NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034961

Metagenome / Metatranscriptome Family F034961

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034961
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 39 residues
Representative Sequence RFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGGGV
Number of Associated Samples 153
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.14 %
% of genes near scaffold ends (potentially truncated) 87.86 %
% of genes from short scaffolds (< 2000 bps) 89.02 %
Associated GOLD sequencing projects 150
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.832 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.387 % of family members)
Environment Ontology (ENVO) Unclassified
(24.855 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.289 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.62%    β-sheet: 0.00%    Coil/Unstructured: 75.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF00885DMRL_synthase 65.32
PF00925GTP_cyclohydro2 6.36
PF02734Dak2 4.62
PF13684Dak1_2 2.31
PF02618YceG 1.73
PF00677Lum_binding 1.73
PF04828GFA 1.73
PF00926DHBP_synthase 1.73
PF00353HemolysinCabind 1.16
PF00534Glycos_transf_1 0.58
PF13011LZ_Tnp_IS481 0.58
PF01189Methyltr_RsmB-F 0.58
PF05974DUF892 0.58
PF02911Formyl_trans_C 0.58
PF135632_5_RNA_ligase2 0.58
PF00834Ribul_P_3_epim 0.58
PF01872RibD_C 0.58
PF03602Cons_hypoth95 0.58
PF00069Pkinase 0.58
PF01070FMN_dh 0.58
PF10502Peptidase_S26 0.58
PF03780Asp23 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG00546,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)Coenzyme transport and metabolism [H] 65.32
COG0807GTP cyclohydrolase IICoenzyme transport and metabolism [H] 6.36
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.31
COG01083,4-dihydroxy-2-butanone 4-phosphate synthaseCoenzyme transport and metabolism [H] 1.73
COG0307Riboflavin synthase alpha chainCoenzyme transport and metabolism [H] 1.73
COG1559Endolytic transglycosylase MltG, terminates peptidoglycan polymerizationCell wall/membrane/envelope biogenesis [M] 1.73
COG3791Uncharacterized conserved proteinFunction unknown [S] 1.73
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.58
COG014416S rRNA C967 or C1407 C5-methylase, RsmB/RsmF familyTranslation, ribosomal structure and biogenesis [J] 0.58
COG0223Methionyl-tRNA formyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.58
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.58
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 0.58
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.58
COG1302Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) familyFunction unknown [S] 0.58
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.58
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.58
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 0.58
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.58
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.58
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.58
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.83 %
UnclassifiedrootN/A27.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig932988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300000886|AL3A1W_1809617Not Available628Open in IMG/M
3300004156|Ga0062589_102006177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300005168|Ga0066809_10019968All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300005168|Ga0066809_10203723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300005184|Ga0066671_10816179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300005336|Ga0070680_100137751All Organisms → cellular organisms → Bacteria2046Open in IMG/M
3300005345|Ga0070692_10256283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300005356|Ga0070674_102122041All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005467|Ga0070706_100120316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2447Open in IMG/M
3300005530|Ga0070679_102043562Not Available522Open in IMG/M
3300005535|Ga0070684_101627316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300005543|Ga0070672_101027277Not Available731Open in IMG/M
3300005549|Ga0070704_101642110Not Available593Open in IMG/M
3300005555|Ga0066692_10413020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300005560|Ga0066670_10279504All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300005561|Ga0066699_10004509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter6002Open in IMG/M
3300005561|Ga0066699_10646238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300005569|Ga0066705_10656188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300005587|Ga0066654_10636963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300005598|Ga0066706_11420971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300005614|Ga0068856_101765689Not Available631Open in IMG/M
3300005614|Ga0068856_101864720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300005615|Ga0070702_100350827All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300005764|Ga0066903_108334190Not Available530Open in IMG/M
3300006032|Ga0066696_10689510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300006046|Ga0066652_100279697All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300006046|Ga0066652_101961388Not Available523Open in IMG/M
3300006237|Ga0097621_101603294Not Available619Open in IMG/M
3300006794|Ga0066658_10720406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300006797|Ga0066659_10063607All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300006797|Ga0066659_10923014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300006844|Ga0075428_101457382Not Available718Open in IMG/M
3300006847|Ga0075431_100756668Not Available947Open in IMG/M
3300006847|Ga0075431_101793175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300006852|Ga0075433_10242964All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300006852|Ga0075433_10275067All Organisms → cellular organisms → Bacteria1492Open in IMG/M
3300006852|Ga0075433_11968056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300006871|Ga0075434_102198665Not Available555Open in IMG/M
3300006914|Ga0075436_100325214All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300006914|Ga0075436_100938013Not Available648Open in IMG/M
3300006914|Ga0075436_101251250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300007004|Ga0079218_13671293Not Available521Open in IMG/M
3300009012|Ga0066710_102339406Not Available776Open in IMG/M
3300009012|Ga0066710_104616812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300009098|Ga0105245_11335707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300009100|Ga0075418_11284163Not Available794Open in IMG/M
3300009156|Ga0111538_10981583All Organisms → cellular organisms → Bacteria1069Open in IMG/M
3300010037|Ga0126304_11028148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300010039|Ga0126309_10160987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1214Open in IMG/M
3300010039|Ga0126309_10936259Not Available577Open in IMG/M
3300010040|Ga0126308_10790759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300010045|Ga0126311_11314279Not Available601Open in IMG/M
3300010323|Ga0134086_10439385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300010326|Ga0134065_10101407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300010335|Ga0134063_10417859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300010362|Ga0126377_11001238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria902Open in IMG/M
3300010375|Ga0105239_13240874Not Available530Open in IMG/M
3300010396|Ga0134126_12808771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300010877|Ga0126356_10915651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300011412|Ga0137424_1004950All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300011412|Ga0137424_1021335All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300012091|Ga0136625_1118899Not Available917Open in IMG/M
3300012159|Ga0137344_1065161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300012186|Ga0136620_10001139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia12511Open in IMG/M
3300012207|Ga0137381_10439216All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300012207|Ga0137381_11094667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300012211|Ga0137377_10159894All Organisms → cellular organisms → Bacteria2160Open in IMG/M
3300012356|Ga0137371_11163050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300012359|Ga0137385_10798357All Organisms → cellular organisms → Bacteria → Terrabacteria group784Open in IMG/M
3300012680|Ga0136612_10095365All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300012885|Ga0157287_1104112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300012910|Ga0157308_10025119Not Available1374Open in IMG/M
3300012957|Ga0164303_11427673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012958|Ga0164299_11317882Not Available553Open in IMG/M
3300012960|Ga0164301_10095850All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300012961|Ga0164302_11024087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300012986|Ga0164304_10920941Not Available685Open in IMG/M
3300012989|Ga0164305_10268119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1244Open in IMG/M
3300013297|Ga0157378_11268477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300013307|Ga0157372_13154393Not Available526Open in IMG/M
3300013772|Ga0120158_10389588Not Available644Open in IMG/M
3300014052|Ga0120109_1015032All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300014058|Ga0120149_1200831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300014157|Ga0134078_10530166All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300014255|Ga0075320_1023429All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300014965|Ga0120193_10020486Not Available745Open in IMG/M
3300015077|Ga0173483_10178090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300015161|Ga0167623_1012522All Organisms → cellular organisms → Bacteria2451Open in IMG/M
3300015371|Ga0132258_10062114All Organisms → cellular organisms → Bacteria8619Open in IMG/M
3300015374|Ga0132255_100740486Not Available1462Open in IMG/M
3300017947|Ga0187785_10335441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300017997|Ga0184610_1198738Not Available669Open in IMG/M
3300018061|Ga0184619_10271233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium779Open in IMG/M
3300018422|Ga0190265_11650766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300018469|Ga0190270_10092226All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300019878|Ga0193715_1092405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300019881|Ga0193707_1167962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300022756|Ga0222622_11056713Not Available597Open in IMG/M
3300022883|Ga0247786_1060474Not Available778Open in IMG/M
3300023168|Ga0247748_1071270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300025795|Ga0210114_1010020All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300025885|Ga0207653_10022937All Organisms → cellular organisms → Bacteria1986Open in IMG/M
3300025899|Ga0207642_10991815Not Available541Open in IMG/M
3300025913|Ga0207695_10604350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300025914|Ga0207671_10540056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6929Open in IMG/M
3300025916|Ga0207663_10428239All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300025930|Ga0207701_11070169Not Available669Open in IMG/M
3300025935|Ga0207709_10386723All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300025936|Ga0207670_10362572All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300025981|Ga0207640_10817368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300026023|Ga0207677_10855880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300026078|Ga0207702_10918762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300026142|Ga0207698_10631785All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300026300|Ga0209027_1069046All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300026301|Ga0209238_1202387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300026315|Ga0209686_1127776All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300026550|Ga0209474_10738308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300027787|Ga0209074_10535262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300027806|Ga0209985_10141608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1194Open in IMG/M
3300027821|Ga0209811_10003446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5160Open in IMG/M
3300028556|Ga0265337_1108200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria755Open in IMG/M
3300028577|Ga0265318_10326273Not Available560Open in IMG/M
3300028587|Ga0247828_10331971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium851Open in IMG/M
3300028708|Ga0307295_10077180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria881Open in IMG/M
3300028711|Ga0307293_10044678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1367Open in IMG/M
3300028713|Ga0307303_10160271Not Available544Open in IMG/M
3300028717|Ga0307298_10064420All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300028717|Ga0307298_10211720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300028719|Ga0307301_10009109All Organisms → cellular organisms → Bacteria2796Open in IMG/M
3300028720|Ga0307317_10000941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia8752Open in IMG/M
3300028720|Ga0307317_10114742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300028755|Ga0307316_10309127Not Available579Open in IMG/M
3300028791|Ga0307290_10007220All Organisms → cellular organisms → Bacteria3687Open in IMG/M
3300028793|Ga0307299_10137247Not Available919Open in IMG/M
3300028799|Ga0307284_10326148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300028799|Ga0307284_10476670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300028809|Ga0247824_10400381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300028810|Ga0307294_10329185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300028814|Ga0307302_10033692All Organisms → cellular organisms → Bacteria2360Open in IMG/M
3300028828|Ga0307312_10559034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria756Open in IMG/M
3300028876|Ga0307286_10177290All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300028876|Ga0307286_10206174Not Available714Open in IMG/M
3300028880|Ga0307300_10123132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300028880|Ga0307300_10288391Not Available553Open in IMG/M
3300028881|Ga0307277_10285038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300028881|Ga0307277_10532742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300028889|Ga0247827_10319676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300030114|Ga0311333_11484212Not Available584Open in IMG/M
3300030336|Ga0247826_10522403All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300031226|Ga0307497_10028105All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300031562|Ga0310886_10729327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300031748|Ga0318492_10750416Not Available524Open in IMG/M
3300031771|Ga0318546_10191756All Organisms → cellular organisms → Bacteria1393Open in IMG/M
3300031819|Ga0318568_10158342Not Available1387Open in IMG/M
3300031963|Ga0315901_10902661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium628Open in IMG/M
3300031965|Ga0326597_11531608Not Available639Open in IMG/M
3300032013|Ga0310906_10814105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300032163|Ga0315281_11207262All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300032205|Ga0307472_100997973All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300032770|Ga0335085_10691135All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300032829|Ga0335070_10894309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales823Open in IMG/M
3300033289|Ga0310914_11112598Not Available691Open in IMG/M
3300033433|Ga0326726_12279648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300033551|Ga0247830_11440998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300033806|Ga0314865_062897All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300033811|Ga0364924_081791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300034090|Ga0326723_0407830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria618Open in IMG/M
3300034281|Ga0370481_0165244Not Available772Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.25%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.89%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.89%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.31%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.73%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.73%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.73%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.16%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.16%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.16%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.16%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.58%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.58%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.58%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.58%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.58%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.58%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.58%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.58%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.58%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.58%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.58%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000886Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012186Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06)EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015161Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300025795Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027806Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033806Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_164237602124908045SoilGLKRRFVATIEWLRLWPKPGFFPQTAQTLDIGRAV
AL3A1W_180961723300000886PermafrostLGLKRRFVATIEWLRFWPKPGFFPQIAQILDTAAECS*
Ga0062589_10200617713300004156SoilRWRFGLKRRFVATIEWLRLWPKDGFFPQTAHTLDIGGGV*
Ga0066809_1001996833300005168SoilWRFGSKRRFVATIEWLRLWPNEGFFPQIAQTLDTAAECS*
Ga0066809_1020372323300005168SoilRTRWRFGSKRRFVATIEWLRLWPNEGFFPQIEQTLDTAAECS*
Ga0066671_1081617913300005184SoilRFGLNRRFVATIEWLRLLPNAGFFPHDWQTFDIARRVYG*
Ga0070680_10013775133300005336Corn RhizosphereTRTRCRFGSKRRLVATIEWLRWFPNPGFFPQIEQTFDIGGPE*
Ga0070692_1025628323300005345Corn, Switchgrass And Miscanthus RhizosphereRWRLGLKRRFVATIEWLRLFPKPGFFPQIAQTLDIGGGV*
Ga0070674_10212204113300005356Miscanthus RhizosphereTRTRWRFGSKRRFVATIEWLRLFPNDGPFPQIAHTLAMAGQ*
Ga0070706_10012031643300005467Corn, Switchgrass And Miscanthus RhizosphereWRLGLNRRLVATIEWLRLFPKPGFFPQTEQTLDTAAECS*
Ga0070679_10204356223300005530Corn RhizosphereRIRTFWRLGSKRRFVATIEWLRELPKPGPFLQEKQTFDTAGKASSG*
Ga0070684_10162731613300005535Corn RhizosphereRTRCRFGLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS*
Ga0070672_10102727713300005543Miscanthus RhizosphereRTRCRFGLKRRLVATMEWLRLFPKPGFFPQMAQIFDMTGGAV*
Ga0070704_10164211023300005549Corn, Switchgrass And Miscanthus RhizosphereTRTRWRFGLKRRFVATIECERWFPNPGFLPQTEQTFDIGRPV*
Ga0066692_1041302013300005555SoilKRRFVATIEWLRLLPKPGFFPQTAQTLDTARQCS*
Ga0066670_1027950433300005560SoilRFGLKRRFVATIEWLRLFPKPGFFPQTAQTLATARQCS*
Ga0066699_1000450913300005561SoilRFGSKRRFVATIEWLRLLPKLGFFPHTAHTFDIGRAV*
Ga0066699_1064623823300005561SoilRWRFGSNRRFVATIEWLRLCPKEGFLPQTAQTLDMAAAV*
Ga0066705_1065618813300005569SoilKRRFVATIEWLRLLPNEGFFPQIAQTLDTAAECS*
Ga0066654_1063696323300005587SoilTRTRWRFGLKRRFVATIEWLRLWPNPGFFPQIAQTLDTTAAV*
Ga0066706_1142097113300005598SoilGLKRRLVATIEWLRLFPKPGFFPQTAQTLDTARQCS*
Ga0068856_10176568923300005614Corn RhizosphereRWRFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGY*
Ga0068856_10186472013300005614Corn RhizosphereRWRFGLKRRFVATIEWLRLWPNEGFFPQIAQTLDIGRAV*
Ga0070702_10035082733300005615Corn, Switchgrass And Miscanthus RhizosphereIRTRCRFGLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS*
Ga0066903_10833419013300005764Tropical Forest SoilRFGLKRRFVATIEWLRLFPKPGPFPQTAHTFDMDGGV*
Ga0066696_1068951013300006032SoilRWRFGSKRRFVATIEWLRLLPKPGFFPQLAQTLDIGRPV*
Ga0066652_10027969713300006046SoilRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDTARQCS*
Ga0066652_10196138823300006046SoilRTRCRFGLKRRRVATIEWLLWLPKPGFFPQMAQTLDIAAAQCS*
Ga0097621_10160329423300006237Miscanthus RhizosphereRFGSKRRFVATIEWLRWLPKPGFFPQIAQTFDIGGAG*
Ga0066658_1072040623300006794SoilGSKRRFVATIEWLRWLPKPGFFPQEAQTLLIGPAW*
Ga0066659_1006360743300006797SoilFGSKRRFVATIEWLRLLPKLGFFPHTAHTFDIGRAV*
Ga0066659_1092301423300006797SoilRFGLNRRFVATIEWLRLCPNAGAFPQTAQTFDIAGAW*
Ga0075428_10145738223300006844Populus RhizosphereCRFGLKRRFVATMEWLRLLPKPGFFPQMAQTFDMSGRECSDQ*
Ga0075431_10075666813300006847Populus RhizosphereSRTTRTRWRFGLKRRFVATMEWLRLLPKPGFFPQMAQTFDMSGRECSDQ*
Ga0075431_10179317513300006847Populus RhizosphereRWRFGLKRRFVATIEWLRLFPKPGFFPQIAHTFAMGRASVQMSR*
Ga0075433_1024296433300006852Populus RhizosphereWRLGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGGV*
Ga0075433_1027506733300006852Populus RhizosphereGLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS*
Ga0075433_1196805623300006852Populus RhizosphereRRFVATIEWLRLCPNEGFFPQTAQTLDMAAQCSQRLSD*
Ga0075434_10219866523300006871Populus RhizosphereRFGLKRRFVATIEWLRLWPNEGFFPQTAQTLDTARQFS*
Ga0075424_10083330213300006904Populus RhizosphereKRRFVATMECERLCPNAGFFPQIEQTLDMAGQCSRIVTPSR*
Ga0075436_10032521433300006914Populus RhizosphereRWRFGSKRRFVATIEWLRWFPKPGFLPQIEQTFAIGAPV*
Ga0075436_10093801313300006914Populus RhizosphereTRTRWRFGLKRRFVATMEWLRLLPKPGFFPQMAHTFDMSGRGV*
Ga0075436_10125125023300006914Populus RhizosphereRWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV*
Ga0079218_1367129323300007004Agricultural SoilFGLKRRRVATIEWLRLFPKDGFLPQVTQTLDIGRAV*
Ga0066710_10233940613300009012Grasslands SoilTRTRWRFGSKRRFVATIEWLRWLPKPGFFPQEAQTLLIGPAW
Ga0066710_10461681223300009012Grasslands SoilWRFGSNRRLVATIEWLRLFPNEGFFPQTAQIFDTSGPV
Ga0105245_1133570713300009098Miscanthus RhizosphereKRRFVATIEWLRLFPKPGFFPQTAQTLDTSRQCS*
Ga0075418_1128416313300009100Populus RhizosphereMRTRWRFGLKRRFVATMEWLREFPNPGAFPHTAQTLDIGEGV*
Ga0111538_1098158333300009156Populus RhizosphereGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGGV*
Ga0131077_1104854323300009873WastewaterMFGLKRRGVARMEWLRLLPNMGFLSQTLQTLATVSVLG*
Ga0126304_1102814813300010037Serpentine SoilLAAPFTRMRTRCRFGSNRRRVATIEWLRVFPKDGFLPQIEHTLDTRRV*
Ga0126309_1016098743300010039Serpentine SoilRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGGGV*
Ga0126309_1093625923300010039Serpentine SoilMRTRCRFGLKRRFVATMEWLRLCPNEGFFPQTLQTFDIGARV*
Ga0126308_1079075923300010040Serpentine SoilGLKRRFVATIEWLRLWPKDGFFPQIAQTLDIGGGV*
Ga0126311_1131427923300010045Serpentine SoilLGLKRRLVATIEWLRLWPKDGFFPQIAQTLDIGGGV*
Ga0134086_1043938523300010323Grasslands SoilRTRWRFGSKRRFVATIEWLRLWPKDGFFPQTAHTFAMGPQ*
Ga0134065_1010140733300010326Grasslands SoilGLKRRFVATIEWLRLFPKPGFFPQTAQTLDIGRAV*
Ga0134063_1041785923300010335Grasslands SoilFGSKRRFVATIEWLRLLPKPGFFPQIAQTLDIGRAW*
Ga0126377_1100123823300010362Tropical Forest SoilGSNRRMVATIEWLRWFPKPGFFPQTAQTLDIGGPG*
Ga0105239_1324087423300010375Corn RhizosphereRFGLKRRFVATIECERWFPNPGFLPQTEQTFDIGRPV*
Ga0134126_1280877113300010396Terrestrial SoilRFGSKRRFVATIECERWFPNAGFLPQTAQTFDIGGPG*
Ga0126356_1091565113300010877Boreal Forest SoilRFGLKRRFVATIEWLRWFPNPGFFPQIEQTFDIGEGV*
Ga0137424_100495033300011412SoilLKRRRVATIEWLRLLPNDGPFPQIAQTLDIGGGV*
Ga0137424_102133533300011412SoilLGLKRRFVATIEWLRLLPNDGPFPQTAQTLDIGG*
Ga0120134_100330213300012004PermafrostRMCCRLGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR*
Ga0136625_111889923300012091Polar Desert SandFWRFGLKRRLVATIEWLRLCPNAGPFPQEKQILAIAGG*
Ga0137344_106516123300012159SoilGLKRRRVATIEWLRLLPNDGPFPQIAQTLDIGGGV*
Ga0136620_10001139133300012186Polar Desert SandVATIEWLRLFPKLGFFPQMAQILDIGGECSEGPGR*
Ga0137381_1043921613300012207Vadose Zone SoilWRFGLKRRFVATIEWLRLLPKPGFFPQTAQTFDIARPV*
Ga0137381_1109466713300012207Vadose Zone SoilTRWRFGSKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV*
Ga0137377_1015989413300012211Vadose Zone SoilSKRRRVATIEWLRLFPKLGFFPQTAQTLDIGPAV*
Ga0137371_1116305023300012356Vadose Zone SoilGLKRRLVATIEWLRLLPKPGFFPQTAQTLDIGRAV*
Ga0137385_1079835723300012359Vadose Zone SoilGSKRRFVATIEWLRLFPKPGFFPQTAQILDIAAV*
Ga0157320_102512813300012481Arabidopsis RhizosphereRFGSKRRFVATMEWLRLLPNAGFFPQIAQTLDTAAECS*
Ga0136612_1009536533300012680Polar Desert SandRTRCRLGSKRRLVATIEWLRLFPKDGFFPHTEQTLDIVRRV*
Ga0157287_110411223300012885SoilGLKRRFVATIEWLRLFPKDGFFPQIAQILATTAAV*
Ga0157308_1002511933300012910SoilGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGV*
Ga0164303_1142767313300012957SoilLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV*
Ga0164299_1131788223300012958SoilWRFGSKRRFVATIEWLRWLPKPGFFPQTAQTFDIGGPE*
Ga0164301_1009585013300012960SoilWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV*
Ga0164302_1102408723300012961SoilRTRWRFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGV*
Ga0164304_1092094123300012986SoilWRFGSKRRLVATIEWLRWLPKPGFFPQTAQTLLIGGAV*
Ga0164305_1026811923300012989SoilTRTRWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV*
Ga0157378_1126847723300013297Miscanthus RhizosphereWRFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGY*
Ga0157372_1315439323300013307Corn RhizosphereFGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR*
Ga0120158_1038958813300013772PermafrostGLKRRLVATIEWLRDWPNAGPLPQLWQTFAIGDSGW*
Ga0120109_101503213300014052PermafrostGLGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR*
Ga0120149_120083123300014058PermafrostLKRRFVATIEWLRLFPKPGFFPQIAQIFDIGRAV*
Ga0134078_1053016623300014157Grasslands SoilWRFGLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQFS*
Ga0075320_102342923300014255Natural And Restored WetlandsMRTRWRFGLKRRLVATIEWLRLFPKDGAFPHTAQTLDIGEGV*
Ga0120193_1002048613300014965TerrestrialTRTRWRFGSKRRFVATIEWLRLCPKDGFFPQTAQILAMAAE*
Ga0173483_1017809013300015077SoilKRRLVATIEWLRLLPNAGFLPQIAQTLDTAAECS*
Ga0167623_101252213300015161Glacier Forefield SoilRFGSKRRLVATIEWERLFPNPGFLPQIAQTFDMRRAV*
Ga0132258_1006211433300015371Arabidopsis RhizosphereMRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTAQTLDIGDGV*
Ga0132255_10074048613300015374Arabidopsis RhizosphereTRWRFGLNRRFVGTIEWLRLWPKPGFFPQIAQTLDIGGGV*
Ga0187785_1033544113300017947Tropical PeatlandCRFGLKRRFVATIEWLRLWPNDGFLPQIAQTFDIGR
Ga0184610_119873823300017997Groundwater SedimentGSKRRLVATIEWLRWFPNPGFFPQIEQTLDIGGPV
Ga0184619_1027123323300018061Groundwater SedimentTRMRTRWRFGLNLRFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL
Ga0190265_1165076633300018422SoilRLGLKRRFVATIEWLRLWPNEGPFPQTAQTFDIGG
Ga0190270_1009222613300018469SoilRFGSKRRFVATIEWLRLFPKPGFFPQTAQIFAMTAE
Ga0193715_109240523300019878SoilTRMRTRWRFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL
Ga0193707_116796223300019881SoilTRWRLGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV
Ga0222622_1105671313300022756Groundwater SedimentGVPFTRMRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTEQTLDIGDGV
Ga0247786_106047413300022883SoilCRKTRTRWRLGLKRRFVATIEWLRLFPKDGFFPQIAQILATTAAV
Ga0247748_107127013300023168SoilWRFGLNRRFVATIEWLLLFPNAGPFPQTAQIFDIGRPV
Ga0210114_101002033300025795Natural And Restored WetlandsMRTRWRFGLKRRLVATIEWLRLFPKDGAFPHTAQTLDIGEGV
Ga0207653_1002293733300025885Corn, Switchgrass And Miscanthus RhizosphereTRWRFGLKRRFVATMEWLRLWPKPGFFPQTAQTLDIGRAV
Ga0207642_1099181523300025899Miscanthus RhizosphereTRCRFGLKRRLVATMEWLRLFPKPGFFPQMAQIFDMTGGAV
Ga0207695_1060435023300025913Corn RhizosphereSKTRTRWRLGLKRRFVATIEWLRLFPNPGFFPQIAQTLDIGGGV
Ga0207671_1054005623300025914Corn RhizosphereLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR
Ga0207663_1042823913300025916Corn, Switchgrass And Miscanthus RhizosphereGLKRRLVATIEWLRLWPNPGFFAQIAHTLDIGGGV
Ga0207701_1107016913300025930Corn, Switchgrass And Miscanthus RhizosphereTRTRWRFGSKRLFVATIEWLRLFPKDGFFPQIAQILATTAAV
Ga0207709_1038672313300025935Miscanthus RhizosphereFGLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQCS
Ga0207670_1036257233300025936Switchgrass RhizosphereGLKRRFVATMEWLRLWPKPGFFPQTAQTLDIGRAV
Ga0207640_1081736823300025981Corn RhizosphereLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS
Ga0207677_1085588013300026023Miscanthus RhizosphereLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQCS
Ga0207702_1091876223300026078Corn RhizosphereRWRFGSKRRFVATIEWLRWLPNPGFFPQIAQTLDIGGPE
Ga0207698_1063178513300026142Corn RhizosphereGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR
Ga0209027_106904633300026300Grasslands SoilSSTRTRWRFGLKRRFVATIEWLRLLPNPGFFPQTAQTLDTAGQCS
Ga0209238_120238713300026301Grasslands SoilRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDTARQCS
Ga0209686_112777633300026315SoilGSKRRFVATIEWLRLLPKLGFFPHTAHTFDIGRAV
Ga0209474_1073830823300026550SoilGSKRRLVATIEWLRWWPKPGFFPQIAQTFDIGAPV
Ga0209074_1053526223300027787Agricultural SoilFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGY
Ga0209985_1014160813300027806Freshwater LakeRRFVATMEWLRLLPKDGPRPQELQTRDMRAVCWTLR
Ga0209811_1000344613300027821Surface SoilRTRWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV
Ga0265337_110820023300028556RhizospherePSRNMRTRWRFGSKRRFVATIEWLRWCPKLGFFPQITHTLDIGGAV
Ga0265318_1032627323300028577RhizosphereRWRLGLKRRLVATIEWLRLLPNDGFFPQMEQILDIGGEV
Ga0247828_1033197113300028587SoilRTRCRFGLKRRLVATIEWLRLFPKDGFLPQDAQTLDIGPGV
Ga0307295_1007718023300028708SoilRRTRTRWRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV
Ga0307293_1004467813300028711SoilFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL
Ga0307303_1016027123300028713SoilLKRRFVATIEWLRFWPKEGFFPQIAQILDTAAESS
Ga0307298_1006442013300028717SoilFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV
Ga0307298_1021172013300028717SoilRCRFGLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQCS
Ga0307301_1000910913300028719SoilRWRLGLKRRFVATIEWLRLFPKPGFFPQTAQTLDIGSAV
Ga0307317_10000941123300028720SoilFGLNRRFVATIEWLLLFPNAGPFPQTAQIFDIGAPV
Ga0307317_1011474213300028720SoilRLGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGV
Ga0307316_1030912723300028755SoilMRTLWRFGSKRRLVATIEWLRLFPKLGFFPQTAQTLDIGGGF
Ga0307290_1000722023300028791SoilMRTRWRFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL
Ga0307299_1013724723300028793SoilGSKRRFVATIEWLRLFPKEGPFPQTEQTLDIGDGV
Ga0307284_1032614813300028799SoilTRTRWRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV
Ga0307284_1047667023300028799SoilRFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL
Ga0247824_1040038113300028809SoilMRTRTRCRFGLKRRLVATIEWLRLFPKDGFLPQDAQTLDIGRGV
Ga0307294_1032918513300028810SoilFGLNRRFVATIEWLLLCPNAGAFPQTAHTFDISARNYS
Ga0307302_1003369213300028814SoilPRSMTRTRWRLGLKRRFVATIEWLRLFPKPGFFPQTAQTLDIGSAV
Ga0307312_1055903413300028828SoilRWRLGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV
Ga0307286_1017729023300028876SoilMRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTEQTLDIGDGV
Ga0307286_1020617413300028876SoilWRFGSKRRFVATIEWLQLFPKDGFFPQIAQILATTAAV
Ga0307300_1012313223300028880SoilWRFGLNRRLVATIEWLRLLPNDGSFRQIAQTLDTAASVAK
Ga0307300_1028839123300028880SoilMRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTEQTFDIGDGV
Ga0307277_1028503823300028881SoilTRWRFGSKRRFVATIEWLRLWPNDGFFPQMAQILDTAAECS
Ga0307277_1053274213300028881SoilRTRWRFGLKRRFVATIEWLRLWPKLGFFPQTAQTLDIGGGL
Ga0247827_1031967613300028889SoilRTRWRLGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGECS
Ga0311333_1148421213300030114FenTRCRFGSKRRRVATIEWLRLLPKAGFLPQTEQTLDIAGAV
Ga0247826_1052240313300030336SoilFGLNRRFVATIEWLLLFPNAGPFPQTAQIFDIGRPV
Ga0307497_1002810513300031226SoilRWRFGLKRRFVATMEWLRLWPKPGFFPQTAQTLDIGRAV
Ga0310886_1072932723300031562SoilTRTRWRLGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGGV
Ga0318492_1075041623300031748SoilSMRTRWRFGSNRRFVATIECDRLWPNPGFLPQTEQTFDIGETG
Ga0318546_1019175613300031771SoilRFGSKRRFVATIEWLRLCPKLGFLPQIAQTFDIGAPV
Ga0318568_1015834223300031819SoilMRTRWRFGSNRRFVATIECDRLWPNPGFLPQTEQTFDIGPTG
Ga0315901_1090266113300031963FreshwaterSKRRFVATMEWLRLLPKDGPRPQELQTRDMRAVCWTLR
Ga0326597_1153160823300031965SoilWARPASMTRTRWRFGLKRRFVATIEWLRLWPNDGFFPQIAQTFDMAGGV
Ga0310906_1081410513300032013SoilRFGLKRRFVATIEWLRLWPKPGFFPQIAQTLDIGGGV
Ga0315281_1120726223300032163SedimentMRCRFGLNRRFVATIEWLRLFPNPGFFPQMAQTLDTAAKCSGRGLTAAAG
Ga0307472_10099797313300032205Hardwood Forest SoilGLNRRFVATMEWLLLCPNAGAFPQTAQTFDMGRPV
Ga0335085_1069113533300032770SoilAPTMIRTRWRFGLKRRFVATIEWLREFPNAGPLPQIAHTFDIAGGV
Ga0335070_1089430923300032829SoilMIRTFWRFGSNRRFVATIEWLRLCPNEGPLPQLWHTFDIVGKP
Ga0310914_1111259813300033289SoilFGSNRRLVATIEWLRLWPNPGFLPQIAQTLDIDDPV
Ga0326726_1227964813300033433Peat SoilRWRFGLKRRFVATIEWLREFPNAGPLPQIAHTFDIAGGV
Ga0247830_1144099813300033551SoilGLKRRFVATIEWLRLFPKPGFFPQIAQTLDIGGGV
Ga0314865_062897_13_1413300033806PeatlandMRTRWRFGSKRRFAATIEWLRWCPKLGFFPQMAHTFDIGAPV
Ga0364924_081791_598_7173300033811SedimentFWRFGLKRRRVATIEWLRLFPNDGFLPQVTQTLDIGRGV
Ga0326723_0407830_241_3903300034090Peat SoilMGVAPTMIRTRWRFGLKRRLVATMEWLREFPNAGPLPQIAHTFDMAGGV
Ga0370481_0165244_92_2263300034281Untreated Peat SoilMRTRWRFGLKRRFEATFEWLRLLPMTGFFPQQVHTLDMRIPWLD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.