NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034946

Metagenome / Metatranscriptome Family F034946

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034946
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 204 residues
Representative Sequence AINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLR
Number of Associated Samples 157
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.07 %
% of genes near scaffold ends (potentially truncated) 78.03 %
% of genes from short scaffolds (< 2000 bps) 99.42 %
Associated GOLD sequencing projects 146
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.266 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(16.763 % of family members)
Environment Ontology (ENVO) Unclassified
(36.994 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(43.931 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.17%    β-sheet: 0.00%    Coil/Unstructured: 59.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF01221Dynein_light 0.58
PF02788RuBisCO_large_N 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG1850Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like proteinCarbohydrate transport and metabolism [G] 0.58

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.42 %
UnclassifiedrootN/A0.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002161|JGI24766J26685_10100872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia614Open in IMG/M
3300002835|B570J40625_100958179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila735Open in IMG/M
3300003621|JGI26083J51738_10092158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea652Open in IMG/M
3300003621|JGI26083J51738_10104816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea600Open in IMG/M
3300003684|Ga0005851_1011557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea572Open in IMG/M
3300004112|Ga0065166_10296305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300004769|Ga0007748_11264994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea807Open in IMG/M
3300004789|Ga0007752_11038045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea882Open in IMG/M
3300004792|Ga0007761_11095087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea523Open in IMG/M
3300004804|Ga0007796_10190897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea605Open in IMG/M
3300005420|Ga0068879_1718697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea982Open in IMG/M
3300005421|Ga0068882_1748610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea886Open in IMG/M
3300005565|Ga0068885_1812754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea628Open in IMG/M
3300005662|Ga0078894_10345055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1349Open in IMG/M
3300005662|Ga0078894_10900088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300005805|Ga0079957_1194887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea983Open in IMG/M
3300005980|Ga0066798_10114808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300005989|Ga0075154_10086183All Organisms → cellular organisms → Eukaryota1886Open in IMG/M
3300006071|Ga0007876_1089848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila800Open in IMG/M
3300006108|Ga0007862_1087007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia596Open in IMG/M
3300006116|Ga0007807_1080755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila607Open in IMG/M
3300006355|Ga0075501_1271977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300006355|Ga0075501_1361285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea853Open in IMG/M
3300006378|Ga0075498_1194262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea893Open in IMG/M
3300006394|Ga0075492_1504424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea908Open in IMG/M
3300006396|Ga0075493_1505307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia560Open in IMG/M
3300006397|Ga0075488_1627952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea970Open in IMG/M
3300006415|Ga0099654_10284843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea923Open in IMG/M
3300006419|Ga0075496_1409752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea576Open in IMG/M
3300006424|Ga0075497_1416253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea998Open in IMG/M
3300006641|Ga0075471_10157438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1199Open in IMG/M
3300006803|Ga0075467_10224245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1032Open in IMG/M
3300006803|Ga0075467_10523121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea609Open in IMG/M
3300007319|Ga0102691_1553894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea946Open in IMG/M
3300007534|Ga0102690_1752918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300007554|Ga0102820_1103845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila683Open in IMG/M
3300007559|Ga0102828_1018888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1482Open in IMG/M
3300007561|Ga0102914_1166316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300007864|Ga0105749_1076015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea713Open in IMG/M
3300007953|Ga0105738_1017405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea990Open in IMG/M
3300007972|Ga0105745_1129206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea762Open in IMG/M
3300008111|Ga0114344_1143300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea824Open in IMG/M
3300008111|Ga0114344_1153897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea782Open in IMG/M
3300008113|Ga0114346_1162747All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300008113|Ga0114346_1287020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300009026|Ga0102829_1070101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
3300009068|Ga0114973_10382405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300009142|Ga0102885_1075127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea809Open in IMG/M
3300009152|Ga0114980_10130862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1492Open in IMG/M
3300009152|Ga0114980_10519051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea677Open in IMG/M
3300009155|Ga0114968_10243616All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300009169|Ga0105097_10295940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea894Open in IMG/M
3300009436|Ga0115008_10308633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1123Open in IMG/M
3300009563|Ga0130030_1036304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea757Open in IMG/M
3300009599|Ga0115103_1282352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea921Open in IMG/M
3300009599|Ga0115103_1809174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1031Open in IMG/M
3300009606|Ga0115102_10890706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila694Open in IMG/M
3300010388|Ga0136551_1079850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300010388|Ga0136551_1090063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300010885|Ga0133913_12574971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1236Open in IMG/M
3300012030|Ga0136599_1018572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1008Open in IMG/M
3300012471|Ga0129334_1095899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea514Open in IMG/M
3300012518|Ga0129349_1029031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300012525|Ga0129353_1608572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300012690|Ga0157575_122216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea505Open in IMG/M
3300012692|Ga0157571_1081456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea553Open in IMG/M
3300012693|Ga0157573_1091942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea543Open in IMG/M
3300012696|Ga0157579_1109844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300012703|Ga0157572_1153484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300012704|Ga0157574_1174970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea638Open in IMG/M
3300012706|Ga0157627_1095056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea842Open in IMG/M
3300012714|Ga0157601_1189320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea726Open in IMG/M
3300012717|Ga0157609_1019763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea691Open in IMG/M
3300012720|Ga0157613_1258218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300012721|Ga0157612_1004690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea839Open in IMG/M
3300012722|Ga0157630_1129913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300012729|Ga0157625_1175335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300012730|Ga0157602_1063235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea658Open in IMG/M
3300012734|Ga0157615_1064941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300012734|Ga0157615_1376984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea502Open in IMG/M
3300012759|Ga0157626_1146234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea673Open in IMG/M
3300012953|Ga0163179_10370939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1153Open in IMG/M
3300012953|Ga0163179_10894231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea768Open in IMG/M
3300012954|Ga0163111_11571759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila653Open in IMG/M
3300012959|Ga0157620_1140573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M
3300012962|Ga0129335_1169986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea906Open in IMG/M
3300012966|Ga0129341_1149148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila640Open in IMG/M
3300012968|Ga0129337_1018126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila626Open in IMG/M
3300012970|Ga0129338_1424664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea941Open in IMG/M
3300013005|Ga0164292_10312732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1071Open in IMG/M
3300013295|Ga0170791_12404645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea967Open in IMG/M
3300013310|Ga0157622_1044189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea660Open in IMG/M
3300014491|Ga0182014_10499631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300016688|Ga0180039_1120151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea614Open in IMG/M
3300016703|Ga0182088_1262105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea612Open in IMG/M
3300016723|Ga0182085_1299268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300016727|Ga0182051_1179280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea519Open in IMG/M
3300016727|Ga0182051_1195989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1006Open in IMG/M
3300016731|Ga0182094_1074620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1053Open in IMG/M
3300016740|Ga0182096_1076709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea960Open in IMG/M
3300016741|Ga0182079_1489922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila843Open in IMG/M
3300016746|Ga0182055_1384121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300016748|Ga0182043_1492556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300017788|Ga0169931_10209900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1646Open in IMG/M
3300017951|Ga0181577_10295415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1053Open in IMG/M
3300017958|Ga0181582_10820582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila552Open in IMG/M
3300018842|Ga0193219_1019412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1005Open in IMG/M
3300018980|Ga0192961_10073321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1017Open in IMG/M
3300018982|Ga0192947_10095294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea982Open in IMG/M
3300019017|Ga0193569_10321508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea631Open in IMG/M
3300019261|Ga0182097_1431421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea890Open in IMG/M
3300019262|Ga0182066_1182338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300019274|Ga0182073_1402719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila630Open in IMG/M
3300019276|Ga0182067_1164873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea886Open in IMG/M
3300020013|Ga0182086_1083575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300020155|Ga0194050_1122244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea706Open in IMG/M
3300020157|Ga0194049_1040956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1204Open in IMG/M
3300020204|Ga0194116_10360670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300020725|Ga0214200_1039321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M
3300021308|Ga0210350_1138192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea573Open in IMG/M
3300021364|Ga0213859_10438295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300021365|Ga0206123_10260585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300021890|Ga0063090_1075439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea546Open in IMG/M
3300021911|Ga0063106_1067867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea926Open in IMG/M
3300021962|Ga0222713_10259533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1127Open in IMG/M
3300021962|Ga0222713_10289642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila1048Open in IMG/M
3300021964|Ga0222719_10600933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila640Open in IMG/M
3300022166|Ga0213932_1065540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300023706|Ga0232123_1061212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea738Open in IMG/M
3300025450|Ga0208744_1087392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea599Open in IMG/M
3300025570|Ga0208660_1077123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila769Open in IMG/M
3300025732|Ga0208784_1070694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1058Open in IMG/M
3300025785|Ga0208498_1042887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300025887|Ga0208544_10217620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300026495|Ga0247571_1140341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila568Open in IMG/M
3300027237|Ga0208930_1042103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea627Open in IMG/M
3300027254|Ga0208177_1083409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea588Open in IMG/M
3300027256|Ga0208932_1077018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300027259|Ga0208178_1066006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300027720|Ga0209617_10104869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1138Open in IMG/M
3300027754|Ga0209596_1163812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea978Open in IMG/M
3300027760|Ga0209598_10106293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1310Open in IMG/M
3300027760|Ga0209598_10305985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300027786|Ga0209812_10102160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1376Open in IMG/M
3300027793|Ga0209972_10295351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea716Open in IMG/M
3300027797|Ga0209107_10370102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea659Open in IMG/M
3300027805|Ga0209229_10400073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea596Open in IMG/M
3300027833|Ga0209092_10200547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1123Open in IMG/M
3300027971|Ga0209401_1133750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea985Open in IMG/M
3300027973|Ga0209298_10366559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300027976|Ga0209702_10236168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea764Open in IMG/M
3300028412|Ga0306910_1022376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
(restricted) 3300028557|Ga0247832_1112766All Organisms → Viruses → Predicted Viral1125Open in IMG/M
3300029908|Ga0311341_10294206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea968Open in IMG/M
3300029913|Ga0311362_11229659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea554Open in IMG/M
3300029915|Ga0311358_10991032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300029955|Ga0311342_11127308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea571Open in IMG/M
3300031261|Ga0302140_10589411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea838Open in IMG/M
3300031710|Ga0307386_10423955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300031758|Ga0315907_10933451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea633Open in IMG/M
3300031758|Ga0315907_11285053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300031784|Ga0315899_10572251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1070Open in IMG/M
3300031788|Ga0302319_11277137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea671Open in IMG/M
3300032492|Ga0314679_10364956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila657Open in IMG/M
3300032724|Ga0314695_1411061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300033572|Ga0307390_10582127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea697Open in IMG/M
3300033984|Ga0334989_0376294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300034019|Ga0334998_0411986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300034064|Ga0335001_0480544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea660Open in IMG/M
3300034064|Ga0335001_0531221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea622Open in IMG/M
3300034072|Ga0310127_125008All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1058Open in IMG/M
3300034116|Ga0335068_0291987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea815Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater16.76%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.14%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh9.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.78%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.78%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.47%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.47%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.47%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.73%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.73%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.16%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.16%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.16%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.16%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.16%
Pond Fresh WaterEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water1.16%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.16%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.16%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.16%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.16%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.16%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.58%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.58%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.58%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.58%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.58%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.58%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.58%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.58%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300003684Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0MEnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005421Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005565Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006071Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006116Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006424Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007319Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007534Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007953Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009563Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 6m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010388Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012690Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES078 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012692Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES073 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012693Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES075 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012696Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES083 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012699Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES110 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012703Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA- GEODES074 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012704Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES077 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012714Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012721Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012734Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012959Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES150 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300016688Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020155Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10mEnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300020204Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surfaceEnvironmentalOpen in IMG/M
3300020725Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnionEnvironmentalOpen in IMG/M
3300021308Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.462 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022166Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025450Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027237Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027256Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027259Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027786Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes)EngineeredOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24766J26685_1010087213300002161Freshwater And SedimentEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGRSVSDLKLKTWEYGKGGNLRSDS
B570J40625_10095817913300002835FreshwaterMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIE
JGI26083J51738_1009215813300003621MarinePKTPKPHLLNDNKYNLGEMISNFASSFTPEWYVHQGKPHYNLGNKIIHSDLYKSLNPLRMRYEAQTGEEVSMPFYFSKVPQLVWLYGNLDYSFQKYHRHYQAHDDWYPDRKNKTLGVKGGGFMNPNKQASKFMTLQPHKIPRGCFREIKSKFMTLQPHKIPRGCFREIKKYQACTSEKDKERCLNEKVSIMEVCPDHVLEGLREKRKWYLRAEAIDN
JGI26083J51738_1010481613300003621MarinePKTPKPHLLNDNKYNLGEMISNFASSFTPEWYVHQGKPHYNLGNKIIHSDLYKSLNPLRMRYEAQTGEEVSMPFYFSKVPQLVWLYGNLDYSFQKYHRHYQAHDDWYPDRKNKTLGVKGGGFMNPNKQASKFMTLQPHKIPRGCFREIKKYQACTSEKDKERCLNEKVSIMEVCPDHVLEGLREKRKWYLRAEAIDNQT
Ga0005851_101155713300003684Freshwater And SedimentAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNK
Ga0065166_1029630513300004112Freshwater LakeKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRY
Ga0007748_1126499413300004769Freshwater LakeSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0007752_1103804513300004789Freshwater LakeEYYWQKGHYNLGNKIVHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0007761_1109508713300004792Freshwater LakeFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDND
Ga0007796_1019089713300004804FreshwaterHSDLYKALNPIRTRYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQICSSKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVSDLQLKTWEHGKGGKLRSDTIWQDDRYNPTKYS
Ga0068879_171869713300005420Freshwater LakeMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0068882_174861013300005421Freshwater LakeAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0068885_181275413300005565Freshwater LakeLNMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCASKKGTDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGKSVSDLTLKTWEYG
Ga0078894_1034505533300005662Freshwater LakeFYSSNFPEYYWQKGHYNLGNKLVHSDLYKKLNPIRARYDYNPNDYSQMPFFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENTMKQSKYMTLIPNFIPRGCYKEIRKFQICSSKKGADHCINDKINVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNRNRSVSDLQLKTWEYGKGGKLRSDSVW*
Ga0078894_1090008813300005662Freshwater LakeVIHSDIYKALNPIRARYDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENTMKFSKYMTLIPNFIPRGCYKEIRKFQICASKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAETIDNQTYKRAMSVSDYNKGRSVTDLKLKTWEHGKGGQLRSDTVWQDDRYNPTKYSHPHRYDNVNFP
Ga0079957_119488733300005805LakePHYNLGNKIVHSDVYKKLNPIRARYDFTPNDYTQMPIFLGVVPQFFWTYGNLDYSFNKHHRLYQSHDDWYPDRKGKTLGAKNGSFNSPLLKDSKYMTLKPNFIPRGCTKEIRKYQICAHEKGAEACFADKISIMEVCPDHVLEALREKKKWYMRAELIDNDTYKRAMIVSDFNKHRSVSDL*
Ga0066798_1011480813300005980SoilMNPIRARYDYQPNEYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKTSKFMTLRPNFIPRGCYKEIRKYQMCAAKNSTEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWDHGKTANMRSDSMWQDDRYNPIEYSH
Ga0075154_1008618323300005989Wastewater EffluentLNPIRARYDYKPNEYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRYYQAHDDWYPDRKAKTLGHKNGGFCEPIGKQSKYMTLTPNFIPRGCYKEIRKYQLCSSKNGKEACLNDKLSIMEVCPEHILEGLKEKKKWHLRAEVIDNDTYKRAMQVSDYNKGKSVTDLKLKTWEHGKAGYLRSDTYWQDDRYDPVKYPHNHRYDSVNFPDQEYRDIFGGTMGQYEQKE*
Ga0007876_108984813300006071FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTRYSHPHRYDNTNFKDQ
Ga0007862_108700713300006108FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQT
Ga0007807_108075513300006116FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVS
Ga0075501_127197713300006355AqueousNMSAINFYSSTTPEYFWQKTHYNWGNYVIHSDIYKKINPIRARYEYTPNDYSQMPFYLGSIPQLNWLYGNLDYSFNKYHKHYQAHDDWVPDRKARTLGTKQGGYCNPNMKNSKFMTLIPNMIPKGCYREIRKFQACSAASGKDNCLGQKLSIMEVCPDHILEGLREKKKWYARAEVIDNETYRRAMQVSDFNRNRSVSDLQLKTWDYGNSLRSDSFYQDDKYNPTKFSHPHRNDNVNFP
Ga0075501_136128523300006355AqueousTTINFYSSNLPEYFWQKPHYNLGNKIVHSDVYKKLNPIRARYDFTPNDYTQMPIFLGVVPQFFWTYGNLDYSFNKHHRLYQSHDDWYPDRKGKTLGAKNGSFNSPLLKDSKYMTLKPNFIPRGCTKEIRKYQICAHEKGAEACFADKISIMEVCPDHVLEALREKKKWYMRAELIDNDTYKRAMVVSDFNKHRSVSDL*
Ga0075498_119426223300006378AqueousTINFYSSNLPEYFWQKPHYNLGNKIVHSDVYKKLNPIRARYDFTPNDYTQMPIFLGVVPQFFWTYGNLDYSFNKHHRLYQSHDDWYPDRKGKTLGAKNGSFNSPLLKDSKYMTLKPNFIPRGCTKEIRKYQICAHEKGAEACFADKISIMEVCPDHVLEALREKKKWYMRAELIDNDTYKRAMVVSDFNKHRSVSDL*
Ga0075492_150442413300006394AqueousEYFWHQGKPHYNWGNKFVHSDLYKSLNPLRQRYDYSPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNMIPRGCYREIRKYQACAATGNKEQCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVSDLSIKDWSFGHSRNLRSDSTW*
Ga0075493_150530713300006396AqueousNMPEYYWQKTHYNWGNSVIHSDIYKKINPIRARYEYTPNEYSQMPFYLGSVPQFNWLYGSLDYSFQKYHKQYQAHDDWVPDRKAKTLGTRQGGHCNPIMKNSKFMTLVPNQIPRGCYREIRKFQACTSANGAAEVCEGQKLSIMEVCPDHILEGLREKKKWFARAEVIDNETYRRAMQVSDYNRGR
Ga0075488_162795213300006397AqueousLNGFYSSNNPGYFHHSGKPHYNWGNKMIHSDLYKKLNPIRQRYDYTPGEYTQMPFYFGHIPQLSWVYGNLDYSFNKYHRHIQAHDDWYPDRKNKSLGHKNGGQCNPNMKQSKFMALQPQYIPRGCYREIRKYQACSASNGRQNCMNEKISIMEVCPDHVLEGLRERRKWSLRAESIDNETYKRAMTVGDYNKGRSVSDLTIKDWSYGSARNLRSESTW*
Ga0099654_1028484323300006415LakeNFYSSNFPEYYWQKPHYDLANKVVHSDLYKKLNPIRARYDYKPNDYTQMPWFLGKLPQFDWLYGNLDYSFNKYHRHYQVHDDWYPDRKGKTLGHKNGSFCSPTMKNSKYMTLRPNFMPRGCYKEVRSYQMCVAKSSAEACFSEKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKSRSVSDLKLKTWDYGKTANLRSDSIWQDDRYDPTKFSHPHRYDNVNFPE*
Ga0075496_140975213300006419AqueousEYFWHQGKPHYNWGNKFVHSDLYKSLNPLRQRYDYSPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNMIPRGCYREIRKYQACAATGNKEQCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVSDLSIK
Ga0075497_141625323300006424AqueousFYTASAPEYFWHQGKPHYNWGNKFVHSDLYKSLNPLRQRYDYSPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNMIPRGCYREIRKYQACAATGNKEQCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVSDLSIKDWSFGHSRNLRSDSTW*
Ga0075471_1015743823300006641AqueousMTTINFYSSNLPEYFWQKPHYNLGNKIVHSDVYKKLNPIRARYDFTPNDYTQMPIFLGVVPQFFWTYGNLDYSFNKHHRLYQSHDDWYPDRKGKTLGAKNGSFNSPLLKDSKYMTLKPNFIPRGCTKEIRKYQICAHEKGAEACFADKISIMEVCPDHVLEALREKKKWYMRAELIDNDTYKRAMVVSDFNKHRSVSDL*
Ga0075467_1022424523300006803AqueousMSAINFYTASAPEYFWHQGKPHYNWGNKFVHSDLYKSLNPLRQRYDYSPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNMIPRGCYREIRKYQACAATGNKEQCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVSDLSIKDWSFGHSRNLRSDSTW*
Ga0075467_1052312113300006803AqueousMTAINFYSSNFPEYFWQKPHYNLGNKIVTSDLYKKLNPIRARYDFNGNDYTQMPIFLGVVPQFFWLYGNLDYSFNKYHRHYQTHDEWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFADKISIMEVCPDHVLEALREKKKWYLRAEMIDN
Ga0102691_155389413300007319Freshwater LakeINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0102690_175291813300007534Freshwater LakeAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYFGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRA
Ga0102820_110384513300007554EstuarineMSAINFYTASAPEYFWHGGRPHYQWGNQFVHSALYKKLNPLRQVYEYQPGEYTQMPFYFGHIPQLSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNYIPKGCYREIRKYQACSQASGKDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDYNKGKS
Ga0102828_101888813300007559EstuarineMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSFW*
Ga0102914_116631613300007561EstuarineMTAINFYSSNFPEYFWQKGHYNLGNKLVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYN*
Ga0105749_107601513300007864Estuary WaterMTAINFYSSNFPEYFWQKPHYNLGNKIVTSDLYKKLNPVRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFKKWHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLKPNFIPRGCVKEIRTYQMCKAKTGSEDACFSEKISIMEVCPDHVLEALREKKKWYLRAEMIDNDPYKRAMSVSDF
Ga0105738_101740513300007953Estuary WaterMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKINPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDYGKTANLRSDSFW*
Ga0105745_112920613300007972Estuary WaterVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHKHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDARYNPIEYSHPH
Ga0114344_114330013300008111Freshwater, PlanktonYNLGNKIIHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0114344_115389713300008111Freshwater, PlanktonMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGNCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCASKKGTDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDYNKGKSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPTKFSHPHRNDNTNFP
Ga0114346_116274713300008113Freshwater, PlanktonMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0114346_128702013300008113Freshwater, PlanktonYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTQYSHPHRYDNTN
Ga0102829_107010113300009026EstuarineLYKKLNPLRANYDYVPGEYSQMAFYFGHIPQLSWLWGNLDYTFNKNHRHIQAHDDWYPDRKNKTLFLKNGGQCNLNMKQSKFMTLKPSEIPKGCYREIRKYQSCAADKGTGNCSNEKISIMEVCPDHVLEGLRERRKWFMRAEAIDNATYKRAMSVSDYNKNRSVSDLELKDWSFGHPRNLRSDSVW*
Ga0114973_1038240513300009068Freshwater LakeMWQKWHYNLGNSIVHSDLYKALNPIRTRYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQICSSKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNKGRSVSDLQLKTWEHGKGGKLRS
Ga0102885_107512713300009142EstuarineMSTINFYSSTLPEYYWQKPHYNWGNAVIHSDIYKKINPIRARYDYNPNDYTQMPWYLGSVPQFNWLYGSLDYSFQKYHKHYQAHDDWVPDRKARTLGTRQGGACQQVMKNSKYMTLVQSMIPRGCYRQIRNFKTCTTANPGEACMDQKLSIMEVCPDHVLEALKEKKKWFARAETIDNETYRRAMQVSDFNRGRSVSDLKLKSWTYGHTLRSDSWYQDDRWDPTKFSHAHRNDNVNF
Ga0114980_1013086213300009152Freshwater LakeMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDWGKTANLRSDSFW*
Ga0114980_1051905113300009152Freshwater LakeMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCFKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEH
Ga0114968_1024361613300009155Freshwater LakeMTAINFYSSNFPEYYWQKGHYNLGNKIIHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW*
Ga0105097_1029594023300009169Freshwater SedimentMTAINFYSSNFPEYYWQKGHYNLGNKIIHSDLYKALNPIRARFDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKHHRHYQAHDDWYPDRKGKTLGHKNGGFCDNTMKFTKYMTLIPSFIPRGCYKEIRKFQICANKRGAETCLNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKSRSVTDL*
Ga0115008_1030863323300009436MarineMSVTNFYHSNTPEYFWHQGKPHYNLGNSIVHSNFMKKFNPIRARYSYEPGEYAQMAFYFGHVPQLSWLYGNLDYSFNKYHRYYQAHDDWYPDRKNKTLGNKNGGFCNMNMKQSKFMTLQPSEIPRGCYREIRKYQSCASKSGAEQCVNEKISIMEVCPDHVLEGLRERRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVADVEMKDWSFGTAKNLRSDSTW*
Ga0130030_103630413300009563Meromictic PondMITTNFYSSNLPEYYWQKPHYNLGNRIIHSDLYKRLNPVRARYEATVNDYTQMPIYLGLYPQLSWVYGNLDYSLKKHHRHYQVHDDWYPDRKGKTLGAKNGGFNSPIMKESKYMTLRPNFIPRGCFREIRKYQLCAAEKNADACFADKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKRAMTVSDFNAHRSVADLQLKTWDYGKTQNLRSDSLYQDDRYNPTKYSHPH
Ga0115103_128235223300009599MarineFNFYSSALPEYYWHQGKPHYNWGNKFVHSDLYKKLNPLRQNYDVVHGEYTQMPFYFGHIPQTSWVYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSQTNPNMKQSKYMTLQPNYIPKGCFREIQKYQACSSASGKEACFNEKISIMEVCPDHVLEGLREKRKWMMRAEAIDNQTYKRAMTVSDYNLGRSVSELNIKSWDYGHPKNLRSESTW*
Ga0115103_180917413300009599MarineMFSNFYSSNTSEYFWHTGKPHYNFGNKIVHSDLYKKINPLRQVYDYQPGQYTQMPMFFGHVPQLSWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKSGGFCNPTMKQTKFMALQPNFMPRGCYREIRKYNSCATDQGKDACLNEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMKVSDYNKGRSVADLECKDWSYGHPKSLRSQSTW*
Ga0115102_1089070613300009606MarineNFYHSNTPEYFWHQGKPHYNLGNSIVHSNFMKKFNPVRARYSYEPGEYAQMAFYFGHVPQLSWLYGNLDYSFNKYHRYYQAHDDWYPDRKNKTLGNKNGGFCNMNMKQSKFMTLQPSEIPRGCYREIRKYQACASQSGADQCNNEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMTVGDYNRGRSVSDVNMKDWSFGTTQNLRSDSTW*
Ga0136551_107985013300010388Pond Fresh WaterNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLKTWDWGKTANLRSDGLWQDDRWDPTAYSHPHRYDN
Ga0136551_109006313300010388Pond Fresh WaterMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDIYKSLNPIRARYDYAPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCASKKNAELCVNDKLSVMEVCPDHVLEGLQEKKK
Ga0133913_1257497123300010885Freshwater LakeMTAINFYSSNFPEYFWQKGHYNLGNKIIHSDLYKALNPIRSRYDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTQYSHPHRYDNTNFKD*
Ga0136599_101857213300012030Saline LakeMSWTNFYHSNSPEYFWHQGKPHYNLGNAIVHSDLMKKINPVRARYHYEPGEYTQMAFYFGHIPQLSWIYGNLDYSFNKYHRYYQAHDDWYPDRKNKTLGNKNGGFCNLNMKQSKFMTLQPSTIPRGCYREIRKYQACAAGGAQCNDEKISIMEVCPDHVLEGLREKRKWFLRAEAIDN*
Ga0129334_109589913300012471AqueousSFYHGALPEYYWHQGKPHYNLGNKIVHSSIAKMNPLRATYHFDPNELTQMPFYFSQVPQLSWLWGNLDFSMNKYHRHYQAHDDWYPDRKNKSLGHKQGGHCNLNGKTSKYMTLQPQTIPRGCFREIRKFQSCASQNGAAECHSEKISIMEVCPQHVLEGLREKRKWYLRA
Ga0129349_102903113300012518AqueousPHYNLGNRIITNETYKSLNPIRARYDYAPNEYTQMPFYLGVVPQFWWLYGNLDYSMDKYHKHYQAHDDWVPDRKNKTLGAKQGGFNSPVMKNSKYMQLIASKIPRGCFREIRKYQSCAKEAGSDKCVAQKVSIMEVCPDHVLEGLRERKKWLLRAEVIDNETYRRAMEVSDFNRGRSVSDLKLKTWEY
Ga0129353_160857213300012525AqueousNFYSSNLPEYYWQKPHYNLGNRIIHSDLYKRLNPVRARYEATVNDYTQMPIYLGLYPQLSWVYGNLDYSLKKHHRHYQVHDDWYPDRKGKTLGAKNGGFNSPIMKESKYMTLRPNFIPRGCFREIRKYQLCAAEKNADACFADKISIMEVCPDHVLEGLREKKKWYMRAEMIDNDTYKR
Ga0157575_12221613300012690FreshwaterEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQ
Ga0157571_108145613300012692FreshwaterFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSE
Ga0157573_109194213300012693FreshwaterVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEH
Ga0157579_110984413300012696FreshwaterINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEHG
Ga0157593_109451613300012699FreshwaterNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTRYSHPHRYDNTNFKDQEYKDIFGGTIGTAE
Ga0157572_115348413300012703FreshwaterAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEHGK
Ga0157574_117497013300012704FreshwaterTAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEHGKQLRSD
Ga0157627_109505613300012706FreshwaterAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLW*
Ga0157601_118932013300012714FreshwaterNMTAINFYSSNFPEYYWQKGHYNLGDKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNF
Ga0157609_101976313300012717FreshwaterFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRDD
Ga0157613_125821813300012720FreshwaterNFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKG
Ga0157612_100469013300012721FreshwaterSSNFPEYYWQKGHYNLGNKIVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCANKKGADHCFNDKIAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVSDLKLKTWEYGKGGQLRSDTVW*
Ga0157630_112991313300012722FreshwaterAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLR
Ga0157625_117533513300012729FreshwaterFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE*
Ga0157602_106323513300012730FreshwaterAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQD
Ga0157615_106494113300012734FreshwaterAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSL
Ga0157615_137698413300012734FreshwaterWQKGHYNLGNKIVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLYANKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYK
Ga0157626_114623413300012759FreshwaterSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPH
Ga0163179_1037093913300012953SeawaterMPVFNFYSSNFPEYYWQKPHYNWGNYIIHSDIYKKINPIRARYDYKPNDYSQMPFYLGVVPQFWWLYGNLDYSLNKYHKHYQAHDDWLPDRKNKTLGAKQGGMNQPIMKNSKYMTLIPNNMPKGCYREVRKYQECAATIGKEVEQCVRQKISIMEVCPDHVLEGLREKKKHMLRAEVIDNETYRRAMQVSDFNRGRSVSDLKLKTWEYGCGNNLRSDSIY*
Ga0163179_1089423113300012953SeawaterVHSDIYKTLNPIRARYDYAPNEYSQMPFFLGVVPQFYWCYGNLDYSFNKYHRHYQAHDDWYPDTKNKTLGHKANGSMTQPNMKNSKYMTLVPNFMPRGCYKEVRKYQMCAGKGDKDACLAEKISIMEVCPDHVLEGLREKKKWYLRAESIDNETYKRAMTVGDYNRGRSVSDLKMKTWEHGKTLRTDSTWEDDRYNPTVYKHPHRNDGQN
Ga0163111_1157175913300012954Surface SeawaterMVWNFYHSANTEYFTHELKPHYNFGNKLMHSDLYKKLNPLRQNYDYQPNGEMQQLPFYFGHIPQLSWVYGNLDYAFNKYHRHYQDHDDWYPDRKAKTLGHKNGSHVNPNMKQSKFMTLQAQTIPRGCYREIRKYQACAGDKGKNACTNEKISIMEVCPDHVLEGLREKRKWYLRAQAIDNETYKRAMTVSAYNAGRSVSDLTV
Ga0157620_114057313300012959FreshwaterIFINMTAINFYSSNFREYYWQKGHYTLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFN
Ga0129335_116998613300012962AqueousSFYHGALPEYYWHQGKPHYNLGNKIVHSSIAKMNPLRATYHFDPNELTQMPFYFSQVPQLSWLWGNLDFSMNKYHRHYQAHDDWYPDRKNKSLGHKQGGHCNLNGKTSKYMTLQPQTIPRGCFREIRKFQSCASQNGAAECHSEKISIMEVCPQHVLEGLREKRKWYLRAEAIDNQTYKRAMKVSDYNRGRSVSDLDIKDWSFGAVGNLRSDSTW*
Ga0129341_114914813300012966AqueousYTSAAPEYFWHGGRPHYQWGNQFVHSDLYKKLNPLRQVYEYQPGQYQQMPFYFGHIPQLSWVYGNLDYSLNKYHRHYQAHDDWYPDRKGKTLGHKNGGMCNPNMKQSKFMTLQPNYIPKGCYREIRKYQACASASGADSCFNEKISIMEVCPDHVLEGLREKRKWYLRAEAIDNQTYKRAMTVSDYNKGRSVGDLDVKDWSYGHPRNLRTDT
Ga0129337_101812613300012968AqueousFYHGALPEYYWHQGKPHYNLGNKIVHSSIAKMNPLRATYHFDPNELTQMPFYFSQVPQLSWLWGNLDFSMNKYHRHYQAHDDWYPDRKNKSLGHKQGGHCNLNGKTSKYMTLQPQTIPRGCFREIRKFQSCASQNGAAECHSEKISIMEVCPQHVLEGLREKRKWYLRAEAIDNQTYKRAMKVSDYNRGRSVSDLDIKDWSFGAVGNL
Ga0129338_142466413300012970AqueousMTSFYHGALPEYYWHQGKPHYNLGNKIVHSSIAKMNPLRATYHFDPNELTQMPFYFSQVPQLSWLWGNLDFSMNKYHRHYQAHDDWYPDRKNKSLGHKQGGHCNLNGKTSKYMTLQPQTIPRGCFREIRKFQSCASQNGAAECHSEKISIMEVCPQHVLEGLREKRKWYLRAEAIDNQTYKRAMKVSDYNRGRSVSDLDIKDWSFGAVGNLRSDSTW*
Ga0164292_1031273213300013005FreshwaterMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCANKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVSDLKLKTWEYGKGGQLRSDTVW*
Ga0170791_1240464513300013295FreshwaterTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDWGKTANLRSDSFW*
Ga0157622_104418913300013310FreshwaterAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQICASKRGADTCINDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDFNKGKSVSDLTLKTWEYGKGGNLRSDSLWQDD
Ga0182014_1049963113300014491BogMTAINFYSSNMPEYFWQKGHYNLGNRVVHSDLYKALNPLRSRFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCSSKRGADHCLNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQ
Ga0180039_112015113300016688FreshwaterFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSVSDLTLKTWEHGKQ
Ga0182088_126210513300016703Salt MarshFNFYSSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSW
Ga0182085_129926813300016723Salt MarshSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVS
Ga0182051_117928013300016727Salt MarshPEYFWQKGHYNLGNSVIHSDLYKKLNPIRARYDYTPNDYSQMPFFLGVVPQFYWLYGNLDYSFNKYHRHYQAHDDWYPDRKSKTLGHKNGSMCQPNMKNSKYMTLIPNFIPRGCYKEIRKYQICAAKDGAESCFQDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRA
Ga0182051_119598913300016727Salt MarshNFYSSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0182094_107462023300016731Salt MarshVLSVLRTFVFQPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0182096_107670923300016740Salt MarshIFNFYSSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0182079_148992213300016741Salt MarshSAAPEYFWHQGKPHYNWGNKIVHSDLYKKLNPLRQNYDYVPGEYTQMPFYFGHIPQLSWIYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGMCNPNMKNSKFMTLQPNMIPRGCYREIRKYQSCAANNGKDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSDFNKGRSVADLECKDWSFGHPRNLRSDSAW
Ga0182055_138412113300016746Salt MarshPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSD
Ga0182043_149255613300016748Salt MarshFYSSNFPEYFWQKPHYNLGNKIVTSDLYKKLNPIRARYDFNGNDYTQMPIFLGVVPQFFWLYGNLDYSFNKYHRHYQTHDEWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNYIPKGCYREIRKYQACSSASGQDACFNEKISIMEVCPDHVLEGLREKRKWFL
Ga0169931_1020990013300017788FreshwaterMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCSSKKGADHCLNDKLNVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVSDL
Ga0181577_1029541513300017951Salt MarshMIFNFYSSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0181582_1082058213300017958Salt MarshSAAPEYFWHQGKPHYNWGNKIVHSDLYKKLNPLRQNYDYVPGEYTQMPFYFGHIPQLSWIYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKMSKFMTLQPSMIPRGCYREIRKYQACASAQGNDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVSD
Ga0193219_101941223300018842MarineFNSYGSVTTEYFHHEGKPHYNLGNALIHSNLYKKLNPVRMRYEAKAGEYTQAPFYFGFVPQETWVYGNLDYSFNKYHRHIQAHDDWHPDRKGKTLGDKSGGAQSPNMQHSKYLTLQSQKIPRGCFREIRKYQACTAEQNKEACLNEKISIMEVCPDHVLEGLREKRKWYLRAQAIDNQTYKRAMKVSDYNKGRSVSDLTIRDWSYGTPDNLRTENTW
Ga0192961_1007332123300018980MarineMTAVNFYSSNLPEYYWQKPHYNLGNQVVHSDLYKKLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHYQAHDDWYPDRKGKTLGHKNGGFCSPTMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDNSSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVTDLKLKTWDYGKTANLKSDSLW
Ga0192947_1009529423300018982MarineTWEFINSLIKMSLNGFYSSNNPGYFHHSGKPHYNWGNKFVHSDLYKKLNPIRQRYDYQPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHIQAHDDWYPDRKNKSLGFKNGGQCNPNMKQSKFMALQPNFVPRGCYREIRKYQACSAANGRTNCMNEKISIMEVCPDHVLEGLRERRKWTLRAESIDNETYKRAMTVGDYNKGKSVSDLHIKDWSHGSSANLRGENTW
Ga0193569_1032150813300019017MarineRQAVGTQQQQQMSAINFYSSNTPEYYWQKTHYNWGNAVVHSEIYKKMNPIRARYDYKPNEYTQMPWYLGSVPQFNWLYGSLDYSFQKYHKHYQAHDDWVPDRKARTLGTRQGGACSPIMKNSKFMTLVPNQIPRGCFREIRKFQACQSAGKDAQVCQAQKMNIMEVCPDHILELLREKKKWFARAEVIDNETYRRAMQVSDYNRGRSVSD
Ga0182097_143142113300019261Salt MarshFYSSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0182066_118233813300019262Salt MarshYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSW
Ga0182073_140271913300019274Salt MarshLFNFYASSVPEYFEHEGKPHYNLGNKLIHSDFYKKINPLRQRYEAQAGEYSQMPFYFGHIPQLTWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKSGGFCSPNMKHSNFLVLQPSKIPRGCYREIRKYQACTAEKNKDACFNEKISIMEVCPDHILEGLREKRKWYLRAQAIDNQTYKRAMRVSDYNRGRSVSDVEMKDWSYGMP
Ga0182067_116487323300019276Salt MarshFNFYSSAVPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0182086_108357513300020013Salt MarshMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNL
Ga0194050_112224413300020155Anoxic Zone FreshwaterMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDWGKTANLRSDSF
Ga0194049_104095613300020157Anoxic Zone FreshwaterMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDWGKTANLRSDSFW
Ga0194116_1036067013300020204Freshwater LakeMTAINFYSSNFPEYFWQKGHYNLGNSIVHSDLYKALNPIRSRYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNQGRSVSDLTLKTWEHGKQLRSDSVWQDD
Ga0214200_103932113300020725FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKIIHSDLYKALNPIRSRYDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCSSRRGADNCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLTLKTWEHGKGGNLRSDTVW
Ga0210350_113819213300021308EstuarineAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKTLNPIRARFDYKPNDYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCESVMKSSKYMTLIPNFIPRGCYKEIRKYQMCAASKDQEACLNDKISIMEVCPDHVLDGLKEKKKWYLRAEVIDNQTYRRAMQVGNYNK
Ga0213859_1043829513300021364SeawaterMLNFYSSIQPEYYWQKPHYNLGNKMITSDLYKKVNPIRARYDYHPGDYTQMPFFLGVVPQFWWLYGNLDYNMDKYHKQYQAHDDWLPDRKAKTLGAKQGGFNSPIMKNSKYMTINYNQIPRGCFREIRKYQACTKQTGDKDRCLDQKISIMEVCPDHILEGLREKKKWL
Ga0206123_1026058513300021365SeawaterMSLNGFYSSNNPGYFHHSGKPHYNWGNKFVHSDLYKKLNPIRQRYDYQPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHIQAHDDWYPDRKNKSLGHKNGGQCNPNMKQSKFMALQPNYIPRGCYREIRKYQACSAANGRQACMNEKISIMEVCPDHVLEGLRERRKWNLRAEAIDNETYKRAMTVGSYNQGKSVSDLKIKDWS
Ga0063090_107543913300021890MarineLYKSLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHYQAHDDWYPDRKGKTLGHKNGGFCSPTMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKR
Ga0063106_106786713300021911MarineLYKQLNPVRQRYDYKPNEYTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHYQAHDDWYPDRKGKTLGHKNGGFCSPTMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDASNKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSSFNKERSVNDLQLKTWDYGKTANLRSDSLW
Ga0222713_1025953333300021962Estuarine WaterMTSFYHGALPEYYWHQGKPHYNLGNKIVHSSIAKMNPLRATYHFDPNELTQMPFYFSQVPQLSWLWGNLDFSMNKYHRHYQAHDDWYPDRKNKSLGHKQGGHCNLNGKTSKYMTLQPQTIPRGCFREIRKFQSCASQNGAAECHSEKISIMEVCPQHVLEGLREKRKWYLRAEAIDNQTYKRAMKVSDYNRGRSVSDLDIKDWSFGAVGNLRSDSTW
Ga0222713_1028964213300021962Estuarine WaterMAFNFYHSAAPEYFWHQGKPHYNWGNKIVHSDLYKKLNPLRQNYDYVPGEYTQMPFYFGHIPQLSWIYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGMCNPNMKNSKFMTLQPNMIPRGCYREIRKYQSCAANNGKDACFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDFNKGRSVADLECKDWSFGHPRNLRSDSAW
Ga0222719_1060093313300021964Estuarine WaterMAFNFYHSAAPEYFWHQGKPHYNWGNKIVHSDLYKKLNPLRQNYDYVPGEYTQMPFYFGHIPQLSWIYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGMCNPNMKNSKFMTLQPNMIPRGCYREIRKYQSCAANNGKDSCFNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMSVSDFNKG
Ga0213932_106554013300022166FreshwaterNFYSSNFPEYFWQKGHYNLGNKVIHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQICASKRGADHCLNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKR
Ga0232123_106121213300023706Salt MarshPEYYWHQGKPHYNWGNKLVHSDLYKKMNPLRQNYDYVPGQYTQMPFYFGHIPQLSWVYGNLDYSFNKHHRHYQAHDDWYPDRKNKTLGHKNGSQCNPNMKNSKFMTLQPNEIPKGCFREIQKYQACSASNGKDACFNDKISIMEVCPDHILEGLREKRKWMLRAEAIDNQTYKRAMTVSDYNKGRSVSDLNVKSWEYGHPKNLRSDSTW
Ga0208744_108739213300025450FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAE
Ga0208660_107712313300025570AqueousMSAINFYTASAPEYFWHQGKPHYNWGNKFVHSDLYKSLNPLRQRYDYSPGEYTQMPFFFGHIPQLSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCNPNMKNSKFMTLQPNMIPRGCYREIRKYQACAATGNKEQCMNEKISIMEVCPDHVLEGLREKRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVSDLSIKDWSFGHSRNLRSDSTW
Ga0208784_107069423300025732AqueousMTTINFYSSNLPEYFWQKPHYNLGNKIVHSDVYKKLNPIRARYDFTPNDYTQMPIFLGVVPQFFWTYGNLDYSFNKHHRLYQSHDDWYPDRKGKTLGAKNGSFNSPLLKDSKYMTLKPNFIPRGCTKEIRKYQICAHEKGAEACFADKISIMEVCPDHVLEALREKKKWYMRAELIDNDTYKRAMVVSDFNKHRSVSDL
Ga0208498_104288713300025785FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKVVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSEYNQGRSV
Ga0208544_1021762013300025887AqueousMSTQNFYSSIAPEYFYQKPHYDLGNRIIHSNLYKKLNPIRARYDYCPNDYSQMPFYLGSVPQFHWLYGSLDYSFQKYHKHYQAHDDWVPDRKGRTLGTRQGGHCNPIMKNSKYMTLVHSHIPRGCYREIRKFQACNSEKGSSEACMAQKMSIMEVCPDHVLEGLREKKKWIARAETIDNETYRRAMQVSDYNRARSVSDLKLKTWAHGYTLRSDSLYEDDRYDPTKFSHAHR
Ga0247571_114034113300026495SeawaterNFYHSANTEYFTHELKPHYNFGNKLMHSDLYKKLNPLRQNYDYQPNGEMQQLPFYFGHIPQLSWVYGNLDYAFNKYHRHYQDHDDWYPDRKAKTLGHKNGSHVNPNMKQSKFMTLQAQTVPRGCYREIRKYQACSADKGKTACTNEKISFMEVCPDHVLEGLREKRKWYLRAQAIDNETYKRAMTVSG
Ga0208930_104210313300027237EstuarineMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDT
Ga0208177_108340913300027254EstuarineMTAINFYSSNFPEYFWQKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMID
Ga0208932_107701813300027256EstuarineMTAINFYSSNFPEYFWQKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEM
Ga0208178_106600613300027259EstuarineMTAINFYSSNFPEYFWQKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNRNRSVSDLKLK
Ga0209617_1010486913300027720Freshwater And SedimentMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW
Ga0209596_116381213300027754Freshwater LakeMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFNKGRSVSHLKLKTWDWGKTANLRSVP
Ga0209598_1010629313300027760Freshwater LakePNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFPE
Ga0209598_1030598513300027760Freshwater LakeMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQ
Ga0209812_1010216013300027786Wastewater EffluentLNPIRARYDYKPNEYSQMPYFLGHVPQFSWVYGNLDYSFNKYHRYYQAHDDWYPDRKAKTLGHKNGGFCEPIGKQSKYMTLTPNFIPRGCYKEIRKYQLCSSKNGKEACLNDKLSIMEVCPEHILEGLKEKKKWHLRAEVIDNDTYKRAMQVSDYNKGKSVTDLKLKTWEHGKAGYLRSDTYWQDDRYDPVKYPHNHRYDSVNFPDQEYRDIFGGTMGQYEQKE
Ga0209972_1029535113300027793Freshwater LakeMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKG
Ga0209107_1037010213300027797Freshwater And SedimentMTTINFYSSNFPEYYWQKTHYNWGNSVIHSDLYKKLNPIRARYDYKPNDYTQMPFYLGVVPQFFWLYGNLDYSFNKYHRHYQHHDDWYPDRKNKTLGHKNGGQCSPIMKESKYMTLRPNYIPRGCYKEIRKYQMCAAKSSAENCFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDFN
Ga0209229_1040007313300027805Freshwater And SedimentMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWLPDRKGKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCSSKKGADHCLNDKINVMEVCPDHVLEGLQEKKKWYLRAEVI
Ga0209092_1020054723300027833MarineMSVTNFYHSNTPEYFWHQGKPHYNLGNSIVHSNFMKKFNPIRARYSYEPGEYAQMAFYFGHVPQLSWLYGNLDYSFNKYHRYYQAHDDWYPDRKNKTLGNKNGGFCNMNMKQSKFMTLQPSEIPRGCYREIRKYQSCASKSGAEQCVNEKISIMEVCPDHVLEGLRERRKWFLRAEAIDNQTYKRAMTVGDYNKGRSVADVEMKDWSFGTAKNLRSDSTW
Ga0209401_113375013300027971Freshwater LakeMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTNFP
Ga0209298_1036655913300027973Freshwater LakeMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWY
Ga0209702_1023616813300027976FreshwaterMIHSDLYKKLNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWQPDRKAKTLGHKNGGFCENSMKFSKYMTLIPNYIPRGCYKEIRKFQLCSTKRGAEHCLNDKLSVMEVCPDHVLEGLQEKKKWFLRAEVIDNQTYKRGMTVSDFNHGRSVSDLKLKTWAHGKELRSDSVWEDDRYNPTK
Ga0306910_102237613300028412Saline LakeMSWTNFYHSNSPEYFWHQGKPHYNLGNAIVHSDLMKKINPVRARYHYEPGEYTQMAFYFGHIPQLSWIYGNLDYSFNKYHRYYQAHDDWYPDRKNKTLGNKNGGFCNLNMKQSKFMTLQPSTIPRGCYREIRKYQACAAGGAQCNDEKISIMEVCPDHVLEGLREKRKWFLRAEAIDN
(restricted) Ga0247832_111276623300028557FreshwaterMTAINFYSSNFPEYYWQKGHYNLGNKIIHSDLYKSLNPIRAHYDYNPNNYSQMPYFLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGNCENSMKSSKYMTLIPNFIPRGCYKEIRKFQLCATKKGADHCLNDKIGVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDFNKGRSVSDLKLKTWEFGKGANLRSDSVW
Ga0311341_1029420623300029908BogLGNRIIHSDLYKALNPLRQRFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKNSKYMTLIPSFIPRGCYKEIRKFQLCATKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLQLKTWEHGKGGRLRSDTVW
Ga0311362_1122965913300029913BogRQRFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKNSKYMTLIPSFIPRGCYKEIRKFQLCATKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLQLKTWEHGKGGRLRSDTVW
Ga0311358_1099103213300029915BogRFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKNSKYMTLIPSFIPRGCYKEIRKFQLCATKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLQLKTWEHGKGGRLRSDTVW
Ga0311342_1112730813300029955BogFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKNSKYMTLIPSFIPRGCYKEIRKFQLCATKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLQLKTWEHGKGGRLRSDTVW
Ga0302140_1058941123300031261BogMTAINFYSSNFPEYFWQKGHYNLGNRIIHSDLYKALNPLRQRFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKNSKYMTLIPSFIPRGCYKEIRKFQLCATKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYNKGRSVTDLQLKTWEHGKGGRLRSDTVW
Ga0307386_1042395513300031710MarineNFYSSNTPEYYWQKPHYNWGNAVVHSELYKKINPIRARYDYCANDYTQMPFYLGVVPQFWWLYGNLDYSLNKYHKHYQAHDDWMPDRKNKTLGAKQGGMNQPNMKNSKYMTLIPNFMPRGCYREVRKYQECAATIGKEFEQCVQQKVAIMEVCPAHVLEALREKKKHMLRAEVIDNETYRRAMQVSDFNRGKSVSDLQLKTWEYGTMKNLRSDTLYQDNRYDPTQFSH
Ga0315907_1093345113300031758FreshwaterMTAINFYSSNFPEYFWQKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVSD
Ga0315907_1128505313300031758FreshwaterINFYSSNFPEYFWQKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKW
Ga0315899_1057225113300031784FreshwaterMTAINFYSSNFPEYFWQKGHYNLGNKLVHSDLYKALNPIRARYDYKPNDYSQMPFFLGHIPQFSWVYGNLDYSFHKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKFSKYMTLIPNFIPRGCYKEIRKFQACAARRNADHCLNEKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMTVSDYNQGRSVSDLTLKTWEHGKQLRSDSVWQDDRYNPTQYSHPHRYDNTNFKD
Ga0302319_1127713713300031788BogMTAINFYSSNFPEYFWQKGHYNLGNRIIHSDLYKALNPLRQRFDYKPNDYSQMPYFLGHIPQFSWVYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGGFCENSMKNSKYMTLIPSFIPRGCYKEIRKFQLCATKRGADHCLNDKLAVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRAMSVSDYN
Ga0314679_1036495613300032492SeawaterNFYHSANTEYFTHELKPHYNFGNKLMHSDLYKKLNPLRQNYDYQPNGEMVQLPFYFGHIPQLSWVYGNLDYAFNKYHRHYQDHDDWYPDRKAKTLGHKNGSHVNPNMKQSKFMTLQAQTVPRGCYREIRKYQACAADKGKTACTNEKISIMEVCPDHVLEGLREKRKWYLRAQAIDNETYKRAMTVSGYNSGRSVGDLTVKDWTAGMPQNLRPDGTWV
Ga0314695_141106113300032724SeawaterYHSANTEYFTHELKPHYNFGNKLMHSDLYKKLNPLRQNYDYQPNGEMVQLPFYFGHIPQLSWVYGNLDYAFNKYHRHYQDHDDWYPDRKAKTLGHKNGSHVNPNMKQSKFMTLQAQTVPRGCYREIRKYQACAADKGKTACTNEKISIMEVCPDHVLEGLREKRKWYLRA
Ga0307390_1058212713300033572MarineDLYKKLNPVRQRYDYKPNESTQMPFYMGVVPQFYWLYGNLDYSFKKWHRHYQAHDDWYPDRKGKTLGHKNGGFCSPTMKNSKYMTLRPNMIPRGCYKEIRNYQKCVDNSSKDACFADKISIMEVCPEHVLEALREKKKWYLRAEMIDNDTYKRAMTVSDFNKERSVTDLKLKTWDYGKTANLKSDSLW
Ga0334989_0376294_53_7363300033984FreshwaterMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEY
Ga0334998_0411986_60_7733300034019FreshwaterMTAINFYSSNFPEYYWQKGHYNLGNKIVHSDLYKSLNPIRARYDYKPNDYSQMPFYLGHVPQTSWVYGNLDYSFNKYHRHYQAHDDWQPDRKAKTLGHKNGGYCENSMKFSKYMTLIPNFIPRGCYKEIRKFQLCAGKRGVDHCVNDKLSVMEVCPDHVLEGLQEKKKWYLRAEVIDNQTYKRGMTVSDFNKGRSVSDLKLKTWEYGKGGNLRSDSLWQDDRYNPVTFSHPHRNDNTN
Ga0335001_0480544_53_6583300034064FreshwaterMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLK
Ga0335001_0531221_3_5723300034064FreshwaterMTAINFYSSNFPEYFWQKPHYNLGNKIVNSNLYKTLNPIRARYDYNGNDYTQMPIYLGVVPQFFWLYGNLDYSFNKYHRHYQAHDDWYPDRKGKTLGHKNGSFCSPTLKQSKYMTLRPNFIPRGCIKEIRSYHLCKAKNGGSEEACFTDKISIMEVCPDHILEGLREKKKWYLRAEMIDNDTYKRAMTVS
Ga0310127_125008_406_10053300034072Fracking WaterMTTINFYSSNLPEYFWQKPHYNLGNKIVHSDVYKKLNPIRARYDFTPNDYTQMPIFLGVVPQFFWTYGNLDYSFNKHHRLYQSHDDWYPDRKGKTLGAKNGSFNSPLLKDSKYMTLKPNFIPRGCTKEIRKYQICAHEKGAEACFADKISIMEVCPDHVLEALREKKKWYMRAELIDNDTYKRAMIVSDFNKHRSVSDL
Ga0335068_0291987_41_7633300034116FreshwaterMTAINFYSSNFPEYYWQKPHYNWGNYVVHSDLYKKINPIRARYDYEPNQYTQMPFYLGVVPQFFWLYGNLDYSFKKYHRHYQAHDDWYPDRKNKTLGHKNGSNCSPIMKSSKFMTLRPNFIPRGCYKEIRKYQMCAAKSSAEACFSDKISIMEVCPDHVLEGLREKKKWYLRAEMIDNDTYKRAMTVSDYNRGRSVNDLQLKTWEHGKTANMRSDSMWQDDRYNPIEYSHPHRNDNVNFP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.