NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034733

Metagenome / Metatranscriptome Family F034733

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034733
Family Type Metagenome / Metatranscriptome
Number of Sequences 174
Average Sequence Length 38 residues
Representative Sequence ELREAQPAAGQFTVQLNGDERAIGEKAAAGLFVRPD
Number of Associated Samples 153
Number of Associated Scaffolds 174

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.47 %
% of genes near scaffold ends (potentially truncated) 93.10 %
% of genes from short scaffolds (< 2000 bps) 93.10 %
Associated GOLD sequencing projects 147
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.713 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.965 % of family members)
Environment Ontology (ENVO) Unclassified
(27.586 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.851 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 26.56%    Coil/Unstructured: 73.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 174 Family Scaffolds
PF02773S-AdoMet_synt_C 44.25
PF14014DUF4230 5.75
PF01370Epimerase 4.02
PF01522Polysacc_deac_1 2.87
PF16363GDP_Man_Dehyd 2.87
PF03640Lipoprotein_15 2.87
PF00583Acetyltransf_1 1.72
PF07479NAD_Gly3P_dh_C 1.72
PF00152tRNA-synt_2 1.15
PF04023FeoA 1.15
PF01797Y1_Tnp 1.15
PF01810LysE 1.15
PF02649GCHY-1 0.57
PF00571CBS 0.57
PF01243Putative_PNPOx 0.57
PF01451LMWPc 0.57
PF13549ATP-grasp_5 0.57
PF02742Fe_dep_repr_C 0.57
PF05199GMC_oxred_C 0.57
PF00230MIP 0.57
PF14333DUF4389 0.57
PF01566Nramp 0.57
PF00378ECH_1 0.57
PF00296Bac_luciferase 0.57
PF14329DUF4386 0.57
PF13683rve_3 0.57
PF14714KH_dom-like 0.57
PF00291PALP 0.57
PF13231PMT_2 0.57
PF11258DUF3048 0.57
PF11832DUF3352 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 174 Family Scaffolds
COG0192S-adenosylmethionine synthetaseCoenzyme transport and metabolism [H] 44.25
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 2.87
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 2.87
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.72
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.15
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.15
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 1.15
COG1918Fe2+ transport protein FeoAInorganic ion transport and metabolism [P] 1.15
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.15
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 1.15
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.57
COG1321Mn-dependent transcriptional regulator MntR, DtxR familyTranscription [K] 0.57
COG1469GTP cyclohydrolase FolE2Coenzyme transport and metabolism [H] 0.57
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 0.57
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.57
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.01 %
UnclassifiedrootN/A22.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig40726All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c1779780Not Available809Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104839707Not Available667Open in IMG/M
3300000891|JGI10214J12806_11680601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium500Open in IMG/M
3300001334|A2165W6_1035246All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii913Open in IMG/M
3300004643|Ga0062591_100956573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300005179|Ga0066684_10521811All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300005181|Ga0066678_10738657All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005181|Ga0066678_10883668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300005327|Ga0070658_11688961All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005329|Ga0070683_100593766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300005450|Ga0066682_10855116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales545Open in IMG/M
3300005554|Ga0066661_10835446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300005560|Ga0066670_10453508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300005563|Ga0068855_102558266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300005564|Ga0070664_100403128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1251Open in IMG/M
3300005576|Ga0066708_10437179All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005576|Ga0066708_10484838All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005614|Ga0068856_100294098All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300005764|Ga0066903_101887679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1144Open in IMG/M
3300005903|Ga0075279_10109972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300006163|Ga0070715_10328571Not Available828Open in IMG/M
3300006173|Ga0070716_101092193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300006173|Ga0070716_101202224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales609Open in IMG/M
3300006755|Ga0079222_11377012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300006903|Ga0075426_10502912All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium901Open in IMG/M
3300006904|Ga0075424_100313794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1669Open in IMG/M
3300006953|Ga0074063_14053751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300006954|Ga0079219_11365544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300009012|Ga0066710_103262671Not Available621Open in IMG/M
3300009012|Ga0066710_104361724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300009038|Ga0099829_11140285Not Available646Open in IMG/M
3300009094|Ga0111539_13047427Not Available541Open in IMG/M
3300009100|Ga0075418_12253077All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium594Open in IMG/M
3300009148|Ga0105243_12086087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium602Open in IMG/M
3300009162|Ga0075423_10405947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1430Open in IMG/M
3300009661|Ga0105858_1178336Not Available613Open in IMG/M
3300009810|Ga0105088_1032752Not Available844Open in IMG/M
3300009840|Ga0126313_11035064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300010041|Ga0126312_11015579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300010152|Ga0126318_10489284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300010301|Ga0134070_10416856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300010337|Ga0134062_10103430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1225Open in IMG/M
3300010371|Ga0134125_12635600Not Available546Open in IMG/M
3300010373|Ga0134128_10970474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium940Open in IMG/M
3300010375|Ga0105239_11055819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium935Open in IMG/M
3300010376|Ga0126381_104983549All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300010395|Ga0058701_10814453Not Available510Open in IMG/M
3300010403|Ga0134123_11068913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria828Open in IMG/M
3300011119|Ga0105246_12477979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300012001|Ga0120167_1029230Not Available1320Open in IMG/M
3300012003|Ga0120163_1106882All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300012014|Ga0120159_1065005All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300012014|Ga0120159_1161182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300012204|Ga0137374_10277448All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300012207|Ga0137381_11161859All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012210|Ga0137378_11688775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300012353|Ga0137367_10241884All Organisms → cellular organisms → Bacteria → Terrabacteria group1299Open in IMG/M
3300012354|Ga0137366_10735483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300012355|Ga0137369_11092389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300012358|Ga0137368_10134405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1850Open in IMG/M
3300012502|Ga0157347_1029864Not Available678Open in IMG/M
3300012529|Ga0136630_1378128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012532|Ga0137373_10445370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300012532|Ga0137373_10516565All Organisms → cellular organisms → Bacteria → Terrabacteria group910Open in IMG/M
3300012668|Ga0157216_10229236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium871Open in IMG/M
3300012899|Ga0157299_10177697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium624Open in IMG/M
3300012906|Ga0157295_10224026Not Available614Open in IMG/M
3300012915|Ga0157302_10215635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300012923|Ga0137359_10645656Not Available925Open in IMG/M
3300012944|Ga0137410_11876809Not Available530Open in IMG/M
3300012948|Ga0126375_12093021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300012955|Ga0164298_11608395Not Available512Open in IMG/M
3300012958|Ga0164299_11069428All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012958|Ga0164299_11088350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300012958|Ga0164299_11166254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300012960|Ga0164301_10296582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300012971|Ga0126369_13618099Not Available506Open in IMG/M
3300012985|Ga0164308_11654281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300012989|Ga0164305_10839947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300012989|Ga0164305_11102530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300013100|Ga0157373_10426514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria952Open in IMG/M
3300013102|Ga0157371_10982574Not Available643Open in IMG/M
3300013104|Ga0157370_10802753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300013296|Ga0157374_11323138Not Available743Open in IMG/M
3300013296|Ga0157374_11666627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300013297|Ga0157378_10858061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300013307|Ga0157372_10284410All Organisms → cellular organisms → Bacteria1923Open in IMG/M
3300013307|Ga0157372_11881532All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii688Open in IMG/M
3300013427|Ga0120106_1084217All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300013763|Ga0120179_1014224All Organisms → cellular organisms → Bacteria2015Open in IMG/M
3300013765|Ga0120172_1006685All Organisms → cellular organisms → Bacteria3919Open in IMG/M
3300014157|Ga0134078_10082006All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300014487|Ga0182000_10478433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300015201|Ga0173478_10003240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3647Open in IMG/M
3300015357|Ga0134072_10183988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium712Open in IMG/M
3300015373|Ga0132257_103105626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300016357|Ga0182032_11076577Not Available689Open in IMG/M
3300017654|Ga0134069_1249981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300017994|Ga0187822_10094924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium903Open in IMG/M
3300018000|Ga0184604_10165076Not Available739Open in IMG/M
3300018056|Ga0184623_10303231Not Available721Open in IMG/M
3300018431|Ga0066655_11108555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300018433|Ga0066667_10898883All Organisms → cellular organisms → Bacteria → Terrabacteria group761Open in IMG/M
3300018466|Ga0190268_12198854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300018920|Ga0190273_12211112Not Available517Open in IMG/M
3300019361|Ga0173482_10374912Not Available653Open in IMG/M
3300019884|Ga0193741_1125203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia648Open in IMG/M
3300020081|Ga0206354_10096275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300021080|Ga0210382_10010653All Organisms → cellular organisms → Bacteria3113Open in IMG/M
3300021445|Ga0182009_10803408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300021510|Ga0222621_1039550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300021510|Ga0222621_1093345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300021560|Ga0126371_10663669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300022467|Ga0224712_10488996All Organisms → cellular organisms → Eukaryota594Open in IMG/M
3300024055|Ga0247794_10059725All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300024055|Ga0247794_10252288Not Available583Open in IMG/M
3300024181|Ga0247693_1064198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300024287|Ga0247690_1002035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2707Open in IMG/M
3300025878|Ga0209584_10212754All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300025878|Ga0209584_10398976All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium531Open in IMG/M
3300025906|Ga0207699_10937222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300025912|Ga0207707_10167933All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300025924|Ga0207694_10227215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Anophelinae → Anopheles → Cellia1523Open in IMG/M
3300025927|Ga0207687_10431771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300025928|Ga0207700_11361568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300025937|Ga0207669_10034823All Organisms → cellular organisms → Bacteria2858Open in IMG/M
3300025939|Ga0207665_10043867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2991Open in IMG/M
3300025939|Ga0207665_10968801All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium676Open in IMG/M
3300025945|Ga0207679_12195184Not Available501Open in IMG/M
3300025949|Ga0207667_12160203Not Available514Open in IMG/M
3300025981|Ga0207640_10430390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium1082Open in IMG/M
3300025981|Ga0207640_11510022Not Available604Open in IMG/M
3300025989|Ga0207998_1035337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300026116|Ga0207674_10800879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300026121|Ga0207683_10785708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi883Open in IMG/M
3300026221|Ga0209848_1049059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300026221|Ga0209848_1060152Not Available680Open in IMG/M
3300026542|Ga0209805_1063870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1805Open in IMG/M
3300027748|Ga0209689_1223668All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300027873|Ga0209814_10119404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1124Open in IMG/M
3300027907|Ga0207428_10501541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria881Open in IMG/M
3300027909|Ga0209382_11358411Not Available716Open in IMG/M
3300028556|Ga0265337_1180012All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300028573|Ga0265334_10166201All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300028705|Ga0307276_10215477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300028708|Ga0307295_10085176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300028714|Ga0307309_10107378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300028718|Ga0307307_10027986Not Available1590Open in IMG/M
3300028718|Ga0307307_10299342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300028721|Ga0307315_10100492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300028744|Ga0307318_10114978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium915Open in IMG/M
3300028755|Ga0307316_10097747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300028771|Ga0307320_10006572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium4142Open in IMG/M
3300028771|Ga0307320_10118924Not Available1011Open in IMG/M
3300028791|Ga0307290_10158540Not Available829Open in IMG/M
3300028799|Ga0307284_10081896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1184Open in IMG/M
3300028799|Ga0307284_10147479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium906Open in IMG/M
3300028828|Ga0307312_10392287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium911Open in IMG/M
3300028828|Ga0307312_10644332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300030785|Ga0102757_11480973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300030830|Ga0308205_1016513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
3300031711|Ga0265314_10063793All Organisms → cellular organisms → Bacteria2497Open in IMG/M
3300031716|Ga0310813_11904366Not Available560Open in IMG/M
3300031821|Ga0318567_10021621All Organisms → cellular organisms → Bacteria3119Open in IMG/M
3300031832|Ga0318499_10249733Not Available689Open in IMG/M
3300031879|Ga0306919_10087261Not Available2166Open in IMG/M
3300031911|Ga0307412_11877887Not Available552Open in IMG/M
3300032074|Ga0308173_11755278Not Available585Open in IMG/M
3300032783|Ga0335079_10492146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1309Open in IMG/M
3300032829|Ga0335070_10708776Not Available940Open in IMG/M
3300033004|Ga0335084_10954543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300034195|Ga0370501_0109781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.90%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.02%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.72%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.72%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.15%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.15%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.15%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.15%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.15%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.15%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.15%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.15%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.57%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.57%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.57%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.57%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.57%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.57%
Arabidopsis RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere0.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.57%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.57%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001334Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012502Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610Host-AssociatedOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013427Permafrost microbial communities from Nunavut, Canada - A15_35cm_18MEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300024287Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025989Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0726.000029302166559005SimulatedVTSSEPAADEFVVRLNGGNQSISERAAAGLFVRAA
ICChiseqgaiiDRAFT_177978013300000033SoilTKLELREAQPAAGQFTVKVDGKEQSIAEKAAAGLFVKPQ*
INPhiseqgaiiFebDRAFT_10483970713300000364SoilELTATQPAAGQLTVRVDGGEKAISERAAEGLFVRPTA*
JGI10214J12806_1168060123300000891SoilVEVRDTQPAAEQLTVRLNGDEQTIAEKAAAGLFVRPAG*
A2165W6_103524613300001334PermafrostLEVQETQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPA*
Ga0062591_10095657313300004643SoilTEVEVREAQPAAEQLTVRLNGGERTIAEKAAAGLFVRPA*
Ga0066684_1052181133300005179SoilGTQVEVREAQPAAEQLTVRLNGDERTIAEKAAAGLFVRPV*
Ga0066678_1073865723300005181SoilSRTALEVRETQPAAEQLTVRVNGDERAISEKAAAGLFVRAV*
Ga0066678_1088366823300005181SoilTSILVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS*
Ga0070658_1168896113300005327Corn RhizospherePGADVELRAVEAAAGQFRVALGGSEKAIGERAAEGLYVKRV*
Ga0070683_10059376613300005329Corn RhizosphereVVELRAAEPAAGQLRVAVGGVEKSIGEKAADGLFVRPAA*
Ga0066682_1085511613300005450SoilIELRSAEPAADQFTVGLDGGERAISEKAAAGLFVRPAAS*
Ga0066661_1083544613300005554SoilELEVRDAQPAAGQMTVALNGTEQAIGEKAAAGLFVRPG*
Ga0066670_1045350823300005560SoilKIELREAQPAAGQFTVRRGGEDRAIGEKAAAGLFVKQL*
Ga0068855_10255826623300005563Corn RhizosphereIELRDAQPAAGQFTVRREGEDRAIGEKAAAGLFVKPV*
Ga0070664_10040312833300005564Corn RhizosphereSDAQPAAGQFTVKVDGREQAIAEKAAAGLFVKAE*
Ga0066708_1043717923300005576SoilEAQPAAGQMTVRLNGTERAIGDKAAAGLFVRPAA*
Ga0066708_1048483833300005576SoilGTQVEVREAQPAAEQLTVRLNGDERTIAEKAAAGLFVRPA*
Ga0068856_10029409813300005614Corn RhizosphereGQQVEIRAATPAADQFTISLGDGEQAISEKAAAGLFVKLVA*
Ga0066903_10188767913300005764Tropical Forest SoilAVESAAGQYRVLVAGGEQAIGEKAAAGLFVRPASA*
Ga0075279_1010997223300005903Rice Paddy SoilVERADAAADQFVVRVGDRSRAVSEKAAAGLFVRPG*
Ga0070715_1032857123300006163Corn, Switchgrass And Miscanthus RhizosphereAAEPAAGQLRVSVGGVEMAIGDKAAAGLYVKPAA*
Ga0070716_10109219313300006173Corn, Switchgrass And Miscanthus RhizosphereGTSILVRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS*
Ga0070716_10120222413300006173Corn, Switchgrass And Miscanthus RhizosphereEIELRTAEPAADQFTVGLEGGERAISEKAAAGLFVRPAAS*
Ga0079222_1137701213300006755Agricultural SoilELQSAEPAADQFTIRLDGSERAVSEKAAAGLFVQPAA*
Ga0075426_1050291213300006903Populus RhizosphereVQTAEPAADQFTVAVDGGERAVSEKAAAGLFVRPA*
Ga0075424_10031379433300006904Populus RhizosphereQLESAEPAAGQFTVRLNGSTRAVGERAAAGLFVRRAA*
Ga0074063_1405375123300006953SoilILVRTAEPAADQFTVSVEKVGERAISEKAAAGLFVRPS*
Ga0079219_1136554413300006954Agricultural SoilTSILVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPA*
Ga0066710_10326267113300009012Grasslands SoilLQSAQPAAGQFTVKVDGSEKAIGEKAAAGLFVRPT
Ga0066710_10436172423300009012Grasslands SoilGTELEIREAQPAAEQLTVRVNGDERAISEKAAAGLFVRAV
Ga0099829_1114028523300009038Vadose Zone SoilVLRASEPAAGQFRVKLDGTEKAIGEKAAAGLFVKPA*
Ga0111539_1304742713300009094Populus RhizosphereQLELQAAQPAAGQFTVKVDGSEKAIGEKAAAGLFVKPA*
Ga0075418_1225307733300009100Populus RhizosphereAAEPAAGQLRVVVDGVEKAIGEKAAAGLFVKRAA*
Ga0105243_1208608723300009148Miscanthus RhizosphereRETQPAADQLTVRLNGHEQTIAEKAAAGLFVRHG*
Ga0075423_1040594713300009162Populus RhizosphereLRDAQPAAGQFTVKVDGREHAIAEKAAAGLFVKPE*
Ga0105858_117833623300009661Permafrost SoilMRRAEPAADQFTIGFLDDGTPSSGDRAISEKAAAGLFVKPAA*
Ga0105088_103275223300009810Groundwater SandELRAAPAAGQFTLKVHGDERAIEEKAAAGLFVRPAA*
Ga0126313_1103506413300009840Serpentine SoilLREAQPAAGQFTLRVKGAERAIGEKAAAGLFVRPV*
Ga0126312_1101557923300010041Serpentine SoilAVEVREAQPAAEQLTVRLDGGEQTIGEKAAAGLFVRAATASK*
Ga0126318_1048928413300010152SoilLVRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS*
Ga0134070_1041685613300010301Grasslands SoilLGDATRPDGGEFTVKVNGDERAIGEKAAAGLFVRPA*
Ga0134062_1010343033300010337Grasslands SoilLVPGTSILVRTAEPAADQFTVSIEKVGERAISEKAAAGLFVRRS*
Ga0134125_1263560023300010371Terrestrial SoilVTSAEPAAGQVVVRLNGDERSIGERAAGGLFVRPA*
Ga0134128_1097047433300010373Terrestrial SoilVEVRETQPAADQLTVRLNGHEQTIAEKAAAGLFVRPAG*
Ga0105239_1105581913300010375Corn RhizosphereIELRSAEPAADQFTVSLDGGDRAVSERAAAGLFVKLV*
Ga0126381_10498354923300010376Tropical Forest SoilRNAAPAADQFTVAIEKVGERAISEKAAAGLFVRPS*
Ga0058701_1081445323300010395AgaveVREVAPAAEQLTVGLDGQEQTIAEKAAAGLFVRPTPSK*
Ga0134123_1106891313300010403Terrestrial SoilFTPGTKIELRDAQPAAGQFTVRREGEDQAIGEKAAAGLFVKLS*
Ga0105246_1247797923300011119Miscanthus RhizosphereVEVREAQPAAEQLTVRLNGGEQTIAEKAAAGLFVRPA*
Ga0120167_102923033300012001PermafrostVPGTAVELRAAEPAAGQFRVVVDGREQAIGEKAADGLFVKRA*
Ga0120163_110688223300012003PermafrostPGQQIEMRSAEPAADQFTIGVENDGERAISEKAASGLFVRTLR*
Ga0120159_106500513300012014PermafrostIELREAQPAAGQLTVKLNGDERAIGEKAAAGLFVRPAA*
Ga0120159_116118233300012014PermafrostPEPAADQFTVGLDGGERAISEKAAAGLFVRPAAS*
Ga0137374_1027744833300012204Vadose Zone SoilELRAAPTVGQFTLKVNGGERAIEEKAAAGLFVRPS*
Ga0137381_1116185923300012207Vadose Zone SoilGQEIEVRTAASAADQFTVGLDGGERAISEKAAAGLFVRPVRA*
Ga0137378_1168877523300012210Vadose Zone SoilVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPA*
Ga0137367_1024188413300012353Vadose Zone SoilEVEVREAQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPAG*
Ga0137366_1073548323300012354Vadose Zone SoilREIEVRDAQPAAGQMTVRLNGKEQAIGEKAAAGLFVRPRDS*
Ga0137369_1109238913300012355Vadose Zone SoilEIEVEATHPEAGQFTVRLNGDERAVSEKAAAGLFVRPE*
Ga0137368_1013440533300012358Vadose Zone SoilGREIEVEATHPEAGQFTVRLNGDERAVSEKAAAGLFVRPE*
Ga0157347_102986413300012502Arabidopsis RhizosphereTAAEPAAGQLRVRLGGAEKTIGDKAADGLFVRPSR*
Ga0136630_137812823300012529Polar Desert SandVELREAQPAAGQFKVCLAGAERAIGEKAAAGLYVKLVG*
Ga0137373_1044537023300012532Vadose Zone SoilVEATHPEAGQFTVRLNGDERAVSEKAAAGLFVRPE*
Ga0137373_1051656523300012532Vadose Zone SoilGREIELAEVAGELTVRLNGDERKVGEKAAAGLFVRPA*
Ga0157216_1022923613300012668Glacier Forefield SoilAQPAAGQFKISLAGTERAIGEKAAAGLYVRALVAS*
Ga0157299_1017769713300012899SoilEVEVRETQPAAEQLTVHLDGHEQTIAEKAAAGLFVRPTG*
Ga0157295_1022402623300012906SoilRELEVRAVNPEADEMTIALDGTERAIGEKAAAGLFVRSA*
Ga0157302_1021563523300012915SoilRDAQPAAGQLTVGLNGDEREVGERAAAGLFVRLS*
Ga0137359_1064565613300012923Vadose Zone SoilEIVLRASQPAAGQFRVKLDGAEKAIGEKAAAGLFVKPA*
Ga0137410_1187680923300012944Vadose Zone SoilMRSSEPAADQFTIGLIDNGAPDGERAISEKAAAGLFVKPA*
Ga0126375_1209302123300012948Tropical Forest SoilEVEVREAQPAAEQLTVSLDGHEQTIAEKAAAGLFVRPTASK*
Ga0164298_1160839523300012955SoilPGQEIELRSAEPAADQFTVSLDGSDRAVSERAAAGLFVRLA*
Ga0164299_1106942823300012958SoilLSLGGEVVELRAVEPAAGQFRVAVGGVEKAIGEKAAGGLFVRR*
Ga0164299_1108835023300012958SoilEVRDAQTAAAQVTVKLNGQERAIGEQAAAGLFARPA*
Ga0164299_1116625423300012958SoilEVQETQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPA*
Ga0164301_1029658223300012960SoilEVRETQPAAEQLTVQLNGHEQTIAEKAAAGLFVRPG*
Ga0126369_1361809923300012971Tropical Forest SoilLQAAEPAAGQFTVRIDGAEKAIGEKAAAGLFVRPES*
Ga0164308_1165428123300012985SoilTPGTKSELRDAQPAAGQFTVRREGEDRAIGEKAAAGLFVKPV*
Ga0164305_1083994723300012989SoilVPGTPLELRAAEPAAGQFRITINGGEKAISEKAAAGLFVKRG*
Ga0164305_1110253023300012989SoilSSEPAADQFTIALDGGVRAVSEKAAAGLFVKPAA*
Ga0157373_1042651423300013100Corn RhizosphereLVRTAEPAADQFTVAIEHVGERAISEKAAAGLFVRPA*
Ga0157371_1098257423300013102Corn RhizosphereRETQPAADQLTVRLNGHEQTIAEKAAAGLFVRPG*
Ga0157370_1080275313300013104Corn RhizosphereLVPGEVVELRAAEPAAGQFRVVVGGVEKAIGERAAGGLFVRR*
Ga0157374_1132313813300013296Miscanthus RhizosphereMCEGIETRSAEPAADQFTVSLDGGDRAVSERAAAGLFVKLV*
Ga0157374_1166662723300013296Miscanthus RhizosphereRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS*
Ga0157378_1085806133300013297Miscanthus RhizosphereAQPAAEQLTVRLDGHEQTIAEKAAAGLFVRPSGSK*
Ga0157372_1028441013300013307Corn RhizosphereILVRTAEPASDQFTVAIEKIGERAISEKAAAGLFVRPSG*
Ga0157372_1188153213300013307Corn RhizosphereLRAAEPAAGQFRVAVGGVEKAIGEKAAGGLFVRR*
Ga0120106_108421723300013427PermafrostIAEPAADQFTIGVENDGERAISEKAASGLFVRTLR*
Ga0120179_101422433300013763PermafrostVEIELREPQPAAGQLTVKLNGDERAIGEKAAAGLFVRPAA*
Ga0120172_100668553300013765PermafrostEAQPAAGQLTVKLNGDERAIGEKAAAGLFVRPAA*
Ga0134078_1008200613300014157Grasslands SoilILVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPSG*
Ga0182000_1047843313300014487SoilLAGAAEPAAGTFTVALNGDERAIGEKAAAGLFVKPER*
Ga0173478_1000324013300015201SoilGAKIELREVQPAAGQFTVKLKGREQAIGEKAAAGLFVKPQ*
Ga0134072_1018398813300015357Grasslands SoilAEPAAGQFTVRVDGSEKAIGEKAAAGLFVRPESR*
Ga0132257_10310562623300015373Arabidopsis RhizosphereEVRAFEPAAEQMTVRLNGSERAIGDRAAACLFVRRTA*
Ga0182032_1107657723300016357SoilELEVRAVEPAAGQFRVTVAGGEQAIGEKAAAGLYVRPA
Ga0134069_124998113300017654Grasslands SoilREIEVRDAQPAAGQMTVKLNGQERAIGEKAAAGLFVRPA
Ga0187822_1009492423300017994Freshwater SedimentMPAAARSAEPAADQFTIGVGRGGRGRAISEKAAAGLFVKPV
Ga0184604_1016507613300018000Groundwater SedimentVLKAAEPAAGQFRVRLAGAEKAIGEKAAAGLFVKPR
Ga0184623_1030323123300018056Groundwater SedimentVQLREAQPAAGLFTVVIGGREQAIGEKAAAGLFVKPS
Ga0066655_1110855523300018431Grasslands SoilRAAQPEAGQFTVRLNGHERAIGERAAAGLFVRQAD
Ga0066667_1089888313300018433Grasslands SoilGRELVVRDAQPAAGQMTVALNGAEQAIGEKAAAGLFVRPD
Ga0190268_1219885413300018466SoilIRRAEPAAGQFAVTVNGDERAIGEKAAAGLFVRPAT
Ga0190273_1221111223300018920SoilLRESQPEEGPITVKLNGGEREIGERAAAGLFVRAA
Ga0173482_1037491213300019361SoilELRAAEPAAGQLRVAVGGVEKSIGEKAADGLFVRPAA
Ga0193741_112520313300019884SoilIEVRTAGPVTGLTVKLNGGERAVSEKAAAGLFVRPA
Ga0206354_1009627523300020081Corn, Switchgrass And Miscanthus RhizosphereLVVTAAEPAADQFTVTLGTDGERAISEKAAAGLFVRPSSA
Ga0210382_1001065313300021080Groundwater SedimentELKSAQPAAGQFTVKVDGSEKAIGEKAAAGLFVRPA
Ga0182009_1080340813300021445SoilVRTAEPAADQFTVAIEKVGERAISEKAAAGLFVRPA
Ga0222621_103955013300021510Groundwater SedimentVPGTTIELRTAEPGGEFTLKVNGDERAIDEKAAAGLFVRPAA
Ga0222621_109334513300021510Groundwater SedimentELRAAEPAAGQLRVAVDGVEKSIGEKAADGLFVRVG
Ga0126371_1066366933300021560Tropical Forest SoilVEVRESQPAAEQLTVRLDGHEQTIAEKAAAGLFVRPSVSK
Ga0224712_1048899623300022467Corn, Switchgrass And Miscanthus RhizosphereRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS
Ga0247794_1005972513300024055SoilVPGTKLELRDAQPAAGQFTVRRNGEDQAIGEKAAAGLFVKRG
Ga0247794_1025228823300024055SoilQVSSAEPAAGQVTVKLNGDERSIGERAAGGLFVRPA
Ga0247693_106419823300024181SoilEVRETQPAADQLTVRLNDHEQTIAEKAAAGLFVRPG
Ga0247690_100203513300024287SoilRTAEPAADQFTVSIEKVGERAISEKAAAGLFVRPS
Ga0209584_1021275423300025878Arctic Peat SoilPGQEIEMRSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPAAA
Ga0209584_1039897613300025878Arctic Peat SoilSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPAAA
Ga0207699_1093722223300025906Corn, Switchgrass And Miscanthus RhizosphereQEIEMRRAEPAADQFTVALINGGGNDERAISEKAAAGLFVKPA
Ga0207707_1016793333300025912Corn RhizosphereLRAAEPAAGQFRVTVNDDEKAIGEKAADGLYVRRG
Ga0207694_1022721513300025924Corn RhizosphereVELRAAEPAAGQFRVAVGGVEKAIGEKAAGGLFVRR
Ga0207687_1043177123300025927Miscanthus RhizosphereKLQVSSAEPAAGQVTVKLNGDERSIGERAAGGLFVRPA
Ga0207700_1136156813300025928Corn, Switchgrass And Miscanthus RhizosphereELRAAEPAAGQFRVVVDGREQSVGEKAADGLFVKRAA
Ga0207669_1003482333300025937Miscanthus RhizosphereELELRAAETAAGQFRVAVDGGEKAIGEKAAAGLFVKAA
Ga0207665_1004386743300025939Corn, Switchgrass And Miscanthus RhizosphereAEPAAGQFTVRLNSSTRAVGEKAAAGLFVRRAACADRG
Ga0207665_1096880113300025939Corn, Switchgrass And Miscanthus RhizosphereRTAASAADQFTVGLDGGERAISEKAAAGLFVRARD
Ga0207679_1219518423300025945Corn RhizosphereTLEVVAAEPAAGQFTITLDGRERAVGDKAAAGLFVRRGS
Ga0207667_1216020333300025949Corn RhizosphereAEVEVRETQPAAEQLTVHLDGHEQTIAEKAAAGLFVRPTG
Ga0207640_1043039013300025981Corn RhizosphereVEVQETQPAADQLTVRLNGHEQTIAEKAAAGLFVRPAG
Ga0207640_1151002223300025981Corn RhizosphereELQAAQPAAGQFTVKVDGNEKAIGEKAAAGLFVRPT
Ga0207998_103533723300025989Rice Paddy SoilVVRADAAADQFVVRVGDRSRAVSEKAAAGLFVRPG
Ga0207674_1080087923300026116Corn RhizosphereVPGTPLELRAAEPAAGQFRITINGGEKAISEKAAAGLFVKRG
Ga0207683_1078570823300026121Miscanthus RhizosphereEREIEVEAAHPEAGQFTVRLNGDKRAVGDKAAAGLFVRPA
Ga0209848_104905923300026221Permafrost SoilVPGAAVELRAVEAAAGQYRVVVDGREQAIGEKAADGLFVRRAP
Ga0209848_106015223300026221Permafrost SoilMRRAEPAADQFTIGFLDDGTPSSGDRAISEKAAAGLFVKPAA
Ga0209805_106387013300026542SoilVRQAQPAAEQLTVRLNGGERTIAEKAAAGLFVRPA
Ga0209689_122366823300027748SoilEIEIGDPQPAAGQITVRLNGAERAIGEKAAAGLFVKPS
Ga0209814_1011940423300027873Populus RhizosphereRELEVRDCEPAAGQMTVRLNGAERAIGEKAAAGLFVKPA
Ga0207428_1050154113300027907Populus RhizosphereIEVRKAQPSAGQFTVRVNGDERAIGEKAAAGLFVRPAA
Ga0209382_1135841123300027909Populus RhizosphereHVEVRAAHPEAGQFTVTLDGGERAIGEKAAAGLFVRPEG
Ga0265337_118001213300028556RhizosphereGQEIEMRSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPSAG
Ga0265334_1016620123300028573RhizosphereQEIEMRSAQPAADQFTIRLIDGETPDGERAISEKAAAGLFVKPSAG
Ga0307276_1021547723300028705SoilELRAAEPAAGQLRVGVGGAEKAIGDKAAAGLFVRPAA
Ga0307295_1008517623300028708SoilEIEVREAHPAAGQVTVKLNGQDRAIGEKAAAGLFVRPA
Ga0307309_1010737823300028714SoilEVREAHPAAGQVTVKLNGQDRAIGEKAAAGLFVRPA
Ga0307307_1002798633300028718SoilLKSAQPAAGQFTVKVDGSEKAIGEKAAAGLFVRPA
Ga0307307_1029934223300028718SoilVPEREIQVEAAHPEAGQFTVRLNGDQRAVSEKAAAGLFVRPA
Ga0307315_1010049233300028721SoilELREAQPAAGQFTVQLNGDERAIGEKAAAGLFVRPD
Ga0307318_1011497823300028744SoilIEVREAQPAAGQVTVKLNGQDRAIGEKAAAGLFVRPA
Ga0307316_1009774713300028755SoilEVEVREAQPAAEQLTVRLNGGDRTIAEKAAAGLFVRPA
Ga0307320_1000657213300028771SoilREAQPAAEQLTVRLNGHEQTIAEKAAAGLFVRPAS
Ga0307320_1011892423300028771SoilQLREAQPAAGQFTVKLNGREQAIGEKAAAGLFVKPA
Ga0307290_1015854023300028791SoilEVSDAPAKGEFALKVNGDERSIDEKAAAGLFVRAA
Ga0307284_1008189613300028799SoilPCTELEVQETQPAAEQLTVRLNGDEKTIAEKAAAGLFVRPA
Ga0307284_1014747923300028799SoilEIEVRDAQPAAGQMTVRLNGGDRAIGEKAAAGLFVRPG
Ga0307312_1039228713300028828SoilQEIDVRTAASAADQFTVGLDDGERAISEKAAAGLFVRPVPA
Ga0307312_1064433223300028828SoilRAAQPAAGQFTVKLNGDERAIGEKAAAGLFVRPAA
Ga0247826_1072280523300030336SoilVEVREAQHAADQLKVLLDGRERAISEKAAGGLYVKASS
Ga0102757_1148097313300030785SoilTTVELREAGSGADRFTVKVNGDERAIGEKAAAGLFVRPA
Ga0308205_101651313300030830SoilTVELCEAGAGRDQFTVEVDGDERAIGEKAAAGLFVRPA
Ga0265314_1006379333300031711RhizosphereLHAAQPAADQFTVKLDGGERAVSARAAAGLFVRPS
Ga0310813_1190436613300031716SoilGAEIQLESAEPAAGQFTVRLNGSTRAVGEKAAAGLFVRRAA
Ga0318567_1002162113300031821SoilIELRAAQPAAGQFQIALGGREMAIGEKAAAGLYVRPA
Ga0318499_1024973313300031832SoilLEVRAVESAAGQFRVTVGGGEQAIGEKAAAGLYVRPA
Ga0306919_1008726113300031879SoilEVRAVESAAGQFRVTVGGGEQAIGEKAAAGLYVRPA
Ga0307412_1187788723300031911RhizosphereTVELRAAPTAGQFTLKVNGGERAIEEKAAAGLFVRPS
Ga0308173_1175527823300032074SoilGEVELRAVQRAAGQFTVRLNGADRAIGEKAAAGLFVRAA
Ga0335079_1049214633300032783SoilTEVEVREAQPAAEQLTVRLNGDERTIAEKAASGLFVRPA
Ga0335070_1070877613300032829SoilAEIVVESAEPAADQFVVLVEGDPRAVSEKAATGLFVRPS
Ga0335084_1095454323300033004SoilGTSILVRAAEPAADQFTVAIEKVGERAISEKAAAGLFVRPS
Ga0370501_0109781_806_9313300034195Untreated Peat SoilPGATVELRAAQPAAGQFRVVLAGNETGIGEKAAAGLFVKRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.