Basic Information | |
---|---|
Family ID | F034806 |
Family Type | Metagenome |
Number of Sequences | 173 |
Average Sequence Length | 40 residues |
Representative Sequence | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.78 % |
% of genes near scaffold ends (potentially truncated) | 93.06 % |
% of genes from short scaffolds (< 2000 bps) | 82.66 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.613 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (24.277 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.867 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (65.318 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.25% β-sheet: 0.00% Coil/Unstructured: 92.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF02515 | CoA_transf_3 | 3.47 |
PF00296 | Bac_luciferase | 2.89 |
PF13432 | TPR_16 | 1.73 |
PF04228 | Zn_peptidase | 1.73 |
PF00266 | Aminotran_5 | 1.73 |
PF00578 | AhpC-TSA | 1.73 |
PF13193 | AMP-binding_C | 1.73 |
PF02746 | MR_MLE_N | 1.73 |
PF05193 | Peptidase_M16_C | 1.16 |
PF00873 | ACR_tran | 1.16 |
PF01019 | G_glu_transpept | 1.16 |
PF13378 | MR_MLE_C | 1.16 |
PF02770 | Acyl-CoA_dh_M | 1.16 |
PF00472 | RF-1 | 1.16 |
PF01479 | S4 | 1.16 |
PF09423 | PhoD | 1.16 |
PF13186 | SPASM | 1.16 |
PF07883 | Cupin_2 | 1.16 |
PF13023 | HD_3 | 1.16 |
PF02538 | Hydantoinase_B | 1.16 |
PF01261 | AP_endonuc_2 | 1.16 |
PF00132 | Hexapep | 1.16 |
PF01979 | Amidohydro_1 | 0.58 |
PF04343 | DUF488 | 0.58 |
PF02775 | TPP_enzyme_C | 0.58 |
PF02348 | CTP_transf_3 | 0.58 |
PF12570 | DUF3750 | 0.58 |
PF02492 | cobW | 0.58 |
PF00118 | Cpn60_TCP1 | 0.58 |
PF13565 | HTH_32 | 0.58 |
PF11141 | DUF2914 | 0.58 |
PF03473 | MOSC | 0.58 |
PF14559 | TPR_19 | 0.58 |
PF01717 | Meth_synt_2 | 0.58 |
PF06925 | MGDG_synth | 0.58 |
PF04909 | Amidohydro_2 | 0.58 |
PF01654 | Cyt_bd_oxida_I | 0.58 |
PF12836 | HHH_3 | 0.58 |
PF12681 | Glyoxalase_2 | 0.58 |
PF11376 | DUF3179 | 0.58 |
PF02518 | HATPase_c | 0.58 |
PF03972 | MmgE_PrpD | 0.58 |
PF01266 | DAO | 0.58 |
PF13231 | PMT_2 | 0.58 |
PF00709 | Adenylsucc_synt | 0.58 |
PF01425 | Amidase | 0.58 |
PF04143 | Sulf_transp | 0.58 |
PF03358 | FMN_red | 0.58 |
PF00561 | Abhydrolase_1 | 0.58 |
PF00497 | SBP_bac_3 | 0.58 |
PF04851 | ResIII | 0.58 |
PF04055 | Radical_SAM | 0.58 |
PF00856 | SET | 0.58 |
PF01927 | Mut7-C | 0.58 |
PF04966 | OprB | 0.58 |
PF00535 | Glycos_transf_2 | 0.58 |
PF02900 | LigB | 0.58 |
PF00378 | ECH_1 | 0.58 |
PF12706 | Lactamase_B_2 | 0.58 |
PF02780 | Transketolase_C | 0.58 |
PF12773 | DZR | 0.58 |
PF02452 | PemK_toxin | 0.58 |
PF01799 | Fer2_2 | 0.58 |
PF12704 | MacB_PCD | 0.58 |
PF08734 | GYD | 0.58 |
PF01314 | AFOR_C | 0.58 |
PF01179 | Cu_amine_oxid | 0.58 |
PF12867 | DinB_2 | 0.58 |
PF02254 | TrkA_N | 0.58 |
PF04011 | LemA | 0.58 |
PF11066 | DUF2867 | 0.58 |
PF00903 | Glyoxalase | 0.58 |
PF01738 | DLH | 0.58 |
PF16277 | DUF4926 | 0.58 |
PF16868 | NMT1_3 | 0.58 |
PF03454 | MoeA_C | 0.58 |
PF00676 | E1_dh | 0.58 |
PF02954 | HTH_8 | 0.58 |
PF12146 | Hydrolase_4 | 0.58 |
PF03069 | FmdA_AmdA | 0.58 |
PF00528 | BPD_transp_1 | 0.58 |
PF01408 | GFO_IDH_MocA | 0.58 |
PF16113 | ECH_2 | 0.58 |
PF01638 | HxlR | 0.58 |
PF00498 | FHA | 0.58 |
PF01547 | SBP_bac_1 | 0.58 |
PF03843 | Slp | 0.58 |
PF02230 | Abhydrolase_2 | 0.58 |
PF12172 | DUF35_N | 0.58 |
PF07690 | MFS_1 | 0.58 |
PF10431 | ClpB_D2-small | 0.58 |
PF12973 | Cupin_7 | 0.58 |
PF01464 | SLT | 0.58 |
PF03061 | 4HBT | 0.58 |
PF03950 | tRNA-synt_1c_C | 0.58 |
PF04984 | Phage_sheath_1 | 0.58 |
PF10590 | PNP_phzG_C | 0.58 |
PF10400 | Vir_act_alpha_C | 0.58 |
PF01958 | Asp_DH_C | 0.58 |
PF01243 | Putative_PNPOx | 0.58 |
PF13580 | SIS_2 | 0.58 |
PF01966 | HD | 0.58 |
PF11737 | DUF3300 | 0.58 |
PF13006 | Nterm_IS4 | 0.58 |
PF00248 | Aldo_ket_red | 0.58 |
PF13551 | HTH_29 | 0.58 |
PF13452 | MaoC_dehydrat_N | 0.58 |
PF00990 | GGDEF | 0.58 |
PF01613 | Flavin_Reduct | 0.58 |
PF08386 | Abhydrolase_4 | 0.58 |
PF13365 | Trypsin_2 | 0.58 |
COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
---|---|---|---|
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 3.47 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 3.47 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.89 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 2.31 |
COG2321 | Predicted metalloprotease | General function prediction only [R] | 1.73 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 1.16 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.16 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 1.16 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.16 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0104 | Adenylosuccinate synthase | Nucleotide transport and metabolism [F] | 0.58 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.58 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.58 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.58 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.58 |
COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.58 |
COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.58 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1712 | L-aspartate dehydrogenase, NAD(P)-dependent | Amino acid transport and metabolism [E] | 0.58 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.58 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.58 |
COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.58 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.58 |
COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.58 |
COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.58 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.58 |
COG3065 | Starvation-inducible outer membrane lipoprotein Slp | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.58 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.58 |
COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.61 % |
Unclassified | root | N/A | 21.39 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002120|C687J26616_10081508 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300002121|C687J26615_10025600 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
3300002121|C687J26615_10078910 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 821 | Open in IMG/M |
3300002121|C687J26615_10083295 | Not Available | 799 | Open in IMG/M |
3300002121|C687J26615_10136542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 619 | Open in IMG/M |
3300002121|C687J26615_10168904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
3300002122|C687J26623_10032267 | Not Available | 1399 | Open in IMG/M |
3300002124|C687J26631_10052931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1414 | Open in IMG/M |
3300002124|C687J26631_10193334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 677 | Open in IMG/M |
3300003994|Ga0055435_10058632 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300004025|Ga0055433_10057624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus | 804 | Open in IMG/M |
3300005204|Ga0068997_10121173 | Not Available | 582 | Open in IMG/M |
3300005445|Ga0070708_100081340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2932 | Open in IMG/M |
3300005445|Ga0070708_100106397 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
3300005468|Ga0070707_100039709 | All Organisms → cellular organisms → Bacteria | 4500 | Open in IMG/M |
3300005468|Ga0070707_102258045 | Not Available | 511 | Open in IMG/M |
3300005536|Ga0070697_102000850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300009012|Ga0066710_100162581 | All Organisms → cellular organisms → Bacteria | 3125 | Open in IMG/M |
3300009090|Ga0099827_11328726 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300009137|Ga0066709_100337567 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
3300009538|Ga0129287_10209270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 844 | Open in IMG/M |
3300010366|Ga0126379_12340908 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300011419|Ga0137446_1046106 | Not Available | 965 | Open in IMG/M |
3300011428|Ga0137456_1050200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 992 | Open in IMG/M |
3300011429|Ga0137455_1189763 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300012035|Ga0137445_1087314 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
3300012096|Ga0137389_10337790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Ea1.12 | 1280 | Open in IMG/M |
3300012164|Ga0137352_1097323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
3300012174|Ga0137338_1004275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2456 | Open in IMG/M |
3300012174|Ga0137338_1050690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 876 | Open in IMG/M |
3300012174|Ga0137338_1054616 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300012174|Ga0137338_1069907 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300012179|Ga0137334_1066083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
3300012225|Ga0137434_1024696 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300012532|Ga0137373_10108261 | All Organisms → cellular organisms → Bacteria | 2414 | Open in IMG/M |
3300014870|Ga0180080_1041064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 740 | Open in IMG/M |
3300014873|Ga0180066_1003974 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
3300014877|Ga0180074_1013760 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300014877|Ga0180074_1057000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 837 | Open in IMG/M |
3300014881|Ga0180094_1079408 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300014881|Ga0180094_1080459 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300014881|Ga0180094_1110103 | Not Available | 639 | Open in IMG/M |
3300014884|Ga0180104_1002332 | All Organisms → cellular organisms → Bacteria | 3924 | Open in IMG/M |
3300014884|Ga0180104_1017679 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
3300014884|Ga0180104_1035717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1293 | Open in IMG/M |
3300014884|Ga0180104_1049723 | Not Available | 1122 | Open in IMG/M |
3300014884|Ga0180104_1060771 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300014884|Ga0180104_1121790 | Not Available | 755 | Open in IMG/M |
3300014884|Ga0180104_1139742 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
3300014884|Ga0180104_1204722 | Not Available | 589 | Open in IMG/M |
3300014884|Ga0180104_1246761 | Not Available | 532 | Open in IMG/M |
3300014885|Ga0180063_1018425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1895 | Open in IMG/M |
3300014885|Ga0180063_1036590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1383 | Open in IMG/M |
3300014885|Ga0180063_1047626 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300014885|Ga0180063_1093112 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300014885|Ga0180063_1135792 | Not Available | 771 | Open in IMG/M |
3300014885|Ga0180063_1199908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
3300014885|Ga0180063_1256163 | Not Available | 559 | Open in IMG/M |
3300014885|Ga0180063_1261660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 552 | Open in IMG/M |
3300015252|Ga0180075_1018863 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300015256|Ga0180073_1030670 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300015256|Ga0180073_1116780 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300015259|Ga0180085_1061033 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1085 | Open in IMG/M |
3300015259|Ga0180085_1093366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 884 | Open in IMG/M |
3300015259|Ga0180085_1135568 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300015259|Ga0180085_1217540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300017961|Ga0187778_10957266 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300017997|Ga0184610_1066940 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300018031|Ga0184634_10020448 | All Organisms → cellular organisms → Bacteria | 2507 | Open in IMG/M |
3300018053|Ga0184626_10106309 | Not Available | 1190 | Open in IMG/M |
3300018056|Ga0184623_10075516 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1552 | Open in IMG/M |
3300018059|Ga0184615_10056373 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2189 | Open in IMG/M |
3300018059|Ga0184615_10170640 | Not Available | 1227 | Open in IMG/M |
3300018059|Ga0184615_10197450 | Not Available | 1132 | Open in IMG/M |
3300018059|Ga0184615_10521914 | Not Available | 636 | Open in IMG/M |
3300018063|Ga0184637_10021454 | All Organisms → cellular organisms → Bacteria | 3890 | Open in IMG/M |
3300018074|Ga0184640_10143700 | Not Available | 1061 | Open in IMG/M |
3300018074|Ga0184640_10366514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 653 | Open in IMG/M |
3300018076|Ga0184609_10162355 | Not Available | 1032 | Open in IMG/M |
3300018076|Ga0184609_10413865 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300018078|Ga0184612_10043251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2341 | Open in IMG/M |
3300018079|Ga0184627_10254619 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300018422|Ga0190265_10044557 | All Organisms → cellular organisms → Bacteria | 3815 | Open in IMG/M |
3300018422|Ga0190265_10240341 | Not Available | 1852 | Open in IMG/M |
3300018422|Ga0190265_10396377 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
3300018422|Ga0190265_10800832 | Not Available | 1065 | Open in IMG/M |
3300018422|Ga0190265_11122517 | Not Available | 906 | Open in IMG/M |
3300018422|Ga0190265_11382270 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300018429|Ga0190272_10189281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
3300018429|Ga0190272_11117923 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300018482|Ga0066669_12315793 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300019458|Ga0187892_10426309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300019487|Ga0187893_10856759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
3300019882|Ga0193713_1114339 | Not Available | 746 | Open in IMG/M |
3300019883|Ga0193725_1041519 | Not Available | 1200 | Open in IMG/M |
3300019886|Ga0193727_1110766 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300019886|Ga0193727_1133301 | Not Available | 697 | Open in IMG/M |
3300021073|Ga0210378_10302684 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300021081|Ga0210379_10057024 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300021081|Ga0210379_10081649 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300021081|Ga0210379_10293865 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300021090|Ga0210377_10388771 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300021090|Ga0210377_10645032 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300022534|Ga0224452_1082462 | Not Available | 976 | Open in IMG/M |
3300025155|Ga0209320_10286670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 689 | Open in IMG/M |
3300025159|Ga0209619_10093310 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
3300025159|Ga0209619_10248179 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300025159|Ga0209619_10546900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
3300025165|Ga0209108_10036128 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
3300025165|Ga0209108_10413299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
3300025165|Ga0209108_10524929 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
3300025289|Ga0209002_10218807 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300025289|Ga0209002_10492986 | Not Available | 678 | Open in IMG/M |
3300025312|Ga0209321_10074574 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1925 | Open in IMG/M |
3300025312|Ga0209321_10146728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1263 | Open in IMG/M |
3300025312|Ga0209321_10169303 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300025312|Ga0209321_10525523 | Not Available | 527 | Open in IMG/M |
3300025318|Ga0209519_10136593 | Not Available | 1449 | Open in IMG/M |
3300025318|Ga0209519_10287122 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300025318|Ga0209519_10443024 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300025318|Ga0209519_10690666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 551 | Open in IMG/M |
3300025319|Ga0209520_10084225 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
3300025322|Ga0209641_10148603 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300025322|Ga0209641_10217263 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300025324|Ga0209640_10078747 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
3300025324|Ga0209640_10149053 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
3300025324|Ga0209640_10190614 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
3300025324|Ga0209640_10544085 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300025324|Ga0209640_11142438 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300025324|Ga0209640_11276269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 546 | Open in IMG/M |
3300025325|Ga0209341_10305391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-11 | 1309 | Open in IMG/M |
3300025325|Ga0209341_10432844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1060 | Open in IMG/M |
3300025325|Ga0209341_10760486 | Not Available | 739 | Open in IMG/M |
3300025965|Ga0210090_1005514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1709 | Open in IMG/M |
3300026354|Ga0257180_1001771 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
3300026371|Ga0257179_1015147 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300026377|Ga0257171_1016921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1218 | Open in IMG/M |
3300026377|Ga0257171_1086114 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300026469|Ga0257169_1010923 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300026480|Ga0257177_1019327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 959 | Open in IMG/M |
3300026507|Ga0257165_1004058 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300026507|Ga0257165_1034081 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300026507|Ga0257165_1087038 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300027815|Ga0209726_10042793 | All Organisms → cellular organisms → Bacteria | 3279 | Open in IMG/M |
3300027815|Ga0209726_10053764 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
3300027815|Ga0209726_10168728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1194 | Open in IMG/M |
3300027815|Ga0209726_10428073 | Not Available | 610 | Open in IMG/M |
3300027846|Ga0209180_10000866 | All Organisms → cellular organisms → Bacteria | 14679 | Open in IMG/M |
3300027952|Ga0209889_1028118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1238 | Open in IMG/M |
3300028673|Ga0257175_1021555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1070 | Open in IMG/M |
3300028803|Ga0307281_10160598 | Not Available | 792 | Open in IMG/M |
3300030006|Ga0299907_10683323 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300030620|Ga0302046_10932243 | Not Available | 693 | Open in IMG/M |
3300031834|Ga0315290_10110034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2334 | Open in IMG/M |
3300031949|Ga0214473_10003437 | All Organisms → cellular organisms → Bacteria | 19219 | Open in IMG/M |
3300031949|Ga0214473_10028013 | All Organisms → cellular organisms → Bacteria | 6600 | Open in IMG/M |
3300031949|Ga0214473_10072603 | All Organisms → cellular organisms → Bacteria | 4024 | Open in IMG/M |
3300031949|Ga0214473_10073591 | All Organisms → cellular organisms → Bacteria | 3996 | Open in IMG/M |
3300031949|Ga0214473_10443340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1458 | Open in IMG/M |
3300031949|Ga0214473_10552466 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300031965|Ga0326597_10079429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4037 | Open in IMG/M |
3300031965|Ga0326597_11597354 | Not Available | 621 | Open in IMG/M |
3300031997|Ga0315278_10229404 | All Organisms → cellular organisms → Bacteria | 1914 | Open in IMG/M |
3300032163|Ga0315281_10911748 | Not Available | 898 | Open in IMG/M |
3300032164|Ga0315283_10648198 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300032401|Ga0315275_10285128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1848 | Open in IMG/M |
3300033407|Ga0214472_10959928 | Not Available | 759 | Open in IMG/M |
3300033417|Ga0214471_10049981 | All Organisms → cellular organisms → Bacteria | 3412 | Open in IMG/M |
3300033417|Ga0214471_10089925 | All Organisms → cellular organisms → Bacteria | 2522 | Open in IMG/M |
3300033417|Ga0214471_10258746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1421 | Open in IMG/M |
3300033417|Ga0214471_11199187 | Not Available | 577 | Open in IMG/M |
3300034177|Ga0364932_0234765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 694 | Open in IMG/M |
3300034178|Ga0364934_0197301 | Not Available | 763 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 24.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 11.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 6.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.78% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.47% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.89% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.89% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 2.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.31% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.73% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.16% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.58% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.58% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C687J26616_100815083 | 3300002120 | Soil | MRPLTLSLSPSGGEGIETTPSPSERERVGVRVALSSRRVHA |
C687J26615_100256001 | 3300002121 | Soil | RPLTLSLSPLGAEGIETAPSPSERERVGVRVAYVFTHDPR* |
C687J26615_100789102 | 3300002121 | Soil | MRPLTLSLSPSGGEGIKTAPSPSERERVGVRVAHVFTHNPD* |
C687J26615_100832952 | 3300002121 | Soil | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTHNPG* |
C687J26615_101365421 | 3300002121 | Soil | MHPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFT |
C687J26615_101689041 | 3300002121 | Soil | MHPLTLSLSPGGEGIEAAPSPSSIKRVGVRVAHEFT |
C687J26623_100322671 | 3300002122 | Soil | MRPLTLSLSPSRGEGIETAPSPSSIKRVGVRVAHV |
C687J26631_100529311 | 3300002124 | Soil | VRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTH |
C687J26631_101933342 | 3300002124 | Soil | LSLSPGGEGIETAPSPSERERVGVRVAHMFTHSPGSGG* |
Ga0055435_100586322 | 3300003994 | Natural And Restored Wetlands | TRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHMFTHNPG* |
Ga0055433_100576243 | 3300004025 | Natural And Restored Wetlands | PLTLSLSPGGGEGIEAPPSPSARERAGVRVAQVFTHNPG* |
Ga0068997_101211732 | 3300005204 | Natural And Restored Wetlands | PRPMHPLTLSLSPSGGEGIEAAPPPSAREGAGVRVALMFTHNPG* |
Ga0070708_1000813402 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIPYPRLALTLSLSPSGGEGIEIASLSEGEGRGEGARVFTHNPR* |
Ga0070708_1001063974 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHPAKRCALPLTLSLSPSGGEGIEMASLSLGEGEGRGEGPHVFTHNPR* |
Ga0070707_1000397094 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RTRIPRRALPLTLSLSPSGGEGIEMAPSPSERERVGVRVRVFTHNPR* |
Ga0070707_1022580451 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RIPRRALPLTLSLSPSGGEGIEMAPSPSERERVRGEGARVFTHNPR* |
Ga0070697_1020008501 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RIPRRALPLTLSLSPSGGEGIEMAPSPSEREKVGGEGARVSTHNPL* |
Ga0066710_1001625811 | 3300009012 | Grasslands Soil | PTLPLTLSLSPSGGEGIETAPSPSERERVGVRGADLFTHNAG |
Ga0099827_113287261 | 3300009090 | Vadose Zone Soil | PLTLSLSPSGGEGIGTASSPSERKRVGVRVAHLLANYPR* |
Ga0066709_1003375671 | 3300009137 | Grasslands Soil | TLSLSPSGGEGIETAPSPSERERVGVRGADLFTHNAG* |
Ga0129287_102092703 | 3300009538 | Beach Aquifer Porewater | PLTLSLSPSGGEGSETTPSPLERERAGVRVGYAFAHNPD* |
Ga0126379_123409081 | 3300010366 | Tropical Forest Soil | GRRQMRIARTTLPLTLSLSPSGGEGIETPSPSERERVGVRVAGGA* |
Ga0137446_10461062 | 3300011419 | Soil | LSLSPFGGEGIETAPSPSSIKRVGVRVAHVFTHDPG* |
Ga0137456_10502002 | 3300011428 | Soil | PRPMRPLTLSLSPAGGEGIETTPSPSARERVGVRVAHVFTHSPG* |
Ga0137455_11897632 | 3300011429 | Soil | TRPLALSLSPSGGEGIETAPSPSARERVGVRVAHVPTHSPG* |
Ga0137445_10873141 | 3300012035 | Soil | LTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG* |
Ga0137389_103377902 | 3300012096 | Vadose Zone Soil | LPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG* |
Ga0137352_10973231 | 3300012164 | Soil | PRPMRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPV* |
Ga0137338_10042754 | 3300012174 | Soil | LTLSLSPSGGEGIDTTPSPSARERVGVRVAQVFTHRPG* |
Ga0137338_10506901 | 3300012174 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSAG* |
Ga0137338_10546163 | 3300012174 | Soil | RTRAPRPMRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHMFTHSPG* |
Ga0137338_10699072 | 3300012174 | Soil | MRPLTLSLSPSGGEGIDTTPSPSARERVGVRVAQVFTHS |
Ga0137334_10660833 | 3300012179 | Soil | MRPLTLSLSPSGGEGIETPPSPSARERAGVRGVHA |
Ga0137434_10246961 | 3300012225 | Soil | LTLSLSPSGGEGIETTPSPSARERVGVRVAHVPTHSPG* |
Ga0137373_101082613 | 3300012532 | Vadose Zone Soil | STSYAPLTLSLSPSGGEGIETAPSPSERLGEGEGRGEGADLFTHKAG* |
Ga0180080_10410641 | 3300014870 | Soil | LTLSLSPSGGEGIETAPSPSERERVGVRVAHVFTHNPD* |
Ga0180066_10039744 | 3300014873 | Soil | RPLTLSLSPSGGEGIETTPSPSARERGGVRVAQVFNIGRS* |
Ga0180074_10137601 | 3300014877 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG* |
Ga0180074_10570001 | 3300014877 | Soil | MLPLTLSLFPSGGEGIDTTPSPSARERVGVRVAQVFTHS |
Ga0180094_10794082 | 3300014881 | Soil | MRPLTLSLSPSGGEGIEMAPSPSERERVGVRVAHVFTHNPR* |
Ga0180094_10804592 | 3300014881 | Soil | PLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFTHNPE* |
Ga0180094_11101031 | 3300014881 | Soil | LSLSGGEGIETTPSPSARERVGVRVAQVFTHSPG* |
Ga0180104_10023324 | 3300014884 | Soil | MHPLTLSLSGGEGIETAPSPSERERVGVRVAHVFTHNPG* |
Ga0180104_10176793 | 3300014884 | Soil | MRPLTLSLSPSGGEGIETAPPSERERVGVRVAYAFTHNPV* |
Ga0180104_10357171 | 3300014884 | Soil | MRPLTLSLSPSGGEGIETPPSPSARERVGVRVAHVFTPRPG |
Ga0180104_10497232 | 3300014884 | Soil | LTLSLSPSGGEGIDTTPSPSARERVGVRVAHVFTHSPG* |
Ga0180104_10607713 | 3300014884 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPV* |
Ga0180104_11217902 | 3300014884 | Soil | LSPSGGEGIDTTPSPSARERVGVRVAQVFTHRPG* |
Ga0180104_11397421 | 3300014884 | Soil | RPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG* |
Ga0180104_12047222 | 3300014884 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTH |
Ga0180104_12467612 | 3300014884 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFT |
Ga0180063_10184251 | 3300014885 | Soil | RPLTLSLSPSGGEGIETAPSPSEGERERVGVRVAHVFTHYPG* |
Ga0180063_10365903 | 3300014885 | Soil | RPLTLSLSPSGGEGIDTTPSPSARERVGVRVAQVLTHSPG* |
Ga0180063_10476261 | 3300014885 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG* |
Ga0180063_10931122 | 3300014885 | Soil | SLSPSGGEEIDTTPSPSARERVGVRVAQVFTHSPG* |
Ga0180063_11357921 | 3300014885 | Soil | RPLTLSLSPSGGEGIETPPSPSARERVGVRVAHVFTHSPG* |
Ga0180063_11999082 | 3300014885 | Soil | LTLSLSPSGGEGYDPTPSPSARERVGVWVAQVFTHSPG* |
Ga0180063_12561632 | 3300014885 | Soil | RPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG* |
Ga0180063_12616602 | 3300014885 | Soil | MCPLTLSLSPTGGEGIDTTPSPSARERVGVRVAQVFTHS |
Ga0180075_10188632 | 3300015252 | Soil | LRPLTLSLSLSEGEGIETAPSPSERERVGVRVAYVFTHNPG* |
Ga0180073_10306702 | 3300015256 | Soil | MHPLTLSLSPFGGEGIETAPSPSERERVGVRVAYVFTH |
Ga0180073_11167801 | 3300015256 | Soil | MRPLTLSLSPSGGEGIETAPSPSPRERAGVRVAHVFSHNPG |
Ga0180085_10610331 | 3300015259 | Soil | LTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG* |
Ga0180085_10933663 | 3300015259 | Soil | PSLLYSTLTLSLSPSGGEGIEPTPSPSARERVGVRVAPVFTHSPG* |
Ga0180085_11355681 | 3300015259 | Soil | MLPLTLSLSPSGGEGIETTPSPSARERGGVRVAHVFT |
Ga0180085_12175402 | 3300015259 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHS |
Ga0187778_109572661 | 3300017961 | Tropical Peatland | TVPLTLALSPSGGEGTRMTPSPSERERGGVRVGDSL |
Ga0184610_10669401 | 3300017997 | Groundwater Sediment | MLPLTLSLSPSGGEGIETTPSPSARERVGVRVAHV |
Ga0184634_100204481 | 3300018031 | Groundwater Sediment | PLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0184626_101063092 | 3300018053 | Groundwater Sediment | PLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG |
Ga0184623_100755162 | 3300018056 | Groundwater Sediment | LPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0184615_100563733 | 3300018059 | Groundwater Sediment | MRPLTLSLFPSGGEGIETAPSPSERERVGVRVAHVVTHIPA |
Ga0184615_101706403 | 3300018059 | Groundwater Sediment | MLPLTLSLSPSGGEGIETTPSPSARERVGVRGAHVFTH |
Ga0184615_101974502 | 3300018059 | Groundwater Sediment | PLDKQDSRSGGEGIETAPSPSERERVGVRVAHVFTHNPG |
Ga0184615_105219141 | 3300018059 | Groundwater Sediment | MRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFTHNPG |
Ga0184637_100214541 | 3300018063 | Groundwater Sediment | MGPDPLHSSMGVARPTRPLTLTLSPSGGEGIETTPSPSARERVGVRVAPVV |
Ga0184640_101437001 | 3300018074 | Groundwater Sediment | PRPMLPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHGPA |
Ga0184640_103665142 | 3300018074 | Groundwater Sediment | MHPLTLSLSPSGGEGIETAPSPSERERGGVRVAHVF |
Ga0184609_101623551 | 3300018076 | Groundwater Sediment | PMLPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHGPG |
Ga0184609_104138652 | 3300018076 | Groundwater Sediment | LTLSLSPSGGEGIETTPSPSARERVGVRVAHVPTHSPG |
Ga0184612_100432511 | 3300018078 | Groundwater Sediment | MRPLTLSLSPSGGEGIETAPSPSPRERVGVRVAYVFTHNP |
Ga0184627_102546192 | 3300018079 | Groundwater Sediment | LPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG |
Ga0190265_100445575 | 3300018422 | Soil | TRVPRPARPLTLTLSPSGGEGIETAPSPSARERVGVRVAPVFTHSPG |
Ga0190265_102403411 | 3300018422 | Soil | RPLTLTLSPSGGEGIETAPSPSARERVGVRVAPVFTHSLG |
Ga0190265_103963771 | 3300018422 | Soil | LTLSPSGGEGIERAPSPSARERVGVRVAPVFTHSSG |
Ga0190265_108008321 | 3300018422 | Soil | MRVPRPARPLTLTLSPSGGEGIERAPSPSARERVGVRVAPVFTHS |
Ga0190265_111225171 | 3300018422 | Soil | RPARPLTLTLSPSGGEGIERAPSPSARERVGVRVAPVFTHRPG |
Ga0190265_113822701 | 3300018422 | Soil | MRVPRPTRPLTLTLSPSGGEGIERAPSPSARERVGVRVAPVFT |
Ga0190272_101892811 | 3300018429 | Soil | LPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVPTHSPG |
Ga0190272_111179231 | 3300018429 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQV |
Ga0066669_123157931 | 3300018482 | Grasslands Soil | LTLSPSGGEWVGTTPSPSERKRAGVRVAYEFTHSLGLGVE |
Ga0187892_104263092 | 3300019458 | Bio-Ooze | RRPMRPLTLSLSPFGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0187893_108567591 | 3300019487 | Microbial Mat On Rocks | HPLTLSLSPSGGEGIETAPSPSERERGGVRVAHVLTHNPG |
Ga0193713_11143391 | 3300019882 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAMCSR |
Ga0193725_10415191 | 3300019883 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVPTHS |
Ga0193727_11107662 | 3300019886 | Soil | APRPMLPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0193727_11333012 | 3300019886 | Soil | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSAGYLHA |
Ga0210378_103026841 | 3300021073 | Groundwater Sediment | RPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPR |
Ga0210379_100570241 | 3300021081 | Groundwater Sediment | MRPLTLSLSASGGEGIETAPSPSERERAGVRVAYAFAHNPG |
Ga0210379_100816493 | 3300021081 | Groundwater Sediment | LSLSPSGGEGIDTAPSPSERERVGVRVAHIFTHNPG |
Ga0210379_102938652 | 3300021081 | Groundwater Sediment | TLPSPPSGGEGIETAPSPSERERVGVRVAHVFTHDAG |
Ga0210377_103887713 | 3300021090 | Groundwater Sediment | SLSPSGGEGIETAPSPSERERVGVRVAHVFTHNPG |
Ga0210377_106450323 | 3300021090 | Groundwater Sediment | MRPLTLSLSPSGGEGIDPAPSPSERERVGVRVAHVFTHDPG |
Ga0224452_10824622 | 3300022534 | Groundwater Sediment | TLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHGPG |
Ga0209320_102866701 | 3300025155 | Soil | PRPMPPLTLSLSPGGEGIEAAPSPSSIKRVGVRVAHEFTQNPG |
Ga0209619_100933103 | 3300025159 | Soil | MRPLTLSLSPGGEGIETAPSPSERERVGVRVAHVFTHNP |
Ga0209619_102481792 | 3300025159 | Soil | LSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTHNPG |
Ga0209619_105469001 | 3300025159 | Soil | RPLPLSLSPSRGEGIETAPSPSERERAGVRVAHEFTHNPD |
Ga0209108_100361284 | 3300025165 | Soil | SLSPSRGEGIETAPSPSSIKRVGVRVAHVFTHNPG |
Ga0209108_104132992 | 3300025165 | Soil | MRPLTLSLSPSRGEGIETAPSPSSIKRVGVRVAHVFTHN |
Ga0209108_105249292 | 3300025165 | Soil | MRPLTLSLSPGGEGIETAPSPSSIKRVGVRVAHVF |
Ga0209002_102188072 | 3300025289 | Soil | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTHNPDPLD |
Ga0209002_104929862 | 3300025289 | Soil | PRPMRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVITHIPG |
Ga0209321_100745741 | 3300025312 | Soil | LSLSPSGGEGIKTAPSPSERERVGVRVAHVFTHNPD |
Ga0209321_101467281 | 3300025312 | Soil | RPLPLSLSPSGGEGIETAPSPSERERVGVRVAHVFTRNPG |
Ga0209321_101693031 | 3300025312 | Soil | MRPLTLSLSPGGEGIETAPSPSERERVGVRVAHVFT |
Ga0209321_105255232 | 3300025312 | Soil | MRPLTLSLSPCGGEGIETAPSPSERERVGVRVALS |
Ga0209519_101365931 | 3300025318 | Soil | SLSPSRGEGIETAPSPSERERVGVRVAYEFTHNPG |
Ga0209519_102871221 | 3300025318 | Soil | AQRAVRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFTHHPR |
Ga0209519_104430241 | 3300025318 | Soil | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAVSSRIIRIRQ |
Ga0209519_106906661 | 3300025318 | Soil | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFT |
Ga0209520_100842254 | 3300025319 | Soil | LTLSLSPSGGEGIGTAPSPSPRERVGVRVEYVFTHNPG |
Ga0209641_101486033 | 3300025322 | Soil | MRPLTLSLSPSRGEGIETAPSPSSIKRVGVRVAHVFT |
Ga0209641_102172632 | 3300025322 | Soil | LSLSPSGGEGIGTAPSPSERERVGVRVEYVFTHNPG |
Ga0209640_100787471 | 3300025324 | Soil | MRPLNLSLSPSGGEGIETTPSPSARERVGVRVAPVFT |
Ga0209640_101490533 | 3300025324 | Soil | PLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFTRNPG |
Ga0209640_101906143 | 3300025324 | Soil | LSLSPSGGEGIETVPSPSSIKRVGVRGAQVFRHNPG |
Ga0209640_105440851 | 3300025324 | Soil | VPRPMRPLTLSLSPGGEGIETAPSPSERERVGVRVAHVFTHNPGWSG |
Ga0209640_111424382 | 3300025324 | Soil | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTHDPG |
Ga0209640_112762691 | 3300025324 | Soil | MRPLTLSLSPSGGEGIETTPSPSSIKRVGVRVAHVSTHDSAQL |
Ga0209341_103053911 | 3300025325 | Soil | LSLSPSRGEGIETAPSPSERERVGVRVAYEFTHNPG |
Ga0209341_104328441 | 3300025325 | Soil | MRPLTLSLSPSGGEGIGTAPSPSERERVGVRVAYVFTHNPGW |
Ga0209341_107604861 | 3300025325 | Soil | ALSPSGGEGIETAPSPSERERVGVRVAHVITHIPG |
Ga0210090_10055143 | 3300025965 | Natural And Restored Wetlands | MHPLTLSLSPFGGEGIETTPSPSARERVGVRVALMFTHNPG |
Ga0257180_10017715 | 3300026354 | Soil | PLTLSLSPSGGEGIETAPSPSARERGGVRVAHMFTHDPG |
Ga0257179_10151471 | 3300026371 | Soil | PRPMRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSAG |
Ga0257171_10169211 | 3300026377 | Soil | SPSGGEGIETTPSPSARERVGVRVAHVFTHSLGYRPT |
Ga0257171_10861141 | 3300026377 | Soil | PMLPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVTHSPG |
Ga0257169_10109231 | 3300026469 | Soil | MLPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVTH |
Ga0257177_10193273 | 3300026480 | Soil | HERVFRPMRPLTLSLSPSGGEGIETAPSPSARERGGVRVAHMFTHDPG |
Ga0257165_10040581 | 3300026507 | Soil | MLPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVL |
Ga0257165_10340811 | 3300026507 | Soil | PMLPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0257165_10870383 | 3300026507 | Soil | MLPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVTHSPG |
Ga0209726_100427931 | 3300027815 | Groundwater | MRPLTRSLSPSGGEGIETTPSPSARERVGVRGAHAFTH |
Ga0209726_100537643 | 3300027815 | Groundwater | TLSLSPSGGEGIETAPSPSASERVGVRVAHAFTHDPV |
Ga0209726_101687281 | 3300027815 | Groundwater | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVVTHSPG |
Ga0209726_104280732 | 3300027815 | Groundwater | LSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSPG |
Ga0209180_1000086620 | 3300027846 | Vadose Zone Soil | RPMLPLTLSLSPSGGEGIETTPSPSARERVRVRVAQVTHSPG |
Ga0209889_10281183 | 3300027952 | Groundwater Sand | MRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTH |
Ga0257175_10215551 | 3300028673 | Soil | PLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHSLGYRPT |
Ga0307281_101605982 | 3300028803 | Soil | MLPLTLSLSPSGGEGIETTPSPSARERVGVRVAHVFTHS |
Ga0299907_106833231 | 3300030006 | Soil | VLMRPLTLSLSPSGGEGIETAPSPSERERVGVEGAHGFTHNPD |
Ga0302046_109322432 | 3300030620 | Soil | MHPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVF |
Ga0315290_101100343 | 3300031834 | Sediment | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAYVFTHNPG |
Ga0214473_100034371 | 3300031949 | Soil | VPRPMRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTHNPG |
Ga0214473_100280131 | 3300031949 | Soil | VPRPMRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFTHNPG |
Ga0214473_100726031 | 3300031949 | Soil | PLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHAFTHNPG |
Ga0214473_100735911 | 3300031949 | Soil | MRPLTLSLSPSGGEGIETAPSPSSIKRVGVRVAHVFTH |
Ga0214473_104433404 | 3300031949 | Soil | MRPLTLSLSPSGGEGIELTPSPSSIKRAGVRVGACSR |
Ga0214473_105524663 | 3300031949 | Soil | MRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHAFTHNPG |
Ga0326597_100794295 | 3300031965 | Soil | MRPLTLSLSPFGGEGIETAPSPSERERVGVRVAHVFTQNPV |
Ga0326597_115973542 | 3300031965 | Soil | LTLSLSGGEGIETAPSPSSIKRAGVRVAHVFTHNSA |
Ga0315278_102294044 | 3300031997 | Sediment | MRPLTLALSPYGGEGIKTAPSPSSIKRVGVRVADVFTHNSG |
Ga0315281_109117482 | 3300032163 | Sediment | MRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVF |
Ga0315283_106481981 | 3300032164 | Sediment | MRPLTLALSPYGGEGIKTAPSPSSIKRVVVRVADVFTRNSG |
Ga0315275_102851283 | 3300032401 | Sediment | LSPSGGEGIETAPSPSERERVGVRVAHVFTHDPGQMPRCEMTGAS |
Ga0214472_109599282 | 3300033407 | Soil | PRPMRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0214471_100499811 | 3300033417 | Soil | TLPPPPAGGVGIHPTPSPSAWEWVGVWVAPVFTHSPG |
Ga0214471_100899254 | 3300033417 | Soil | MRPLTLSLSPSGGEGIETAPSPSERERVGVRVAHVFPHSPA |
Ga0214471_102587463 | 3300033417 | Soil | APRPMRPLTLSLSPSGGEGIETTPSPSARERVGVRVAQVFTHSPG |
Ga0214471_111991871 | 3300033417 | Soil | MHPLTLSLSPSGGEGIETAPSPSERERGGVRVAHVFTHVRVRTHSDPQ |
Ga0364932_0234765_577_693 | 3300034177 | Sediment | MRPLTLSLSPSGGEGIETAPSPSSIERVGVRVAHVFTHN |
Ga0364934_0197301_641_763 | 3300034178 | Sediment | MLPLTLSLSPSGGEGIETTPSPSTGETVGVRVAQVFTHSPG |
⦗Top⦘ |