Metagenome / Metatranscriptome Family F034741

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F034741
Family Type	Metagenome / Metatranscriptome
Number of Sequences	174
Average Sequence Length	41 residues
Representative Sequence	TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Number of Associated Samples	133
Number of Associated Scaffolds	174

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Archaea
% of genes with valid RBS motifs	1.15 %
% of genes near scaffold ends (potentially truncated)	41.95 %
% of genes from short scaffolds (< 2000 bps)	71.84 %
Associated GOLD sequencing projects	124
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Archaea (51.724 % of family members)
NCBI Taxonomy ID	2157
Taxonomy	All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.092 % of family members)
Environment Ontology (ENVO)	Unclassified (25.862 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (40.230 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 174 Family Scaffolds
PF01814	Hemerythrin	5.75
PF07040	DUF1326	3.45
PF14947	HTH_45	2.87
PF01436	NHL	2.30
PF00850	Hist_deacetyl	2.30
PF00296	Bac_luciferase	2.30
PF00072	Response_reg	1.15
PF00582	Usp	1.15
PF12680	SnoaL_2	1.15
PF00127	Copper-bind	1.15
PF05899	Cupin_3	1.15
PF02518	HATPase_c	1.15
PF01391	Collagen	1.15
PF07452	CHRD	0.57
PF00149	Metallophos	0.57
PF13412	HTH_24	0.57
PF00732	GMC_oxred_N	0.57
PF04457	MJ1316	0.57
PF00011	HSP20	0.57
PF04895	Nre_C	0.57
PF05496	RuvB_N	0.57
PF08327	AHSA1	0.57
PF00211	Guanylate_cyc	0.57
PF17159	MASE3	0.57
PF10069	DICT	0.57
PF06348	DUF1059	0.57
PF07995	GSDH	0.57
PF05638	T6SS_HCP	0.57
PF14534	DUF4440	0.57
PF01022	HTH_5	0.57
PF05559	DUF763	0.57
PF13424	TPR_12	0.57
PF09859	Oxygenase-NA	0.57
PF13649	Methyltransf_25	0.57
PF00413	Peptidase_M10	0.57
PF08241	Methyltransf_11	0.57
PF14059	DUF4251	0.57
PF08240	ADH_N	0.57
PF00171	Aldedh	0.57
PF07366	SnoaL	0.57
PF01928	CYTH	0.57

COG ID	Name	Functional Category	% Frequency in 174 Family Scaffolds
COG0123	Acetoin utilization deacetylase AcuC or a related deacetylase	Secondary metabolites biosynthesis, transport and catabolism [Q]	4.60
COG5588	Uncharacterized conserved protein, DUF1326 domain	Function unknown [S]	3.45
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	2.30
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.57
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.57
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.57
COG1415	Uncharacterized conserved protein, DUF763 domain	Function unknown [S]	0.57
COG1531	Uncharacterized conserved protein, UPF0248 family	Function unknown [S]	0.57
COG1602	Archaeal DNA repair protein NreA	Replication, recombination and repair [L]	0.57
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.57
COG2133	Glucose/arabinose dehydrogenase, beta-propeller fold	Carbohydrate transport and metabolism [G]	0.57
COG2255	Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB	Replication, recombination and repair [L]	0.57
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.57
COG3157	Type VI protein secretion system component Hcp (secreted cytotoxin)	Intracellular trafficking, secretion, and vesicular transport [U]	0.57
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.57
COG5549	Predicted Zn-dependent protease	Posttranslational modification, protein turnover, chaperones [O]	0.57

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.32 %
Unclassified	root	N/A	43.68 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.17 %
Unclassified	root	N/A	43.68 %
Viruses	superkingdom	All Organisms → Viruses	1.15 %

Name	Rank	Taxonomy	Distribution
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	51.72 %
Unclassified	root	N/A	43.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	3.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	26.44 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.57 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Thaumarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	25.86 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.57 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Nitrososphaeria	class	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria	17.82 %
Nitrosopumilales	order	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales	4.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
Verrucomicrobiae	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae	0.57 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Nitrososphaerales	order	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales	17.82 %
unclassified Nitrosopumilales	no rank	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales	2.87 %
Nitrosopumilaceae	family	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae	1.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
Verrucomicrobiales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales	0.57 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Nitrososphaeraceae	family	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae	17.82 %
Nitrosopumilales archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	2.87 %
Nitrosopumilus	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus	1.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.57 %
Verrucomicrobia subdivision 3	family	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Nitrososphaera	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera	10.34 %
unclassified Nitrososphaeraceae	no rank	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae	4.60 %
Nitrosopumilales archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	2.87 %
Candidatus Nitrosocosmicus	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus	1.15 %
unclassified Nitrosopumilus	no rank	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus	1.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
unclassified Verrucomicrobia subdivision 3	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3	0.57 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Candidatus Nitrososphaera evergladensis	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	7.47 %
Nitrososphaeraceae archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	4.60 %
Nitrosopumilales archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	2.87 %
Nitrosopumilus sp.	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.	1.15 %
Candidatus Nitrosocosmicus	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus	1.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
unclassified Nitrososphaera	no rank	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera	0.57 %
Verrucomicrobia subdivision 3 bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium	0.57 %
Hanamia	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia	0.57 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.68 %
Candidatus Nitrososphaera evergladensis	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	7.47 %
Nitrososphaeraceae archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	4.60 %
Nitrosopumilales archaeon	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	2.87 %
Nitrosopumilus sp.	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.	1.15 %
Candidatus Nitrosocosmicus	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus	1.15 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.15 %
Hanamia caeni	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni	0.57 %
Nitrososphaera sp. AFS	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS	0.57 %
Verrucomicrobia subdivision 3 bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium	0.57 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886007\|SwRhRL2b_contig_317263	All Organisms → cellular organisms → Archaea	1254	Open in IMG/M
2162886007\|SwRhRL2b_contig_612750	All Organisms → cellular organisms → Archaea	822	Open in IMG/M
2228664021\|ICCgaii200_c0228975	Not Available	560	Open in IMG/M
3300000044\|ARSoilOldRDRAFT_c002510	Not Available	1613	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104636691	Not Available	724	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10002422	All Organisms → cellular organisms → Archaea	4943	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10016618	Not Available	2021	Open in IMG/M
3300000787\|JGI11643J11755_11432229	Not Available	986	Open in IMG/M
3300000787\|JGI11643J11755_11456906	Not Available	585	Open in IMG/M
3300001538\|A10PFW1_10197141	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	1514	Open in IMG/M
3300002568\|C688J35102_118581117	Not Available	574	Open in IMG/M
3300002568\|C688J35102_120833204	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1739	Open in IMG/M
3300003911\|JGI25405J52794_10025652	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	1209	Open in IMG/M
3300003987\|Ga0055471_10003546	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	2832	Open in IMG/M
3300003987\|Ga0055471_10207710	Not Available	613	Open in IMG/M
3300004081\|Ga0063454_101986969	Not Available	514	Open in IMG/M
3300004114\|Ga0062593_100978266	Not Available	865	Open in IMG/M
3300004145\|Ga0055489_10266349	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	546	Open in IMG/M
3300004153\|Ga0063455_100062871	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	1342	Open in IMG/M
3300005161\|Ga0066807_1005369	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	1088	Open in IMG/M
3300005289\|Ga0065704_10540383	All Organisms → cellular organisms → Archaea	641	Open in IMG/M
3300005294\|Ga0065705_10062967	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	594	Open in IMG/M
3300005328\|Ga0070676_10013871	All Organisms → cellular organisms → Archaea	4421	Open in IMG/M
3300005441\|Ga0070700_100366946	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	1072	Open in IMG/M
3300005441\|Ga0070700_101422270	Not Available	587	Open in IMG/M
3300005444\|Ga0070694_101595475	Not Available	554	Open in IMG/M
3300005518\|Ga0070699_101849814	Not Available	552	Open in IMG/M
3300005614\|Ga0068856_102508480	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	522	Open in IMG/M
3300005616\|Ga0068852_100222089	Not Available	1797	Open in IMG/M
3300005896\|Ga0075282_1006428	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	1334	Open in IMG/M
3300006049\|Ga0075417_10162957	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1042	Open in IMG/M
3300006163\|Ga0070715_10056176	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	1712	Open in IMG/M
3300006806\|Ga0079220_10073992	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1688	Open in IMG/M
3300006844\|Ga0075428_100047579	All Organisms → cellular organisms → Archaea → TACK group	4710	Open in IMG/M
3300006844\|Ga0075428_100433913	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	1407	Open in IMG/M
3300006844\|Ga0075428_101239288	Not Available	786	Open in IMG/M
3300006845\|Ga0075421_100196096	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera	2502	Open in IMG/M
3300006845\|Ga0075421_100402931	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	1642	Open in IMG/M
3300006845\|Ga0075421_100428811	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera	1583	Open in IMG/M
3300006845\|Ga0075421_101005158	All Organisms → cellular organisms → Archaea	944	Open in IMG/M
3300006846\|Ga0075430_100552853	Not Available	949	Open in IMG/M
3300006847\|Ga0075431_100851909	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	883	Open in IMG/M
3300006847\|Ga0075431_101848509	Not Available	560	Open in IMG/M
3300006871\|Ga0075434_100025503	Not Available	5784	Open in IMG/M
3300006871\|Ga0075434_100119414	Not Available	2650	Open in IMG/M
3300006880\|Ga0075429_100503259	All Organisms → cellular organisms → Archaea	1062	Open in IMG/M
3300006904\|Ga0075424_100485171	Not Available	1320	Open in IMG/M
3300006904\|Ga0075424_101203135	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	806	Open in IMG/M
3300006969\|Ga0075419_10079681	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	2083	Open in IMG/M
3300006969\|Ga0075419_10701996	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	717	Open in IMG/M
3300006969\|Ga0075419_11402697	All Organisms → cellular organisms → Archaea	521	Open in IMG/M
3300007004\|Ga0079218_11607319	All Organisms → cellular organisms → Archaea	713	Open in IMG/M
3300007076\|Ga0075435_100097451	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	2434	Open in IMG/M
3300009094\|Ga0111539_10216951	Not Available	2228	Open in IMG/M
3300009094\|Ga0111539_12295463	Not Available	626	Open in IMG/M
3300009094\|Ga0111539_12439607	Not Available	607	Open in IMG/M
3300009147\|Ga0114129_10197132	Not Available	2730	Open in IMG/M
3300009156\|Ga0111538_10212117	All Organisms → cellular organisms → Archaea	2455	Open in IMG/M
3300009156\|Ga0111538_11602472	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300009789\|Ga0126307_10013019	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	6111	Open in IMG/M
3300009789\|Ga0126307_10019061	All Organisms → cellular organisms → Archaea	5153	Open in IMG/M
3300009789\|Ga0126307_10057824	All Organisms → cellular organisms → Archaea	3039	Open in IMG/M
3300009789\|Ga0126307_10124980	All Organisms → cellular organisms → Archaea	2051	Open in IMG/M
3300009801\|Ga0105056_1012615	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera	968	Open in IMG/M
3300009803\|Ga0105065_1051258	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera	588	Open in IMG/M
3300009811\|Ga0105084_1008985	Not Available	1503	Open in IMG/M
3300010036\|Ga0126305_10031226	All Organisms → cellular organisms → Archaea	2906	Open in IMG/M
3300010036\|Ga0126305_10038087	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	2666	Open in IMG/M
3300010036\|Ga0126305_10965431	Not Available	583	Open in IMG/M
3300010037\|Ga0126304_10040150	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	2803	Open in IMG/M
3300010037\|Ga0126304_10060811	All Organisms → cellular organisms → Archaea	2316	Open in IMG/M
3300010039\|Ga0126309_10273563	Not Available	966	Open in IMG/M
3300010040\|Ga0126308_10053566	Not Available	2352	Open in IMG/M
3300010040\|Ga0126308_10346105	Not Available	984	Open in IMG/M
3300010040\|Ga0126308_10389747	Not Available	928	Open in IMG/M
3300010041\|Ga0126312_10298527	All Organisms → cellular organisms → Bacteria	1136	Open in IMG/M
3300010042\|Ga0126314_10042832	All Organisms → cellular organisms → Archaea	2900	Open in IMG/M
3300010042\|Ga0126314_10063481	All Organisms → cellular organisms → Archaea	2435	Open in IMG/M
3300010044\|Ga0126310_10027976	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium	2924	Open in IMG/M
3300010358\|Ga0126370_10000267	All Organisms → cellular organisms → Archaea	20333	Open in IMG/M
3300010362\|Ga0126377_10421210	All Organisms → cellular organisms → Archaea	1351	Open in IMG/M
3300010362\|Ga0126377_10813895	Not Available	993	Open in IMG/M
3300010371\|Ga0134125_10651747	All Organisms → cellular organisms → Archaea	1162	Open in IMG/M
3300010371\|Ga0134125_12072643	Not Available	618	Open in IMG/M
3300010397\|Ga0134124_10242140	All Organisms → cellular organisms → Archaea	1656	Open in IMG/M
3300012189\|Ga0137388_10488609	All Organisms → cellular organisms → Archaea	1143	Open in IMG/M
3300012469\|Ga0150984_121340364	Not Available	806	Open in IMG/M
3300012490\|Ga0157322_1016905	Not Available	664	Open in IMG/M
3300012505\|Ga0157339_1000899	Not Available	1662	Open in IMG/M
3300012517\|Ga0157354_1002562	Not Available	1389	Open in IMG/M
3300012900\|Ga0157292_10418545	Not Available	511	Open in IMG/M
3300012951\|Ga0164300_10247052	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.	904	Open in IMG/M
3300012957\|Ga0164303_10434191	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.	821	Open in IMG/M
3300012961\|Ga0164302_11091876	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300012987\|Ga0164307_10206170	All Organisms → cellular organisms → Archaea	1342	Open in IMG/M
3300012987\|Ga0164307_10743644	Not Available	773	Open in IMG/M
3300012989\|Ga0164305_11970057	Not Available	532	Open in IMG/M
3300013102\|Ga0157371_10780992	Not Available	719	Open in IMG/M
3300013104\|Ga0157370_11991096	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni	521	Open in IMG/M
3300014263\|Ga0075324_1129261	Not Available	567	Open in IMG/M
3300014270\|Ga0075325_1006001	Not Available	1987	Open in IMG/M
3300014311\|Ga0075322_1011657	All Organisms → cellular organisms → Archaea	1710	Open in IMG/M
3300014311\|Ga0075322_1111330	Not Available	647	Open in IMG/M
3300015371\|Ga0132258_11585059	All Organisms → cellular organisms → Archaea	1653	Open in IMG/M
3300015372\|Ga0132256_102054669	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae	677	Open in IMG/M
3300015374\|Ga0132255_103108485	All Organisms → cellular organisms → Archaea	708	Open in IMG/M
3300018000\|Ga0184604_10000292	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus	4993	Open in IMG/M
3300018051\|Ga0184620_10006920	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae	2435	Open in IMG/M
3300018051\|Ga0184620_10205000	Not Available	657	Open in IMG/M
3300018053\|Ga0184626_10234630	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	772	Open in IMG/M
3300018063\|Ga0184637_10678222	Not Available	567	Open in IMG/M
3300018067\|Ga0184611_1020523	Not Available	2030	Open in IMG/M
3300018077\|Ga0184633_10452946	Not Available	633	Open in IMG/M
3300018422\|Ga0190265_10153178	Not Available	2258	Open in IMG/M
3300018432\|Ga0190275_11365442	Not Available	785	Open in IMG/M
3300018465\|Ga0190269_11509515	Not Available	554	Open in IMG/M
3300018469\|Ga0190270_10023354	All Organisms → cellular organisms → Archaea	3877	Open in IMG/M
3300018481\|Ga0190271_10030561	Not Available	4334	Open in IMG/M
3300019356\|Ga0173481_10075365	All Organisms → cellular organisms → Archaea	1233	Open in IMG/M
3300019356\|Ga0173481_10086413	Not Available	1173	Open in IMG/M
3300019869\|Ga0193705_1020530	All Organisms → cellular organisms → Archaea	1437	Open in IMG/M
3300019881\|Ga0193707_1201628	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	507	Open in IMG/M
3300020069\|Ga0197907_11172005	Not Available	590	Open in IMG/M
3300020077\|Ga0206351_10438100	Not Available	510	Open in IMG/M
3300021362\|Ga0213882_10174977	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → unclassified Nitrososphaera → Nitrososphaera sp. AFS	883	Open in IMG/M
3300024055\|Ga0247794_10324925	All Organisms → cellular organisms → Archaea	522	Open in IMG/M
3300025315\|Ga0207697_10003644	All Organisms → cellular organisms → Archaea	7550	Open in IMG/M
3300025537\|Ga0210061_1000498	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	5754	Open in IMG/M
3300025537\|Ga0210061_1000743	All Organisms → cellular organisms → Archaea	4940	Open in IMG/M
3300025559\|Ga0210087_1060337	Not Available	756	Open in IMG/M
3300025567\|Ga0210076_1002402	All Organisms → cellular organisms → Archaea	4560	Open in IMG/M
3300025567\|Ga0210076_1009166	Not Available	2145	Open in IMG/M
3300025567\|Ga0210076_1078523	Not Available	721	Open in IMG/M
3300025792\|Ga0210143_1005450	All Organisms → cellular organisms → Archaea	2488	Open in IMG/M
3300025795\|Ga0210114_1003874	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	3682	Open in IMG/M
3300025901\|Ga0207688_10019801	All Organisms → cellular organisms → Archaea	3669	Open in IMG/M
3300025904\|Ga0207647_10245528	All Organisms → cellular organisms → Bacteria	1028	Open in IMG/M
3300025907\|Ga0207645_10007458	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	7724	Open in IMG/M
3300025932\|Ga0207690_11421271	Not Available	580	Open in IMG/M
3300025932\|Ga0207690_11514218	All Organisms → cellular organisms → Archaea	561	Open in IMG/M
3300025961\|Ga0207712_12002551	Not Available	518	Open in IMG/M
3300025981\|Ga0207640_10137862	Not Available	1774	Open in IMG/M
3300026535\|Ga0256867_10022374	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → unclassified Nitrososphaeraceae → Nitrososphaeraceae archaeon	2691	Open in IMG/M
3300027056\|Ga0209879_1005137	All Organisms → Viruses → Predicted Viral	1994	Open in IMG/M
3300027360\|Ga0209969_1000163	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae	8820	Open in IMG/M
3300027384\|Ga0209854_1061877	Not Available	653	Open in IMG/M
3300027462\|Ga0210000_1028546	Not Available	869	Open in IMG/M
3300027511\|Ga0209843_1008854	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus	2186	Open in IMG/M
3300027647\|Ga0214468_1006489	All Organisms → cellular organisms → Archaea	3473	Open in IMG/M
3300027650\|Ga0256866_1000615	All Organisms → cellular organisms → Archaea	8371	Open in IMG/M
3300027717\|Ga0209998_10013792	All Organisms → cellular organisms → Archaea	1684	Open in IMG/M
3300027907\|Ga0207428_10197660	Not Available	1513	Open in IMG/M
3300027909\|Ga0209382_10284315	Not Available	1869	Open in IMG/M
3300027948\|Ga0209858_1021390	Not Available	583	Open in IMG/M
3300031093\|Ga0308197_10204943	All Organisms → cellular organisms → Archaea	673	Open in IMG/M
3300031229\|Ga0299913_10102612	All Organisms → cellular organisms → Archaea	2793	Open in IMG/M
3300031547\|Ga0310887_10020273	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	2625	Open in IMG/M
3300031731\|Ga0307405_11712259	Not Available	557	Open in IMG/M
3300031824\|Ga0307413_10327967	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon	1172	Open in IMG/M
3300031852\|Ga0307410_10204047	Not Available	1511	Open in IMG/M
3300031852\|Ga0307410_10635455	Not Available	894	Open in IMG/M
3300031858\|Ga0310892_10404899	Not Available	889	Open in IMG/M
3300031911\|Ga0307412_10788734	All Organisms → cellular organisms → Archaea	824	Open in IMG/M
3300031911\|Ga0307412_11302805	Not Available	654	Open in IMG/M
3300031913\|Ga0310891_10045950	Not Available	1208	Open in IMG/M
3300031995\|Ga0307409_100215580	All Organisms → cellular organisms → Archaea	1729	Open in IMG/M
3300031996\|Ga0308176_10209423	All Organisms → Viruses → Predicted Viral	1840	Open in IMG/M
3300032000\|Ga0310903_10607569	Not Available	583	Open in IMG/M
3300032002\|Ga0307416_103004619	Not Available	564	Open in IMG/M
3300032004\|Ga0307414_10317775	Not Available	1324	Open in IMG/M
3300032013\|Ga0310906_10107181	All Organisms → cellular organisms → Archaea	1546	Open in IMG/M
3300032013\|Ga0310906_11242655	Not Available	543	Open in IMG/M
3300032180\|Ga0307471_100001135	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis	14367	Open in IMG/M
3300034090\|Ga0326723_0336243	Not Available	680	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	63.22%
Host-Associated	Host-Associated	36.78%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.87%
Plants	Host-Associated → Plants	36.78%
Aquatic	Environmental → Aquatic	10.34%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.72%
Rhizosphere	Host-Associated → Plants → Rhizosphere	27.01%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.77%
Marine	Environmental → Aquatic → Marine	6.32%
Sediment	Environmental → Aquatic → Sediment	4.02%
Peat	Environmental → Terrestrial → Peat	0.57%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.99%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.90%
Wetlands	Environmental → Aquatic → Marine → Wetlands	6.32%
Loam	Environmental → Terrestrial → Soil → Loam	5.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.02%
Sand	Environmental → Terrestrial → Soil → Sand	4.02%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.02%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.87%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.57%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.99%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.90%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	6.32%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.02%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.02%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	4.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.02%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.87%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.87%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.87%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.30%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.30%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.30%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.72%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	1.15%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.57%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.57%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.57%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	16.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.92%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	9.77%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	6.32%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	5.17%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.02%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	4.02%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.30%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.30%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.30%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.30%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.72%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	1.72%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	1.72%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.15%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.15%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.15%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	1.15%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.15%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	1.15%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.15%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.15%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.15%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.15%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.15%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.57%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.57%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.57%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.57%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.57%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.57%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.57%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.57%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.57%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.57%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.57%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.57%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old	Host-Associated	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300003987	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004145	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300005161	Soil and rhizosphere microbial communities from Laval, Canada - mgLPA	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005896	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009801	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30	Environmental	Open in IMG/M
3300009803	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50	Environmental	Open in IMG/M
3300009811	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Host-Associated	Open in IMG/M
3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Host-Associated	Open in IMG/M
3300012517	Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610	Environmental	Open in IMG/M
3300012900	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300014263	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1	Environmental	Open in IMG/M
3300014270	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1	Environmental	Open in IMG/M
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018067	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex	Environmental	Open in IMG/M
3300018077	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019869	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2	Environmental	Open in IMG/M
3300019881	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2	Environmental	Open in IMG/M
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021362	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09	Environmental	Open in IMG/M
3300024055	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025537	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)	Environmental	Open in IMG/M
3300025559	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025567	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025792	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025795	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300027056	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)	Host-Associated	Open in IMG/M
3300027384	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)	Environmental	Open in IMG/M
3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)	Host-Associated	Open in IMG/M
3300027511	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)	Environmental	Open in IMG/M
3300027647	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq	Environmental	Open in IMG/M
3300027650	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq	Environmental	Open in IMG/M
3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027948	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
SwRhRL2b_0009.00001310	2162886007	Switchgrass Rhizosphere	MNFEDKQHLENHKKVHGRKSKVYEYGDPEFTKDRLRG
SwRhRL2b_0943.00003030	2162886007	Switchgrass Rhizosphere	MNFEEKRHLENHKKVHGRKSKVYEYGDPEFTKDRLRG
ICCgaii200_02289751	2228664021	Soil	VCGLIFGEEKRYQIHKKVHGRKPKISEYGSPEFNQD
ARSoilOldRDRAFT_0025101	3300000044	Arabidopsis Rhizosphere	EEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
INPhiseqgaiiFebDRAFT_1046366912	3300000364	Soil	MQDMGLQFEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
AF_2010_repII_A1DRAFT_100024227	3300000597	Forest Soil	MEFPDSRHLENHKKVHGRKPKISEYGDPEFSKDRLR*
AF_2010_repII_A1DRAFT_100166184	3300000597	Forest Soil	MEFADEKHLKNHKKVHGRKPKIREYGDPEFSKDRLRG*
JGI11643J11755_114322293	3300000787	Soil	LIFGEEKRYQIHKKVHGRKPKISEYGSPEFSQDRLRG*
JGI11643J11755_114569061	3300000787	Soil	RPLAFKCKVCGLIFGEEKRYQIHKKVHGRKPKISEYGSPEFNQDRLRG*
A10PFW1_101971412	3300001538	Permafrost	MQFEDKEHFEIHKTVHGRKSKVSEYGSPEFSQDRLRG*
C688J35102_1185811172	3300002568	Soil	TCGLQFEEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
C688J35102_1208332041	3300002568	Soil	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLR
JGI25405J52794_100256521	3300003911	Tabebuia Heterophylla Rhizosphere	MVFRCSKCGSVFEEKRRLEIHKQTHDRKSKIREYGSPEFSQDSLRG*
Ga0055471_100035461	3300003987	Natural And Restored Wetlands	MASLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0055471_102077101	3300003987	Natural And Restored Wetlands	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSSEFNQDRLRG*
Ga0063454_1019869692	3300004081	Soil	FKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0062593_1009782663	3300004114	Soil	MCGLQFEEKKRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
Ga0055489_102663491	3300004145	Natural And Restored Wetlands	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSSEFNQDRLRG*
Ga0063455_1000628711	3300004153	Soil	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0066807_10053691	3300005161	Soil	LTFKCKISGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0065704_105403832	3300005289	Switchgrass Rhizosphere	LTFKCKICGSQFEEKERLGIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0065705_100629671	3300005294	Switchgrass Rhizosphere	LTFKCKICGSQFEEKERLDIHKKVHGXKAKISEYGSPEFNQDRLRG*
Ga0070676_100138712	3300005328	Miscanthus Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDMLRG*
Ga0070700_1003669461	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDR
Ga0070700_1014222701	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0070694_1015954752	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	LTFKCKICGSQFEEKERLQIHKKVHGRKAQISEYGSPEFNQDRLRG*
Ga0070699_1018498142	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	KTCGLQFDEKRRLEIHKQVHGRKSKVSEYGSPEFSQDRLRG*
Ga0068856_1025084801	3300005614	Corn Rhizosphere	CKKCNLEFEEKNRLEIHKKVHGRKSKVSEYGSPEFNQDRLRG*
Ga0068852_1002220893	3300005616	Corn Rhizosphere	MKFEDPRRLENHKKVHGRKSKVSEYGDPEFNIDRLRG*
Ga0075282_10064283	3300005896	Rice Paddy Soil	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFN
Ga0075417_101629571	3300006049	Populus Rhizosphere	LTFKCKICGSQFEEKERLDIHKNVHGRKAKISEYGSPEFNQDRLEAN
Ga0070715_100561762	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MQKEFSDTKHLENHKKVHGRKPKVSEYGDPEFSKDRLR*
Ga0079220_100739922	3300006806	Agricultural Soil	MPFKCKECGTQFEEKRRLEIHKKLHGRKSKISEYGSPEFNQDRLRG*
Ga0075428_1000475793	3300006844	Populus Rhizosphere	MNFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075428_1004339133	3300006844	Populus Rhizosphere	MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG*
Ga0075428_1012392881	3300006844	Populus Rhizosphere	FEEKERLDIHKKVHGRKAKISEYGSPEFNQNRLRG*
Ga0075421_1001960963	3300006845	Populus Rhizosphere	CGLKFEEKKRLEIHKQVHGRKPKVTEYGSSEFSQDRLRG*
Ga0075421_1004029312	3300006845	Populus Rhizosphere	MNFEEKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075421_1004288113	3300006845	Populus Rhizosphere	MQDIGLDFEEKKRLEIHKQVHDRKLKVAEYGSPEFSQDRLRG*
Ga0075421_1010051582	3300006845	Populus Rhizosphere	LTLKCKICGSQFEEKERLDIHKKVHGRKAKISEYGSTEFNQDRLRG*
Ga0075430_1005528532	3300006846	Populus Rhizosphere	MNFEDKRRLENHKKVHGRKSKVSEYGNSEFNIDRLRG*
Ga0075431_1008519091	3300006847	Populus Rhizosphere	MQDIGLKFEEKKRLEIHKQVHGRKPKVTEYGSPEFSQDRLRG*
Ga0075431_1018485092	3300006847	Populus Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFN
Ga0075434_1000255037	3300006871	Populus Rhizosphere	PISMPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0075434_1001194142	3300006871	Populus Rhizosphere	MLSFKCKICGSQFEEKERLDIHKKVHGGKAKISEYGSPEFNQDRLRG*
Ga0075429_1005032592	3300006880	Populus Rhizosphere	LTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYGSTEFNQDRLRG*
Ga0075424_1004851711	3300006904	Populus Rhizosphere	FEEKERLDIHKKVHGGKAKISEYGSPEFNQDRLRG*
Ga0075424_1012031351	3300006904	Populus Rhizosphere	SQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRC*
Ga0075419_100796811	3300006969	Populus Rhizosphere	KCKICGSQFEEKERLDIHKKVHGRKAKIREYGSPEFNQDRLRG*
Ga0075419_107019962	3300006969	Populus Rhizosphere	CGSQFEEKERLDIHKNVHGRKAKISEYGSPEFNQDRLRG*
Ga0075419_114026972	3300006969	Populus Rhizosphere	LTFKCKICGSQFEEKERLDIHKNVHGRKAKISEYGSPEF
Ga0079218_116073192	3300007004	Agricultural Soil	MNFEDKKRLENHKKVHGRKSKVSEYGNPEFNIDRLRG*
Ga0075435_1000974514	3300007076	Populus Rhizosphere	LTFKCKICGSQFEEKERFDIHKKVHGRKAKIREYGSPEFNQDRLRG*
Ga0111539_102169512	3300009094	Populus Rhizosphere	MNFEDKRRLENYKKVHKRKSKVSEYGDSEFNIDRLRG*
Ga0111539_122954631	3300009094	Populus Rhizosphere	RMVQFFKCKVRGLQFEEEKRLKIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0111539_124396071	3300009094	Populus Rhizosphere	MTFEEKNRLEVHKKVHGRKSKVSEYGSPEFNQDRLRG*
Ga0114129_101971323	3300009147	Populus Rhizosphere	MNFEDKRRLKNHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0111538_102121173	3300009156	Populus Rhizosphere	MKFEDPRRLENHKKVHGRKSKVSEYGDPEFSIDRLKG*
Ga0111538_116024721	3300009156	Populus Rhizosphere	KCKICNMKFEDPRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0126307_100130194	3300009789	Serpentine Soil	MNFEDKQHLEYHKKIHGRKSKLYEYGDPEFSKDRLRG*
Ga0126307_100190613	3300009789	Serpentine Soil	MNFEDKRRSENHKKVHGRKSKVSEYGNPEFNIDRLRG*
Ga0126307_100578242	3300009789	Serpentine Soil	MNFEDKQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG*
Ga0126307_101249801	3300009789	Serpentine Soil	MNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG*
Ga0105056_10126152	3300009801	Groundwater Sand	MEFENKDRLERHRKVHGRKSKVSEAGTMDFNQVGF*
Ga0105065_10512582	3300009803	Groundwater Sand	MEFEDKERFERHKKVHGRKSKISEAGAMDFSQVGF*
Ga0105084_10089851	3300009811	Groundwater Sand	KCKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0126305_100312261	3300010036	Serpentine Soil	MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNLDRLRG*
Ga0126305_100380872	3300010036	Serpentine Soil	MNFEDKQHLENHKKLHGRKSKVYEYGDPEFNKDRLRG*
Ga0126305_109654312	3300010036	Serpentine Soil	MNFEDKRRLENHKKVHGRTSKVSEYGDPEFNKDRLRG*
Ga0126304_100401504	3300010037	Serpentine Soil	MNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG*
Ga0126304_100608112	3300010037	Serpentine Soil	MNFEDRQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG*
Ga0126309_102735631	3300010039	Serpentine Soil	MGFKCKKCNLQFEEERRLEIHKKVHDRKSKVSEYGSPVFNDDRLRGG*
Ga0126308_100535662	3300010040	Serpentine Soil	MNFEDKRRLENHKKVHGRKSKVSEYGDPEFNKDRLRG*
Ga0126308_103461051	3300010040	Serpentine Soil	MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRD*
Ga0126308_103897471	3300010040	Serpentine Soil	MASFKCKICNMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG*
Ga0126312_102985273	3300010041	Serpentine Soil	MNFEDKRHLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0126314_100428323	3300010042	Serpentine Soil	MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIERLRD*
Ga0126314_100634813	3300010042	Serpentine Soil	MNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLIG*
Ga0126310_100279763	3300010044	Serpentine Soil	MNFEDKRHLENHKKVHGRKPKVYEYGDPEFNKDRLRG*
Ga0126370_100002679	3300010358	Tropical Forest Soil	MVFKCKECGTEFEEKRRLEIHKKVHGRKSKVREYGSPEFNQDRLRG*
Ga0126377_104212102	3300010362	Tropical Forest Soil	EEKRRLEIHKKVHGRKSKVREYGSPEFNQDRLRG*
Ga0126377_108138951	3300010362	Tropical Forest Soil	TFEDEKRLQIHKRVHGRKPKIREYGSPEFSQDRLRG*
Ga0134125_106517472	3300010371	Terrestrial Soil	EEKRRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG*
Ga0134125_120726431	3300010371	Terrestrial Soil	VCGTLFVEKRRLEVHKKVHRRKPKIREYGSPEFNQDRLRG*
Ga0134124_102421401	3300010397	Terrestrial Soil	MPFKCKECGTQFEEERRLEIHKKVHGRKSKIREYGSPEFNQDRLRG*
Ga0137388_104886093	3300012189	Vadose Zone Soil	DEKRRLEIQKQVHGRKSKVSEYGSPEFSQDRLRG*
Ga0150984_1213403641	3300012469	Avena Fatua Rhizosphere	CKKCNLEFEEKKRLEIHKNVHGRKSKVSEYGSPEFNQDRLRG*
Ga0157322_10169051	3300012490	Arabidopsis Rhizosphere	TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG*
Ga0157339_10008991	3300012505	Arabidopsis Rhizosphere	QFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0157354_10025623	3300012517	Unplanted Soil	EEKERLDIHKKVHGRKAKISEYGSPEFYQDRLRG*
Ga0157292_104185451	3300012900	Soil	LTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYGS
Ga0164300_102470521	3300012951	Soil	LALKCKKCNLEFEEKKRREIHKNVHDRKSKVYEYGSPEFKDDRLRAG*
Ga0164303_104341912	3300012957	Soil	LALKCKKCNLEFEEKKRREIHKNVHDRKSKVYEYGSPEFNDDRLRAG*
Ga0164302_110918762	3300012961	Soil	CGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG*
Ga0164307_102061702	3300012987	Soil	FEEEKRLQIHKKVHGRKPKISEYESPEFSQDRLRG*
Ga0164307_107436442	3300012987	Soil	LALKCKKCNLEFEEKKRREIHENVHDRKSKVYEYGSPEFNNDRLRAG*
Ga0164305_119700571	3300012989	Soil	VLVHKCKVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0157371_107809921	3300013102	Corn Rhizosphere	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKIREYGSPEFNQDRLRG*
Ga0157370_119910961	3300013104	Corn Rhizosphere	MLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEY
Ga0075324_11292611	3300014263	Natural And Restored Wetlands	MASLKCKLYNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075325_10060013	3300014270	Natural And Restored Wetlands	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSPEFNQDRLRG*
Ga0075322_10116572	3300014311	Natural And Restored Wetlands	MVSFKCKIYNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG*
Ga0075322_11113301	3300014311	Natural And Restored Wetlands	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSS
Ga0132258_115850593	3300015371	Arabidopsis Rhizosphere	MNFEDEIRLENHKKVHGRKSKVAEYGDSEFNIDRLRG*
Ga0132256_1020546692	3300015372	Arabidopsis Rhizosphere	FSFLYILAFKCKKCNLQFEEKSRLEIHKKLHGRKSKLSEYGSPGFNDDRLRGG*
Ga0132255_1031084852	3300015374	Arabidopsis Rhizosphere	EDEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG*
Ga0184604_100002921	3300018000	Groundwater Sediment	CKICGSQFEEKERLNIHKKVHGRKPKISEYGSPEFNQDRLRG
Ga0184620_100069201	3300018051	Groundwater Sediment	TLFVEKRRLEVHKKVHRRKPKIREYGSPEFNQDRLRG
Ga0184620_102050001	3300018051	Groundwater Sediment	MQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0184626_102346302	3300018053	Groundwater Sediment	FEEKERLNIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0184637_106782221	3300018063	Groundwater Sediment	FEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0184611_10205232	3300018067	Groundwater Sediment	MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0184633_104529461	3300018077	Groundwater Sediment	KVCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0190265_101531782	3300018422	Soil	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSPEFNQDRLRG
Ga0190275_113654421	3300018432	Soil	MVFKSSKCGSVFEEERRLEIHKQTHDRKSKISEYGLPEFNQDRLRG
Ga0190269_115095151	3300018465	Soil	MNFEDKRRLENHKNVHGRKSKVSEYGDPEFNKDRLRG
Ga0190270_100233543	3300018469	Soil	MVFKCSKCGIVFEEKRRLEIHKQTHDRKSKISEYGSPEFNQDRLRG
Ga0190271_100305614	3300018481	Soil	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKIGEYGSSEFNQDR
Ga0173481_100753652	3300019356	Soil	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0173481_100864131	3300019356	Soil	MCGLQFEEKKRLEIHKQVHGRKSKVTEYGSPEFSQDRLRG
Ga0193705_10205301	3300019869	Soil	LQFEEEKRLQIHKKIHGRKPKISEYGSPEFNQDRLRG
Ga0193707_12016281	3300019881	Soil	LVSRAFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0197907_111720051	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	KCKKCNQQFEEKRRLEIHKKVHDRKSKISEYGSPGFNDDRLRGG
Ga0206351_104381001	3300020077	Corn, Switchgrass And Miscanthus Rhizosphere	TQFEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0213882_101749771	3300021362	Exposed Rock	EFPDEKHLNNHKKVHGRKPKISEYGDPEFSKDRLR
Ga0247794_103249252	3300024055	Soil	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYG
Ga0207697_100036441	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQD
Ga0210061_10004982	3300025537	Natural And Restored Wetlands	MASLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210061_10007433	3300025537	Natural And Restored Wetlands	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKISEYGSSEFNQDRLRG
Ga0210087_10603371	3300025559	Natural And Restored Wetlands	MVSFKCKIYNNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210076_10024027	3300025567	Natural And Restored Wetlands	MNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210076_10091663	3300025567	Natural And Restored Wetlands	MNFEDKRRMENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210076_10785231	3300025567	Natural And Restored Wetlands	SLKCKLCNINFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210143_10054501	3300025792	Natural And Restored Wetlands	MVSFKCKIYNMNFEDARHLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0210114_10038744	3300025795	Natural And Restored Wetlands	FEDKRRMENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0207688_100198014	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0207647_102455282	3300025904	Corn Rhizosphere	MKFEDPRRLENHKKVHGRKSKVSEYGDPEFSIDRLRG
Ga0207645_100074588	3300025907	Miscanthus Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDMLRG
Ga0207690_114212711	3300025932	Corn Rhizosphere	MKFEDPRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0207690_115142182	3300025932	Corn Rhizosphere	MPFKCKECGTQFEEKRRLEIHKKVHGRKSKISEYGS
Ga0207712_120025512	3300025961	Switchgrass Rhizosphere	MSFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0207640_101378621	3300025981	Corn Rhizosphere	MLTFKCKTCGSQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDM
Ga0256867_100223746	3300026535	Soil	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDRLRG
Ga0209879_10051371	3300027056	Groundwater Sand	LQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0209969_10001639	3300027360	Arabidopsis Thaliana Rhizosphere	FKCKICGSQFEEKERLDIHKNAHGRKAKISEYGNPEFNQDRLRG
Ga0209854_10618771	3300027384	Groundwater Sand	CGSQFEEKERLRVHKKVHGRKPKISEYGSPEFNQDRLRG
Ga0210000_10285462	3300027462	Arabidopsis Thaliana Rhizosphere	CKICGSQFEEKERLQIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0209843_10088541	3300027511	Groundwater Sand	QFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0214468_10064894	3300027647	Soil	MVFICSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDRLRG
Ga0256866_10006156	3300027650	Soil	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDGLRG
Ga0209998_100137921	3300027717	Arabidopsis Thaliana Rhizosphere	FKLTIKCKICGSQFEEKERLDIHKKVHGRKAKVSEYGSPEFNQDRLRG
Ga0207428_101976601	3300027907	Populus Rhizosphere	MNFEDKRRLENYKKVHKRKSKVSEYGDSEFNIDRLRG
Ga0209382_102843152	3300027909	Populus Rhizosphere	MNFEEKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0209858_10213901	3300027948	Groundwater Sand	VCGLQFEEEKRLQIHKKVHGRKPKISEYGSPEFSQDRLRG
Ga0308197_102049432	3300031093	Soil	CGMQFEEEKRLQIHKKVHGRKPKIIEYGSPEFSQDRLRG
Ga0299913_101026121	3300031229	Soil	MVFKCSKCGSVFEEKRRLEIHKQTHDRKSKTSEYGSPEFNQDKLRG
Ga0310887_100202731	3300031547	Soil	MLTFKCKICGSQFEEKERLDIHKKVHGRKAKISEYG
Ga0307405_117122591	3300031731	Rhizosphere	MNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDHLRG
Ga0307413_103279672	3300031824	Rhizosphere	AISVYIINNLSSFKCKTCNMNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG
Ga0307410_102040471	3300031852	Rhizosphere	MNFEDKQHLEYHKKIHGRKSKLYEYGDPEFSKDRLRG
Ga0307410_106354551	3300031852	Rhizosphere	MNFEDKRHLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0310892_104048991	3300031858	Soil	NFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0307412_107887342	3300031911	Rhizosphere	MNFEDKQHLENHKKVHGRKPKVYEYGDPEFTKDRLRG
Ga0307412_113028052	3300031911	Rhizosphere	MASFKCKICNMNFEDKRHLETHKKVHGRTSKVSEYGDPEFNKDRLRG
Ga0310891_100459502	3300031913	Soil	SQFEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0307409_1002155801	3300031995	Rhizosphere	MNFEDKRRLENHKKVHGRKSKVSEYGNPKFNIDRLRD
Ga0308176_102094232	3300031996	Soil	MPFKCKECGTQFEEERRLEIHKKVHGRKSKISEYGSPEFNQDRLRG
Ga0310903_106075691	3300032000	Soil	MNFEDKRRLENHKKVHGRKSKVSEYVNPEFTIDRPRG
Ga0307416_1030046191	3300032002	Rhizosphere	MNFEDKRRLENHKKVHGRKSKVSEYGDSEFNIDRLRG
Ga0307414_103177752	3300032004	Rhizosphere	MNFEDKQHLEYHKKIHGRKSKVYEYGDPEFSKDRLRG
Ga0310906_101071813	3300032013	Soil	CKICNMNFEDKRRLENHKKVHGRKSKVSEYGNPEFNIDRLRG
Ga0310906_112426551	3300032013	Soil	FEEKERLDIHKKVHGRKAKISEYGSPEFNQDRLRG
Ga0307471_1000011359	3300032180	Hardwood Forest Soil	MEFENKDRLERHRKVHGRKSKVSEAGAMDFNQVGF
Ga0326723_0336243_2_109	3300034090	Peat Soil	FEEKRRLEIHKKVHGRKSKISEYGSPEFNQDRLRG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F034741

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences