in IMG/M |
3300025925|Ga0207650_10025459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4215 | Open in IMG/M |
3300025925|Ga0207650_10213436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1550 | Open in IMG/M |
3300025931|Ga0207644_10104952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2128 | Open in IMG/M |
3300025931|Ga0207644_10299113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1296 | Open in IMG/M |
3300025939|Ga0207665_10158160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1628 | Open in IMG/M |
3300025940|Ga0207691_10033112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4813 | Open in IMG/M |
3300025940|Ga0207691_11427316 | Not Available | 568 | Open in IMG/M |
3300025941|Ga0207711_11468876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
3300025945|Ga0207679_10017366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. Root404 | 4799 | Open in IMG/M |
3300025945|Ga0207679_10789729 | Not Available | 865 | Open in IMG/M |
3300025961|Ga0207712_10542964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 999 | Open in IMG/M |
3300025986|Ga0207658_10218858 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300026023|Ga0207677_10060364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. Root404 | 2620 | Open in IMG/M |
3300026041|Ga0207639_11030595 | Not Available | 771 | Open in IMG/M |
3300026078|Ga0207702_10925879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 864 | Open in IMG/M |
3300026089|Ga0207648_10681811 | Not Available | 951 | Open in IMG/M |
3300026142|Ga0207698_10385100 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300026142|Ga0207698_11158852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 787 | Open in IMG/M |
3300028380|Ga0268265_10316384 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300028587|Ga0247828_10009765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Azohydromonas → Azohydromonas sediminis | 3500 | Open in IMG/M |
3300028587|Ga0247828_10189212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1064 | Open in IMG/M |
3300028596|Ga0247821_11238721 | Not Available | 508 | Open in IMG/M |
3300028802|Ga0307503_10206732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 933 | Open in IMG/M |
3300028802|Ga0307503_10751556 | Not Available | 552 | Open in IMG/M |
3300028889|Ga0247827_10472366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 778 | Open in IMG/M |
3300031170|Ga0307498_10009491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1904 | Open in IMG/M |
3300031226|Ga0307497_10671033 | Not Available | 532 | Open in IMG/M |
3300031366|Ga0307506_10092194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 977 | Open in IMG/M |
3300031543|Ga0318516_10189464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1186 | Open in IMG/M |
3300031562|Ga0310886_11100618 | Not Available | 513 | Open in IMG/M |
3300031572|Ga0318515_10230460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 993 | Open in IMG/M |
3300031680|Ga0318574_10702081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
3300031681|Ga0318572_10660312 | Not Available | 623 | Open in IMG/M |
3300031765|Ga0318554_10264126 | Not Available | 980 | Open in IMG/M |
3300031765|Ga0318554_10639041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
3300031765|Ga0318554_10694029 | Not Available | 571 | Open in IMG/M |
3300031781|Ga0318547_10867560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
3300031846|Ga0318512_10553057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
3300031852|Ga0307410_10719265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 843 | Open in IMG/M |
3300031896|Ga0318551_10122578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1401 | Open in IMG/M |
3300031913|Ga0310891_10125757 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300031938|Ga0308175_100261970 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
3300031938|Ga0308175_103091780 | Not Available | 517 | Open in IMG/M |
3300031939|Ga0308174_10041623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. Root404 | 3046 | Open in IMG/M |
3300031939|Ga0308174_10105947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2025 | Open in IMG/M |
3300031939|Ga0308174_10191687 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300031939|Ga0308174_10224993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1444 | Open in IMG/M |
3300031939|Ga0308174_10637682 | Not Available | 884 | Open in IMG/M |
3300032001|Ga0306922_10159110 | Not Available | 2418 | Open in IMG/M |
3300032068|Ga0318553_10315735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 818 | Open in IMG/M |
3300032074|Ga0308173_11374723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 662 | Open in IMG/M |
3300033550|Ga0247829_10603026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 913 | Open in IMG/M |
3300034125|Ga0370484_0118711 | Not Available | 698 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 9.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 8.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 7.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.02% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.72% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.72% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.15% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.15% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.15% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.15% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.15% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.57% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.57% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.57% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.57% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_01008170 | 2199352024 | Soil | MRSPFVDSASFLSEGPPEPGLRAAGLSIRLLAFALVMAVAASSAVLIAM |
Ga0062589_1013164272 | 3300004156 | Soil | PVETAMRSPFVDSASFLSEPSSGAARRHSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0062590_1004704733 | 3300004157 | Soil | MRSPFVDSASFLSEPSSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI* |
Ga0062592_1009244531 | 3300004480 | Soil | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0066395_102325811 | 3300004633 | Tropical Forest Soil | MRSPFVDSASFLSEGFDRVTRRGPSTIRLLAFALVTAVAASSAVLLAI* |
Ga0062591_1005439091 | 3300004643 | Soil | RPPAETAMRSPFVDSASFLSEPLSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI* |
Ga0062594_1000786902 | 3300005093 | Soil | MRSPFVDSASFLSDPSSDAARRQSLVVSRLLLLALVTAVAASSAVLLAI* |
Ga0062594_1004058312 | 3300005093 | Soil | FVDSASFLSEGFAGAARRAPSTIRLLAFALVTAVAASSAVLLAI* |
Ga0070658_100287095 | 3300005327 | Corn Rhizosphere | MRSPFVDSASFLSEGMGAAARRAPSAIRLLAFALVTVVAASSAVLLAI* |
Ga0070658_102084082 | 3300005327 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLLAI* |
Ga0070676_100047035 | 3300005328 | Miscanthus Rhizosphere | MPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLAF* |
Ga0070676_100305742 | 3300005328 | Miscanthus Rhizosphere | MRSPFVDSASFLSDRPRSSGPRQSIVVGRLLLFALVMAVAASSAVLLAI* |
Ga0070676_100529243 | 3300005328 | Miscanthus Rhizosphere | MRSPFVDSASFLSEGFAGAARRAPSTIRLLAFALVTAVAASSAVLLAI* |
Ga0070676_102203802 | 3300005328 | Miscanthus Rhizosphere | MRSPFVDSASFLSDPSADEGRRQSLVVGRLLMFALVVAVAASSAVLLAI* |
Ga0070683_1001654092 | 3300005329 | Corn Rhizosphere | MRSPFVDSASFLSEGFAGAARRAPFTIRLLAFALVTAVAASSAVLLAI* |
Ga0070670_1000367124 | 3300005331 | Switchgrass Rhizosphere | MRTPFFVDSASYLSEHSEGRSSLVVSRLLTLALVVAVAASSAVLIAI* |
Ga0070670_1000763514 | 3300005331 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPLSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI* |
Ga0070670_1004752802 | 3300005331 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPSADVGPRHSLVVGRLLLLALVMAVAASSAVLLAI* |
Ga0070670_1013626652 | 3300005331 | Switchgrass Rhizosphere | MRSPFVDSASFLSETSRHARQSLVVGRLLLFALVIAVATSSAVLLAV* |
Ga0070677_101445882 | 3300005333 | Miscanthus Rhizosphere | MRSPFVDSASFLSDRPRNSGPRQSIVVGRLLLFALVMAVAASSAVLLAI* |
Ga0070677_102341241 | 3300005333 | Miscanthus Rhizosphere | SFLSDPSADEGRRQSLVVGRLLMFALVVAVAASSAVLLAI* |
Ga0070677_107591311 | 3300005333 | Miscanthus Rhizosphere | MRSPFVDSASFLSEPSPDAARRHSLVVSRLLLLALVMAVAASSAVLLAI* |
Ga0070666_100954082 | 3300005335 | Switchgrass Rhizosphere | MRSPFVDSASFLPEPSADDGPRQSLIVGRLLLFALVLAVAASSAVLLAI* |
Ga0070666_111814262 | 3300005335 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPSSDAARRQSLVVSQLLMLALVTAVAASSAVLLAI* |
Ga0068868_1004354762 | 3300005338 | Miscanthus Rhizosphere | MQTPFVDSASYLPEHSERQSSLVATRLLMLALVVAVAASSAVLIAI* |
Ga0068868_1005049222 | 3300005338 | Miscanthus Rhizosphere | MRTPFFVDSASYLSGHSERRSSLVASRLLTLALVVAVAASSAVLIAI* |
Ga0068868_1009890642 | 3300005338 | Miscanthus Rhizosphere | FVDSASFLSAGFGGSGRRAAAGLRLLAFALVTVVAASSAVLIAI* |
Ga0070660_1002482723 | 3300005339 | Corn Rhizosphere | MRSPFVDSASFLSAGFGGSGRRAAAGLRLLAFALVTAVAASSAVLIAI* |
Ga0070661_1009123012 | 3300005344 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDDARRHSLVVGRLLLLALVMAVAASSAVLLAI* |
Ga0070661_1019175481 | 3300005344 | Corn Rhizosphere | DSASFLSEPSSDAGPRQSLVVSRLLLLALVLAVAASSAVLLAI* |
Ga0070671_1001780453 | 3300005355 | Switchgrass Rhizosphere | MRSPFVDSDSFLSEGPLSGGRRGHRVGIRLLACALVIAVAASSAVLLAL* |
Ga0070674_1000119032 | 3300005356 | Miscanthus Rhizosphere | MPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALVMAVAASSAVLLAF* |
Ga0070688_1002637782 | 3300005365 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPSSDAARRQSLVVSRLLLLALVTAVAASSAVLLAI* |
Ga0070659_1011218032 | 3300005366 | Corn Rhizosphere | AETAMPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLAF* |
Ga0070701_106223532 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSPFVDSASFLSAGFGGSGRRAAAGLRLLAFALVTVVAASSAVLIAI* |
Ga0070662_1009549491 | 3300005457 | Corn Rhizosphere | MQTPCVDSASYLPEHSERQSSLVATRLLMLALVVAVAASSAVLIAI* |
Ga0070662_1009797761 | 3300005457 | Corn Rhizosphere | MRTPFFVDSASYLSGHSERRSSLVASRLLTLALVVAVAASSA |
Ga0068867_1007188331 | 3300005459 | Miscanthus Rhizosphere | MRAPFFVDSASYLSEHSERRSSLVASRLLTLALVVAVAASSAVLIAI* |
Ga0070679_1007211882 | 3300005530 | Corn Rhizosphere | RSPFVDSASFLSEPSSDAARRHSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0070684_1003085422 | 3300005535 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDAARRLSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0068853_1014336162 | 3300005539 | Corn Rhizosphere | MRSPFVDSASFLSDPSADESRRQSLVVGRLLMFALVVAVAASSAVLLAI* |
Ga0070672_1005729122 | 3300005543 | Miscanthus Rhizosphere | MRSPFVDSASLLSDPPSDARARHSLVVGRLLLLALVTAVAASSAVLLAI* |
Ga0070693_1000269631 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSPFVDSASFLSEPSSGAARRHSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0070693_1002121312 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | SASFLSEGFAGATRRMPTMIRLLAFALVTAVAASSAVLLAI* |
Ga0070664_1010212232 | 3300005564 | Corn Rhizosphere | MRSPFVDSASFLSDPSSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI* |
Ga0068851_107961671 | 3300005834 | Corn Rhizosphere | MRFPFVDSASFLSGPSPDAARRHSLVVSRLLLLALVMAVAASSAVLLAI* |
Ga0066790_100929603 | 3300005995 | Soil | MRYPFVDSASFLSEGSRETVDPSAFRSSWLLALALVMAVATSSAVLLAL* |
Ga0066652_1001494452 | 3300006046 | Soil | MRSPFVDSASFLSEPSSDPRGRQSNAVGRLLLFALIVAVAASSAVLLAI* |
Ga0070715_103843532 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSPFVDSASLLSERSSDAARRHSLVVGRLLFFALVMAVAASSAVLLAF* |
Ga0070716_1001089251 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSPFVDSASFLSEPSSDAGRRQSNAVGRLLLFALVVAVAASSAVLLAI* |
Ga0097621_1013086631 | 3300006237 | Miscanthus Rhizosphere | SPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLLAI* |
Ga0097621_1022405642 | 3300006237 | Miscanthus Rhizosphere | FVDSASFLSEGMGAAARRAPSAIRLLAFALVTVVAASSAVLLAI* |
Ga0068871_1003018902 | 3300006358 | Miscanthus Rhizosphere | MPSPFVDSASLLSEPSSDAARRHSLVVGRLLMLALVMAVAASSAVLLAF* |
Ga0068865_1014266022 | 3300006881 | Miscanthus Rhizosphere | ERPPAETAMRSPFVDSASFLSEPLSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI* |
Ga0075435_1008894511 | 3300007076 | Populus Rhizosphere | SEGFAGAARRAPSTIRLLAFALVTVVAASSAVLLAI* |
Ga0111539_109043732 | 3300009094 | Populus Rhizosphere | MPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALGMAVAASSAVLLAF* |
Ga0105245_126292232 | 3300009098 | Miscanthus Rhizosphere | AMRSPFVDSASFLSEPSSDAARRHSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0066709_1019927342 | 3300009137 | Grasslands Soil | MRSPFVNSASFLSEPSSDAGRRQSNAVGRLLLFALVVAVAASSAVLLAI* |
Ga0105243_114728031 | 3300009148 | Miscanthus Rhizosphere | MRSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLAF* |
Ga0111538_109203112 | 3300009156 | Populus Rhizosphere | MRFPFVDSASFLSGPSPDAARRHSLVVGRLLMLALVMAVAASSAVLLAI* |
Ga0105241_114316212 | 3300009174 | Corn Rhizosphere | SEGFAGAARRAPSTIRLLAFALVTAVAASSAVLLAI* |
Ga0105242_130897211 | 3300009176 | Miscanthus Rhizosphere | SAETAMRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLLAI* |
Ga0105249_104753172 | 3300009553 | Switchgrass Rhizosphere | MRSPFVDSASFLSEGFAGSARRAPSTIRLLAFALVTAVAASSAVLLAI* |
Ga0105249_105170052 | 3300009553 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPSPDAARRHSLVVSRLLLLALVTAVAASSAVLLAI* |
Ga0126304_112676631 | 3300010037 | Serpentine Soil | MRSPFVDSASFLSEGPVETGRRESAISIRLLAFALVMVVAASSAVLLAI* |
Ga0134062_102721212 | 3300010337 | Grasslands Soil | MRSPFVDSASFLSEPSSDAVRHQSNAVSRLLLFALVVAVAASSAVLLAI* |
Ga0126378_102947262 | 3300010361 | Tropical Forest Soil | MHSPFVDSASFLSEGFDRVTRSTPSAIRLLAFALVTAVAASSAVLLAI* |
Ga0134125_103919472 | 3300010371 | Terrestrial Soil | MRSPFVDSASFLSEGFAGATRRMPTMIRLLAFALVTAVAASSAVLLAI* |
Ga0134122_113866032 | 3300010400 | Terrestrial Soil | MRSPFVDSASFLSEGFAGATRRMPAMIRLLAFALVTAVAASSAVLLAI* |
Ga0134123_122285012 | 3300010403 | Terrestrial Soil | VSPAPAETAMRSPFVDSASFLSDPSADEGRRQSLVVGRLLMFALVVAVAASSAVLLAI* |
Ga0157334_10177112 | 3300012509 | Soil | MRSPFVDSASFLPEPSPDDGPRQSLVVGRLLLFALVLAVAASSAVLLAI* |
Ga0157334_10499942 | 3300012509 | Soil | MRSPFVDSASFLSAGFGGSGRRAAAGLRLLAFALVTAVAASSAVLLAI* |
Ga0157282_102605081 | 3300012904 | Soil | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVM |
Ga0157296_102831902 | 3300012905 | Soil | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALV |
Ga0157308_104125902 | 3300012910 | Soil | AMRSPFVDSASFLSEPSSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI* |
Ga0157297_103104292 | 3300012914 | Soil | MRSPFVDSASFLSEPSSGAARRHSLVVGRLLLLALVTAVAASSAVLLAI* |
Ga0164308_102295732 | 3300012985 | Soil | MRSPFVDSASFLSEPSSDAARRESLVVSRLLLLALVTAVAASSAVLLAI* |
Ga0164306_106577961 | 3300012988 | Soil | MPSPFVDSASLLSEPSSDAARRHSLVVGRLLMLALV |
Ga0157370_108268942 | 3300013104 | Corn Rhizosphere | DSASFLSEGMGAAARRAPSAIRLLAFALVTVVAASSAVLLAI* |
Ga0157374_105971252 | 3300013296 | Miscanthus Rhizosphere | MQTPFVDSASYLPEHSERHSSLVATRLLMLALVVAVAASSAVLIAI* |
Ga0163162_106444672 | 3300013306 | Switchgrass Rhizosphere | MRSPFVDSASFLSAGFGGSGRRAAAGLRLLAFALVTVVAASSSVLIAI* |
Ga0163162_120332141 | 3300013306 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPAPDAARRHSLVVSRLLLLALVMAVAASSAVLLAM* |
Ga0157375_102584912 | 3300013308 | Miscanthus Rhizosphere | MRSPFVDSASFLSECFAGAARRAPSTIRLLAFALVTAVAASSAVLLAI* |
Ga0157375_106286451 | 3300013308 | Miscanthus Rhizosphere | MRTRFFVDSASYLSEHSERRSSLVASRLLTLALVVAVAASSAVLIAI |
Ga0157375_107545701 | 3300013308 | Miscanthus Rhizosphere | MRSPFVDSASLLSDPPSDARARHSLVVGRLLLLALVTAVAASS |
Ga0157377_107875051 | 3300014745 | Miscanthus Rhizosphere | MRSPFVDSASFLSEPSSDAARRHSLVVSRLLLLALVTAVAASSAVLLAI* |
Ga0157379_114487042 | 3300014968 | Switchgrass Rhizosphere | RPAETAMRSPFVDSASLLSDPPSDARARHSLVVGRLLLLALVTAVAASSAVLLAI* |
Ga0157379_125806941 | 3300014968 | Switchgrass Rhizosphere | AATLPRVSSARHAETAMRSPFVDSASFLSDPSSDAARRQSLVVSRLLLLALVTAVAASSAVLLAI* |
Ga0157376_106159051 | 3300014969 | Miscanthus Rhizosphere | MRSPFVDSASFLSDPSSDAARRQSLVVSRLLLLAMVTAVAASSAGLLA |
Ga0157376_121205722 | 3300014969 | Miscanthus Rhizosphere | MRSPFVDSASFLSEPSSDAARRHSIVVGRLLLLALVTALAASSAVLLAI* |
Ga0132258_112178742 | 3300015371 | Arabidopsis Rhizosphere | MRSPFVDSASFLSAGFDGAARRAPSAIRLLAFALVTAVAASSAVLLAI* |
Ga0132258_119566902 | 3300015371 | Arabidopsis Rhizosphere | MRSPFVDSASFLSEPSADDGRRQSLVVGRLLMFALVVAVAASSAVLLAI* |
Ga0132257_1025035531 | 3300015373 | Arabidopsis Rhizosphere | MRSPFVDSASFLPEPSADDGPRQSLVVGRLLLFALVLAVAASSAVLLAI* |
Ga0182036_109627362 | 3300016270 | Soil | MRSPFVDSASFLSEGFDRVTRRGPSTIRLLAFALVTAVAASSAVLLAI |
Ga0163161_108993372 | 3300017792 | Switchgrass Rhizosphere | MRFPFVDSASFLSGPSPDAARRHSLVVSRLLLLALVMAVAASSAVLLAI |
Ga0190266_106520602 | 3300017965 | Soil | MRTPFVDSASYLPQHAERAPSLVASRLLMLALVVAVAASSAVLLAI |
Ga0190274_105845482 | 3300018476 | Soil | MRSPFVDSASFLSEPSSDAARRQSLVVSRLLLLALVTAVAASSAVLLAI |
Ga0190271_101204422 | 3300018481 | Soil | MRSPFVDSASFFSEPSSDAARRQSLVVSRLLLLALVTAVAASSAVLLAI |
Ga0066669_119259171 | 3300018482 | Grasslands Soil | VDSASFLSEPSSDARRRQSNAVGRLLLFALVVAVAASSAVLLAI |
Ga0190273_120537281 | 3300018920 | Soil | MRTPFVDSASFLSQRSSDAQPRQSLVVGRLLLFALVLAVAASSAVLLAM |
Ga0173479_108247521 | 3300019362 | Soil | MRSPFVDSASFLSEPAPDAARRHSLVVSRLLLLALVMAVAASSAVLLAI |
Ga0210380_100409843 | 3300021082 | Groundwater Sediment | MRSPFVDSASYLPEHAERRPSLVASRLLMLALVVAVAASSAVLLAI |
Ga0210380_103302212 | 3300021082 | Groundwater Sediment | MRSPFVDSASLLSEPSSDAARRHSLIVDRLLLLALVMAVAASSAVLLAI |
Ga0182009_100079304 | 3300021445 | Soil | MRSPFVDSASFLSEGMGAAARRAPSAIRLLAFALVTVVAASSAVLLAI |
Ga0182009_102546622 | 3300021445 | Soil | MRSPFVDSASSLSEGFNVSGRRTWTGIWLLAFALVTAVAASSAVLLAI |
Ga0222622_102589642 | 3300022756 | Groundwater Sediment | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLLAI |
Ga0247772_11101112 | 3300023264 | Plant Litter | MRSPFVDSASFLSEPSSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI |
Ga0207697_100439001 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLAF |
Ga0207697_101644802 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSPFVDSASFLSDPSSDAARRQSLVVSRLLLLALVTAVAASSAVLLAI |
Ga0207682_100246063 | 3300025893 | Miscanthus Rhizosphere | MRSPFVDSASFLSDRPRNSGPRQSIVVGRLLLFALVMAVAASSAVLLAI |
Ga0207680_103199492 | 3300025903 | Switchgrass Rhizosphere | MRSPFVDSASFLPEPSADDGPRQSLIVGRLLLFALVLAVAASSAVLLAI |
Ga0207685_101762062 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSPFVDSASLLSERSSDAARRHSLVVGRLLFFALVMAVAASSAVLLAF |
Ga0207645_102302072 | 3300025907 | Miscanthus Rhizosphere | MRSPFVDSASFLSDPSADEGRRQSLVVGRLLMFALVVAVAASSAVLLAI |
Ga0207654_105113761 | 3300025911 | Corn Rhizosphere | LSEGFAGAARRAPSTIRLLAFALVTAVAASSAVLLAI |
Ga0207657_107993881 | 3300025919 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVL |
Ga0207657_113311001 | 3300025919 | Corn Rhizosphere | MRSPFVDSASFLSAGFGGSGRRAAAGLRLLAFALVTAVAASSAVLIAI |
Ga0207649_102354032 | 3300025920 | Corn Rhizosphere | MRSPFVDSASFLSEGFAGAARRAPFTIRLLAFALVTAVAASSAVLLAI |
Ga0207649_102447002 | 3300025920 | Corn Rhizosphere | SFLSEPSSGAARRHSLVVGRLLMLALVMAVAASSAVLLAI |
Ga0207649_104864581 | 3300025920 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDDARRHSLVVGRLLLLALVMAVAASSAVLLAI |
Ga0207649_108460072 | 3300025920 | Corn Rhizosphere | MRSPFVDSASFLSEPSADVGPRHSLVVGRLLLLALVMAVAASSAVLLAI |
Ga0207681_103457022 | 3300025923 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPSPDAARRHSLVVSRLLLLALVMAVAASSAVLLAI |
Ga0207650_100254592 | 3300025925 | Switchgrass Rhizosphere | MRTPFFVDSASYLSEHSEGRSSLVVSRLLTLALVVAVAASSAVLIAI |
Ga0207650_102134362 | 3300025925 | Switchgrass Rhizosphere | MRSPFVDSASFLSEPLSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI |
Ga0207644_101049523 | 3300025931 | Switchgrass Rhizosphere | MRSPFVDSASILSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLLAI |
Ga0207644_102991132 | 3300025931 | Switchgrass Rhizosphere | MQTPFVDSASYLPEHSERQSSLVATRLLMLALVVAVAASSAVLIAI |
Ga0207665_101581602 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ETVMRSPFVDSASFLSEPSSDAGRRQSNAVGRLLLFALVVAVAASSAVLLAI |
Ga0207691_100331123 | 3300025940 | Miscanthus Rhizosphere | MRTPFFVDSASYLSGHSERRSSLVASRLLTLALVVAVAASSAVLIAI |
Ga0207691_114273162 | 3300025940 | Miscanthus Rhizosphere | MRSPFVDSASLLSDPPSDARARHSLVVGRLLLLALVTAVAASSAVLLAI |
Ga0207711_114688762 | 3300025941 | Switchgrass Rhizosphere | ASLLSDPPSDARARHSLVVGRLLLLALVTAVAASSAVLLAI |
Ga0207679_100173663 | 3300025945 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLMLALVMAVAASSAVLLAI |
Ga0207679_107897293 | 3300025945 | Corn Rhizosphere | MRSPFVDSASFLSDPSSDAARRQSLVVSRLLMLALVTAVAASSAVLLAI |
Ga0207712_105429642 | 3300025961 | Switchgrass Rhizosphere | MRSPFVDSASFLSEGFAGSARRAPSTIRLLAFALVTAVAASSAVLLAI |
Ga0207658_102188581 | 3300025986 | Switchgrass Rhizosphere | MRSPFVDSASFLSDPSSDAARRQSLVVSRLLLLALVTA |
Ga0207677_100603641 | 3300026023 | Miscanthus Rhizosphere | PAETAMASPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLAF |
Ga0207639_110305952 | 3300026041 | Corn Rhizosphere | MRSPFVDSASFLSDPSADESRRQSLVVGRLLMFALVVAVAASSAVLLAI |
Ga0207702_109258791 | 3300026078 | Corn Rhizosphere | MRAPFVDSDSFLSEGPLSGGRRGHRVGIRLLACALVIAVAASSAVLLAL |
Ga0207648_106818111 | 3300026089 | Miscanthus Rhizosphere | MRSPFVDSASFLSAGFGGSGRRAAAGLRLLAFALVTVVAASSAVLIAI |
Ga0207698_103851001 | 3300026142 | Corn Rhizosphere | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAA |
Ga0207698_111588522 | 3300026142 | Corn Rhizosphere | ETSMRSPFVDSASFLSDRPRSSGPRQSIVVGRLLLFALVMAVAASSAVLLAI |
Ga0268265_103163842 | 3300028380 | Switchgrass Rhizosphere | MPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALVMAVAASSAVLLAF |
Ga0247828_100097652 | 3300028587 | Soil | MRSPFVDSASFLSEPSSDAARRHSLIVGRLLLLALVMAVAASSAVLLAI |
Ga0247828_101892122 | 3300028587 | Soil | MRFPFVDSASFLSGPSPDAARRHSLVVSRLLLLALVTAVAASSAVLLAI |
Ga0247821_112387212 | 3300028596 | Soil | MRSPFVDSDSFLSEGPLSGGRRGHRVGIRLLACALVIAVAASSAVLLAL |
Ga0307503_102067322 | 3300028802 | Soil | MRSPFVDSASFLSEPSSDATRRQSLVVSRLLLLALVTAVAASSAVLLAI |
Ga0307503_107515561 | 3300028802 | Soil | MRSPFVDSASFLSDPPSDARARHSLVVGRLLLLALVTAVAASSAVLLAI |
Ga0247827_104723662 | 3300028889 | Soil | SLERRPAEAAMRSPFVDSASFLSEPSSDAARRHSLIVGRLLLLALVMAVAASSAVLLAI |
Ga0307498_100094913 | 3300031170 | Soil | MRSPFVDSASFLSEPSSDAARRHSLVVARLLLLALVTAVAASSAVLLAI |
Ga0307497_106710332 | 3300031226 | Soil | MRSPFVDSASFLSEPSSDAARRHSLVVGRLLLLALVTAVAASSAVLL |
Ga0307506_100921942 | 3300031366 | Soil | MQTPFVDSASYLPEHSERQSSLVATRLLTLALVVAVAASSAVLIAI |
Ga0318516_101894642 | 3300031543 | Soil | LSEGFDRVTRSTPSAIRLLAFALVTAVAASSAVLLAI |
Ga0310886_111006181 | 3300031562 | Soil | MRSPFVDSASFLSEPSADAGPRHSLVVGRLLLLALVMAVAASSAVLLAI |
Ga0318515_102304601 | 3300031572 | Soil | FVDSASFLSEGFDRVTRSTPSAIRLLAFALVTAVAASSAVLLAI |
Ga0318574_107020811 | 3300031680 | Soil | PFVDSASFLSEGFDRVTRSTPSAIRLLAFALVTAVAASSAVLLAI |
Ga0318572_106603122 | 3300031681 | Soil | MRSPFVDSASFLSEGFDRVTRRGPSTILLLAFALVTAVAASSAVLLAI |
Ga0318554_102641262 | 3300031765 | Soil | MRSPFVDSASFVSEGFDLVTRRGPSTIRLLAFALVTAVAASSAVLLAI |
Ga0318554_106390412 | 3300031765 | Soil | SEGFDRVTRSTPSAIRLLAFALVTAIAASSAVLLAI |
Ga0318554_106940292 | 3300031765 | Soil | MHSPFVDSASFLSEGFERVARHGPATIRLLAFALVTAVAASSAILLAI |
Ga0318547_108675601 | 3300031781 | Soil | EGFDRVTRRGPSTIRLLAFALVTAVAASSAVLLAI |
Ga0318512_105530572 | 3300031846 | Soil | SEGFDLVTRRGPSTIRLLAFALVTAVAASSAVLLAI |
Ga0307410_107192652 | 3300031852 | Rhizosphere | MRSPFVDSASFLSEGPVERGRRASAVGIRLLAFALVMAVAASSAVLLAI |
Ga0318551_101225781 | 3300031896 | Soil | AAAIAMRSPFVDSASFVSEGFDLVTRRGPSTIRLLAFALVTAVAASSAVLLAI |
Ga0310891_101257572 | 3300031913 | Soil | MPSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLA |
Ga0308175_1002619701 | 3300031938 | Soil | MRSPFVDSASFLSPGPPERDHRAAAVSTRLLAFALVMAIAASSAVLIA |
Ga0308175_1030917802 | 3300031938 | Soil | MRSPFVDSASFLSERAPHTGPRQSLVVGRLLLLALVMAVAASSAVLLAI |
Ga0308174_100416233 | 3300031939 | Soil | AMRTPFVHSASYLSEPAERAPSLVTSRLLTFALVVAVAASSAVLIAI |
Ga0308174_101059472 | 3300031939 | Soil | MRSPFVDSASFLSRPSPEARSRQSPIAGRLLLFALVVAVAASSAVLLAI |
Ga0308174_101916874 | 3300031939 | Soil | MRTPFVDSASYLSEPAERAPSLVTSRLLTFALVVAVAASSAVLIAI |
Ga0308174_102249932 | 3300031939 | Soil | MRSPFVDSASFLSERAPDLGPRQSLVVGRLLMFALVLAVAASSAVLLAI |
Ga0308174_106376822 | 3300031939 | Soil | MPSPFVDSASFLSEPSPGEPRRHSLAVGRLLLLGLVMAVAASSAVLLAF |
Ga0306922_101591102 | 3300032001 | Soil | MRSPFVDSASFVSEGFDRVTRRGPSTIRLLAFALVTAVAASSAVLLAI |
Ga0318553_103157352 | 3300032068 | Soil | ASFLSEGFDRVTRRAPSTIRLLAFALVTAVAASSAVLLAI |
Ga0308173_113747231 | 3300032074 | Soil | FVDSASLLSERAPDARPRQSVVIGRLLLLALVMAVAASSAVLLAI |
Ga0247829_106030261 | 3300033550 | Soil | PSPFVDSASFLTEPSSDAARRHSLLVGRLLLLALMMAVAASSAVLLAF |
Ga0370484_0118711_553_696 | 3300034125 | Untreated Peat Soil | MRSPFVDSASFLSDRPTDAGSRHSTVVGRLLMLALVMAVAASSAVLLA |
⦗Top⦘ |