Basic Information | |
---|---|
Family ID | F034961 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 173 |
Average Sequence Length | 39 residues |
Representative Sequence | RFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGGGV |
Number of Associated Samples | 153 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.14 % |
% of genes near scaffold ends (potentially truncated) | 87.86 % |
% of genes from short scaffolds (< 2000 bps) | 89.02 % |
Associated GOLD sequencing projects | 150 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.832 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.387 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.855 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.289 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.62% β-sheet: 0.00% Coil/Unstructured: 75.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF00885 | DMRL_synthase | 65.32 |
PF00925 | GTP_cyclohydro2 | 6.36 |
PF02734 | Dak2 | 4.62 |
PF13684 | Dak1_2 | 2.31 |
PF02618 | YceG | 1.73 |
PF00677 | Lum_binding | 1.73 |
PF04828 | GFA | 1.73 |
PF00926 | DHBP_synthase | 1.73 |
PF00353 | HemolysinCabind | 1.16 |
PF00534 | Glycos_transf_1 | 0.58 |
PF13011 | LZ_Tnp_IS481 | 0.58 |
PF01189 | Methyltr_RsmB-F | 0.58 |
PF05974 | DUF892 | 0.58 |
PF02911 | Formyl_trans_C | 0.58 |
PF13563 | 2_5_RNA_ligase2 | 0.58 |
PF00834 | Ribul_P_3_epim | 0.58 |
PF01872 | RibD_C | 0.58 |
PF03602 | Cons_hypoth95 | 0.58 |
PF00069 | Pkinase | 0.58 |
PF01070 | FMN_dh | 0.58 |
PF10502 | Peptidase_S26 | 0.58 |
PF03780 | Asp23 | 0.58 |
COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
---|---|---|---|
COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 65.32 |
COG0807 | GTP cyclohydrolase II | Coenzyme transport and metabolism [H] | 6.36 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.31 |
COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 1.73 |
COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 1.73 |
COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 1.73 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.73 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.58 |
COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.58 |
COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG1302 | Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) family | Function unknown [S] | 0.58 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.58 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.58 |
COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.58 |
COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.58 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.58 |
COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.83 % |
Unclassified | root | N/A | 27.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig932988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300000886|AL3A1W_1809617 | Not Available | 628 | Open in IMG/M |
3300004156|Ga0062589_102006177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300005168|Ga0066809_10019968 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300005168|Ga0066809_10203723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300005184|Ga0066671_10816179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
3300005336|Ga0070680_100137751 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
3300005345|Ga0070692_10256283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
3300005356|Ga0070674_102122041 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005467|Ga0070706_100120316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2447 | Open in IMG/M |
3300005530|Ga0070679_102043562 | Not Available | 522 | Open in IMG/M |
3300005535|Ga0070684_101627316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300005543|Ga0070672_101027277 | Not Available | 731 | Open in IMG/M |
3300005549|Ga0070704_101642110 | Not Available | 593 | Open in IMG/M |
3300005555|Ga0066692_10413020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
3300005560|Ga0066670_10279504 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300005561|Ga0066699_10004509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6002 | Open in IMG/M |
3300005561|Ga0066699_10646238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
3300005569|Ga0066705_10656188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300005587|Ga0066654_10636963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300005598|Ga0066706_11420971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300005614|Ga0068856_101765689 | Not Available | 631 | Open in IMG/M |
3300005614|Ga0068856_101864720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300005615|Ga0070702_100350827 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300005764|Ga0066903_108334190 | Not Available | 530 | Open in IMG/M |
3300006032|Ga0066696_10689510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 657 | Open in IMG/M |
3300006046|Ga0066652_100279697 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300006046|Ga0066652_101961388 | Not Available | 523 | Open in IMG/M |
3300006237|Ga0097621_101603294 | Not Available | 619 | Open in IMG/M |
3300006794|Ga0066658_10720406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300006797|Ga0066659_10063607 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300006797|Ga0066659_10923014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
3300006844|Ga0075428_101457382 | Not Available | 718 | Open in IMG/M |
3300006847|Ga0075431_100756668 | Not Available | 947 | Open in IMG/M |
3300006847|Ga0075431_101793175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300006852|Ga0075433_10242964 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300006852|Ga0075433_10275067 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300006852|Ga0075433_11968056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300006871|Ga0075434_102198665 | Not Available | 555 | Open in IMG/M |
3300006914|Ga0075436_100325214 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300006914|Ga0075436_100938013 | Not Available | 648 | Open in IMG/M |
3300006914|Ga0075436_101251250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300007004|Ga0079218_13671293 | Not Available | 521 | Open in IMG/M |
3300009012|Ga0066710_102339406 | Not Available | 776 | Open in IMG/M |
3300009012|Ga0066710_104616812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300009098|Ga0105245_11335707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
3300009100|Ga0075418_11284163 | Not Available | 794 | Open in IMG/M |
3300009156|Ga0111538_10981583 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300010037|Ga0126304_11028148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300010039|Ga0126309_10160987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
3300010039|Ga0126309_10936259 | Not Available | 577 | Open in IMG/M |
3300010040|Ga0126308_10790759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
3300010045|Ga0126311_11314279 | Not Available | 601 | Open in IMG/M |
3300010323|Ga0134086_10439385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300010326|Ga0134065_10101407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300010335|Ga0134063_10417859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
3300010362|Ga0126377_11001238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
3300010375|Ga0105239_13240874 | Not Available | 530 | Open in IMG/M |
3300010396|Ga0134126_12808771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300010877|Ga0126356_10915651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
3300011412|Ga0137424_1004950 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300011412|Ga0137424_1021335 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300012091|Ga0136625_1118899 | Not Available | 917 | Open in IMG/M |
3300012159|Ga0137344_1065161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300012186|Ga0136620_10001139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 12511 | Open in IMG/M |
3300012207|Ga0137381_10439216 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300012207|Ga0137381_11094667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300012211|Ga0137377_10159894 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
3300012356|Ga0137371_11163050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300012359|Ga0137385_10798357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 784 | Open in IMG/M |
3300012680|Ga0136612_10095365 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
3300012885|Ga0157287_1104112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300012910|Ga0157308_10025119 | Not Available | 1374 | Open in IMG/M |
3300012957|Ga0164303_11427673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300012958|Ga0164299_11317882 | Not Available | 553 | Open in IMG/M |
3300012960|Ga0164301_10095850 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300012961|Ga0164302_11024087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
3300012986|Ga0164304_10920941 | Not Available | 685 | Open in IMG/M |
3300012989|Ga0164305_10268119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1244 | Open in IMG/M |
3300013297|Ga0157378_11268477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
3300013307|Ga0157372_13154393 | Not Available | 526 | Open in IMG/M |
3300013772|Ga0120158_10389588 | Not Available | 644 | Open in IMG/M |
3300014052|Ga0120109_1015032 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300014058|Ga0120149_1200831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
3300014157|Ga0134078_10530166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300014255|Ga0075320_1023429 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300014965|Ga0120193_10020486 | Not Available | 745 | Open in IMG/M |
3300015077|Ga0173483_10178090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
3300015161|Ga0167623_1012522 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
3300015371|Ga0132258_10062114 | All Organisms → cellular organisms → Bacteria | 8619 | Open in IMG/M |
3300015374|Ga0132255_100740486 | Not Available | 1462 | Open in IMG/M |
3300017947|Ga0187785_10335441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
3300017997|Ga0184610_1198738 | Not Available | 669 | Open in IMG/M |
3300018061|Ga0184619_10271233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
3300018422|Ga0190265_11650766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
3300018469|Ga0190270_10092226 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
3300019878|Ga0193715_1092405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300019881|Ga0193707_1167962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300022756|Ga0222622_11056713 | Not Available | 597 | Open in IMG/M |
3300022883|Ga0247786_1060474 | Not Available | 778 | Open in IMG/M |
3300023168|Ga0247748_1071270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
3300025795|Ga0210114_1010020 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
3300025885|Ga0207653_10022937 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
3300025899|Ga0207642_10991815 | Not Available | 541 | Open in IMG/M |
3300025913|Ga0207695_10604350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300025914|Ga0207671_10540056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 929 | Open in IMG/M |
3300025916|Ga0207663_10428239 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300025930|Ga0207701_11070169 | Not Available | 669 | Open in IMG/M |
3300025935|Ga0207709_10386723 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300025936|Ga0207670_10362572 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300025981|Ga0207640_10817368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
3300026023|Ga0207677_10855880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300026078|Ga0207702_10918762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300026142|Ga0207698_10631785 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300026300|Ga0209027_1069046 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300026301|Ga0209238_1202387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300026315|Ga0209686_1127776 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300026550|Ga0209474_10738308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
3300027787|Ga0209074_10535262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300027806|Ga0209985_10141608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1194 | Open in IMG/M |
3300027821|Ga0209811_10003446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5160 | Open in IMG/M |
3300028556|Ga0265337_1108200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300028577|Ga0265318_10326273 | Not Available | 560 | Open in IMG/M |
3300028587|Ga0247828_10331971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
3300028708|Ga0307295_10077180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
3300028711|Ga0307293_10044678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1367 | Open in IMG/M |
3300028713|Ga0307303_10160271 | Not Available | 544 | Open in IMG/M |
3300028717|Ga0307298_10064420 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300028717|Ga0307298_10211720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300028719|Ga0307301_10009109 | All Organisms → cellular organisms → Bacteria | 2796 | Open in IMG/M |
3300028720|Ga0307317_10000941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8752 | Open in IMG/M |
3300028720|Ga0307317_10114742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300028755|Ga0307316_10309127 | Not Available | 579 | Open in IMG/M |
3300028791|Ga0307290_10007220 | All Organisms → cellular organisms → Bacteria | 3687 | Open in IMG/M |
3300028793|Ga0307299_10137247 | Not Available | 919 | Open in IMG/M |
3300028799|Ga0307284_10326148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300028799|Ga0307284_10476670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300028809|Ga0247824_10400381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
3300028810|Ga0307294_10329185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300028814|Ga0307302_10033692 | All Organisms → cellular organisms → Bacteria | 2360 | Open in IMG/M |
3300028828|Ga0307312_10559034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300028876|Ga0307286_10177290 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300028876|Ga0307286_10206174 | Not Available | 714 | Open in IMG/M |
3300028880|Ga0307300_10123132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
3300028880|Ga0307300_10288391 | Not Available | 553 | Open in IMG/M |
3300028881|Ga0307277_10285038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
3300028881|Ga0307277_10532742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300028889|Ga0247827_10319676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
3300030114|Ga0311333_11484212 | Not Available | 584 | Open in IMG/M |
3300030336|Ga0247826_10522403 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300031226|Ga0307497_10028105 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
3300031562|Ga0310886_10729327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300031748|Ga0318492_10750416 | Not Available | 524 | Open in IMG/M |
3300031771|Ga0318546_10191756 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300031819|Ga0318568_10158342 | Not Available | 1387 | Open in IMG/M |
3300031963|Ga0315901_10902661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 628 | Open in IMG/M |
3300031965|Ga0326597_11531608 | Not Available | 639 | Open in IMG/M |
3300032013|Ga0310906_10814105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300032163|Ga0315281_11207262 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300032205|Ga0307472_100997973 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300032770|Ga0335085_10691135 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300032829|Ga0335070_10894309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 823 | Open in IMG/M |
3300033289|Ga0310914_11112598 | Not Available | 691 | Open in IMG/M |
3300033433|Ga0326726_12279648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300033551|Ga0247830_11440998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300033806|Ga0314865_062897 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300033811|Ga0364924_081791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
3300034090|Ga0326723_0407830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300034281|Ga0370481_0165244 | Not Available | 772 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.47% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.89% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.89% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.31% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.73% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.16% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.16% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.16% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.16% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.58% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.58% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.58% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.58% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.58% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.58% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.58% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.58% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.58% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.58% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.58% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
3300012186 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ416 (21.06) | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_16423760 | 2124908045 | Soil | GLKRRFVATIEWLRLWPKPGFFPQTAQTLDIGRAV |
AL3A1W_18096172 | 3300000886 | Permafrost | LGLKRRFVATIEWLRFWPKPGFFPQIAQILDTAAECS* |
Ga0062589_1020061771 | 3300004156 | Soil | RWRFGLKRRFVATIEWLRLWPKDGFFPQTAHTLDIGGGV* |
Ga0066809_100199683 | 3300005168 | Soil | WRFGSKRRFVATIEWLRLWPNEGFFPQIAQTLDTAAECS* |
Ga0066809_102037232 | 3300005168 | Soil | RTRWRFGSKRRFVATIEWLRLWPNEGFFPQIEQTLDTAAECS* |
Ga0066671_108161791 | 3300005184 | Soil | RFGLNRRFVATIEWLRLLPNAGFFPHDWQTFDIARRVYG* |
Ga0070680_1001377513 | 3300005336 | Corn Rhizosphere | TRTRCRFGSKRRLVATIEWLRWFPNPGFFPQIEQTFDIGGPE* |
Ga0070692_102562832 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | RWRLGLKRRFVATIEWLRLFPKPGFFPQIAQTLDIGGGV* |
Ga0070674_1021220411 | 3300005356 | Miscanthus Rhizosphere | TRTRWRFGSKRRFVATIEWLRLFPNDGPFPQIAHTLAMAGQ* |
Ga0070706_1001203164 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | WRLGLNRRLVATIEWLRLFPKPGFFPQTEQTLDTAAECS* |
Ga0070679_1020435622 | 3300005530 | Corn Rhizosphere | RIRTFWRLGSKRRFVATIEWLRELPKPGPFLQEKQTFDTAGKASSG* |
Ga0070684_1016273161 | 3300005535 | Corn Rhizosphere | RTRCRFGLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS* |
Ga0070672_1010272771 | 3300005543 | Miscanthus Rhizosphere | RTRCRFGLKRRLVATMEWLRLFPKPGFFPQMAQIFDMTGGAV* |
Ga0070704_1016421102 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TRTRWRFGLKRRFVATIECERWFPNPGFLPQTEQTFDIGRPV* |
Ga0066692_104130201 | 3300005555 | Soil | KRRFVATIEWLRLLPKPGFFPQTAQTLDTARQCS* |
Ga0066670_102795043 | 3300005560 | Soil | RFGLKRRFVATIEWLRLFPKPGFFPQTAQTLATARQCS* |
Ga0066699_100045091 | 3300005561 | Soil | RFGSKRRFVATIEWLRLLPKLGFFPHTAHTFDIGRAV* |
Ga0066699_106462382 | 3300005561 | Soil | RWRFGSNRRFVATIEWLRLCPKEGFLPQTAQTLDMAAAV* |
Ga0066705_106561881 | 3300005569 | Soil | KRRFVATIEWLRLLPNEGFFPQIAQTLDTAAECS* |
Ga0066654_106369632 | 3300005587 | Soil | TRTRWRFGLKRRFVATIEWLRLWPNPGFFPQIAQTLDTTAAV* |
Ga0066706_114209711 | 3300005598 | Soil | GLKRRLVATIEWLRLFPKPGFFPQTAQTLDTARQCS* |
Ga0068856_1017656892 | 3300005614 | Corn Rhizosphere | RWRFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGY* |
Ga0068856_1018647201 | 3300005614 | Corn Rhizosphere | RWRFGLKRRFVATIEWLRLWPNEGFFPQIAQTLDIGRAV* |
Ga0070702_1003508273 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IRTRCRFGLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS* |
Ga0066903_1083341901 | 3300005764 | Tropical Forest Soil | RFGLKRRFVATIEWLRLFPKPGPFPQTAHTFDMDGGV* |
Ga0066696_106895101 | 3300006032 | Soil | RWRFGSKRRFVATIEWLRLLPKPGFFPQLAQTLDIGRPV* |
Ga0066652_1002796971 | 3300006046 | Soil | RFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDTARQCS* |
Ga0066652_1019613882 | 3300006046 | Soil | RTRCRFGLKRRRVATIEWLLWLPKPGFFPQMAQTLDIAAAQCS* |
Ga0097621_1016032942 | 3300006237 | Miscanthus Rhizosphere | RFGSKRRFVATIEWLRWLPKPGFFPQIAQTFDIGGAG* |
Ga0066658_107204062 | 3300006794 | Soil | GSKRRFVATIEWLRWLPKPGFFPQEAQTLLIGPAW* |
Ga0066659_100636074 | 3300006797 | Soil | FGSKRRFVATIEWLRLLPKLGFFPHTAHTFDIGRAV* |
Ga0066659_109230142 | 3300006797 | Soil | RFGLNRRFVATIEWLRLCPNAGAFPQTAQTFDIAGAW* |
Ga0075428_1014573822 | 3300006844 | Populus Rhizosphere | CRFGLKRRFVATMEWLRLLPKPGFFPQMAQTFDMSGRECSDQ* |
Ga0075431_1007566681 | 3300006847 | Populus Rhizosphere | SRTTRTRWRFGLKRRFVATMEWLRLLPKPGFFPQMAQTFDMSGRECSDQ* |
Ga0075431_1017931751 | 3300006847 | Populus Rhizosphere | RWRFGLKRRFVATIEWLRLFPKPGFFPQIAHTFAMGRASVQMSR* |
Ga0075433_102429643 | 3300006852 | Populus Rhizosphere | WRLGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGGV* |
Ga0075433_102750673 | 3300006852 | Populus Rhizosphere | GLKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS* |
Ga0075433_119680562 | 3300006852 | Populus Rhizosphere | RRFVATIEWLRLCPNEGFFPQTAQTLDMAAQCSQRLSD* |
Ga0075434_1021986652 | 3300006871 | Populus Rhizosphere | RFGLKRRFVATIEWLRLWPNEGFFPQTAQTLDTARQFS* |
Ga0075424_1008333021 | 3300006904 | Populus Rhizosphere | KRRFVATMECERLCPNAGFFPQIEQTLDMAGQCSRIVTPSR* |
Ga0075436_1003252143 | 3300006914 | Populus Rhizosphere | RWRFGSKRRFVATIEWLRWFPKPGFLPQIEQTFAIGAPV* |
Ga0075436_1009380131 | 3300006914 | Populus Rhizosphere | TRTRWRFGLKRRFVATMEWLRLLPKPGFFPQMAHTFDMSGRGV* |
Ga0075436_1012512502 | 3300006914 | Populus Rhizosphere | RWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV* |
Ga0079218_136712932 | 3300007004 | Agricultural Soil | FGLKRRRVATIEWLRLFPKDGFLPQVTQTLDIGRAV* |
Ga0066710_1023394061 | 3300009012 | Grasslands Soil | TRTRWRFGSKRRFVATIEWLRWLPKPGFFPQEAQTLLIGPAW |
Ga0066710_1046168122 | 3300009012 | Grasslands Soil | WRFGSNRRLVATIEWLRLFPNEGFFPQTAQIFDTSGPV |
Ga0105245_113357071 | 3300009098 | Miscanthus Rhizosphere | KRRFVATIEWLRLFPKPGFFPQTAQTLDTSRQCS* |
Ga0075418_112841631 | 3300009100 | Populus Rhizosphere | MRTRWRFGLKRRFVATMEWLREFPNPGAFPHTAQTLDIGEGV* |
Ga0111538_109815833 | 3300009156 | Populus Rhizosphere | GLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGGV* |
Ga0131077_110485432 | 3300009873 | Wastewater | MFGLKRRGVARMEWLRLLPNMGFLSQTLQTLATVSVLG* |
Ga0126304_110281481 | 3300010037 | Serpentine Soil | LAAPFTRMRTRCRFGSNRRRVATIEWLRVFPKDGFLPQIEHTLDTRRV* |
Ga0126309_101609874 | 3300010039 | Serpentine Soil | RFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGGGV* |
Ga0126309_109362592 | 3300010039 | Serpentine Soil | MRTRCRFGLKRRFVATMEWLRLCPNEGFFPQTLQTFDIGARV* |
Ga0126308_107907592 | 3300010040 | Serpentine Soil | GLKRRFVATIEWLRLWPKDGFFPQIAQTLDIGGGV* |
Ga0126311_113142792 | 3300010045 | Serpentine Soil | LGLKRRLVATIEWLRLWPKDGFFPQIAQTLDIGGGV* |
Ga0134086_104393852 | 3300010323 | Grasslands Soil | RTRWRFGSKRRFVATIEWLRLWPKDGFFPQTAHTFAMGPQ* |
Ga0134065_101014073 | 3300010326 | Grasslands Soil | GLKRRFVATIEWLRLFPKPGFFPQTAQTLDIGRAV* |
Ga0134063_104178592 | 3300010335 | Grasslands Soil | FGSKRRFVATIEWLRLLPKPGFFPQIAQTLDIGRAW* |
Ga0126377_110012382 | 3300010362 | Tropical Forest Soil | GSNRRMVATIEWLRWFPKPGFFPQTAQTLDIGGPG* |
Ga0105239_132408742 | 3300010375 | Corn Rhizosphere | RFGLKRRFVATIECERWFPNPGFLPQTEQTFDIGRPV* |
Ga0134126_128087711 | 3300010396 | Terrestrial Soil | RFGSKRRFVATIECERWFPNAGFLPQTAQTFDIGGPG* |
Ga0126356_109156511 | 3300010877 | Boreal Forest Soil | RFGLKRRFVATIEWLRWFPNPGFFPQIEQTFDIGEGV* |
Ga0137424_10049503 | 3300011412 | Soil | LKRRRVATIEWLRLLPNDGPFPQIAQTLDIGGGV* |
Ga0137424_10213353 | 3300011412 | Soil | LGLKRRFVATIEWLRLLPNDGPFPQTAQTLDIGG* |
Ga0120134_10033021 | 3300012004 | Permafrost | RMCCRLGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR* |
Ga0136625_11188992 | 3300012091 | Polar Desert Sand | FWRFGLKRRLVATIEWLRLCPNAGPFPQEKQILAIAGG* |
Ga0137344_10651612 | 3300012159 | Soil | GLKRRRVATIEWLRLLPNDGPFPQIAQTLDIGGGV* |
Ga0136620_1000113913 | 3300012186 | Polar Desert Sand | VATIEWLRLFPKLGFFPQMAQILDIGGECSEGPGR* |
Ga0137381_104392161 | 3300012207 | Vadose Zone Soil | WRFGLKRRFVATIEWLRLLPKPGFFPQTAQTFDIARPV* |
Ga0137381_110946671 | 3300012207 | Vadose Zone Soil | TRWRFGSKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV* |
Ga0137377_101598941 | 3300012211 | Vadose Zone Soil | SKRRRVATIEWLRLFPKLGFFPQTAQTLDIGPAV* |
Ga0137371_111630502 | 3300012356 | Vadose Zone Soil | GLKRRLVATIEWLRLLPKPGFFPQTAQTLDIGRAV* |
Ga0137385_107983572 | 3300012359 | Vadose Zone Soil | GSKRRFVATIEWLRLFPKPGFFPQTAQILDIAAV* |
Ga0157320_10251281 | 3300012481 | Arabidopsis Rhizosphere | RFGSKRRFVATMEWLRLLPNAGFFPQIAQTLDTAAECS* |
Ga0136612_100953653 | 3300012680 | Polar Desert Sand | RTRCRLGSKRRLVATIEWLRLFPKDGFFPHTEQTLDIVRRV* |
Ga0157287_11041122 | 3300012885 | Soil | GLKRRFVATIEWLRLFPKDGFFPQIAQILATTAAV* |
Ga0157308_100251193 | 3300012910 | Soil | GLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGV* |
Ga0164303_114276731 | 3300012957 | Soil | LKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV* |
Ga0164299_113178822 | 3300012958 | Soil | WRFGSKRRFVATIEWLRWLPKPGFFPQTAQTFDIGGPE* |
Ga0164301_100958501 | 3300012960 | Soil | WRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV* |
Ga0164302_110240872 | 3300012961 | Soil | RTRWRFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGV* |
Ga0164304_109209412 | 3300012986 | Soil | WRFGSKRRLVATIEWLRWLPKPGFFPQTAQTLLIGGAV* |
Ga0164305_102681192 | 3300012989 | Soil | TRTRWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV* |
Ga0157378_112684772 | 3300013297 | Miscanthus Rhizosphere | WRFGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGY* |
Ga0157372_131543932 | 3300013307 | Corn Rhizosphere | FGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR* |
Ga0120158_103895881 | 3300013772 | Permafrost | GLKRRLVATIEWLRDWPNAGPLPQLWQTFAIGDSGW* |
Ga0120109_10150321 | 3300014052 | Permafrost | GLGLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR* |
Ga0120149_12008312 | 3300014058 | Permafrost | LKRRFVATIEWLRLFPKPGFFPQIAQIFDIGRAV* |
Ga0134078_105301662 | 3300014157 | Grasslands Soil | WRFGLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQFS* |
Ga0075320_10234292 | 3300014255 | Natural And Restored Wetlands | MRTRWRFGLKRRLVATIEWLRLFPKDGAFPHTAQTLDIGEGV* |
Ga0120193_100204861 | 3300014965 | Terrestrial | TRTRWRFGSKRRFVATIEWLRLCPKDGFFPQTAQILAMAAE* |
Ga0173483_101780901 | 3300015077 | Soil | KRRLVATIEWLRLLPNAGFLPQIAQTLDTAAECS* |
Ga0167623_10125221 | 3300015161 | Glacier Forefield Soil | RFGSKRRLVATIEWERLFPNPGFLPQIAQTFDMRRAV* |
Ga0132258_100621143 | 3300015371 | Arabidopsis Rhizosphere | MRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTAQTLDIGDGV* |
Ga0132255_1007404861 | 3300015374 | Arabidopsis Rhizosphere | TRWRFGLNRRFVGTIEWLRLWPKPGFFPQIAQTLDIGGGV* |
Ga0187785_103354411 | 3300017947 | Tropical Peatland | CRFGLKRRFVATIEWLRLWPNDGFLPQIAQTFDIGR |
Ga0184610_11987382 | 3300017997 | Groundwater Sediment | GSKRRLVATIEWLRWFPNPGFFPQIEQTLDIGGPV |
Ga0184619_102712332 | 3300018061 | Groundwater Sediment | TRMRTRWRFGLNLRFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL |
Ga0190265_116507663 | 3300018422 | Soil | RLGLKRRFVATIEWLRLWPNEGPFPQTAQTFDIGG |
Ga0190270_100922261 | 3300018469 | Soil | RFGSKRRFVATIEWLRLFPKPGFFPQTAQIFAMTAE |
Ga0193715_10924052 | 3300019878 | Soil | TRMRTRWRFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL |
Ga0193707_11679622 | 3300019881 | Soil | TRWRLGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV |
Ga0222622_110567131 | 3300022756 | Groundwater Sediment | GVPFTRMRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTEQTLDIGDGV |
Ga0247786_10604741 | 3300022883 | Soil | CRKTRTRWRLGLKRRFVATIEWLRLFPKDGFFPQIAQILATTAAV |
Ga0247748_10712701 | 3300023168 | Soil | WRFGLNRRFVATIEWLLLFPNAGPFPQTAQIFDIGRPV |
Ga0210114_10100203 | 3300025795 | Natural And Restored Wetlands | MRTRWRFGLKRRLVATIEWLRLFPKDGAFPHTAQTLDIGEGV |
Ga0207653_100229373 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | TRWRFGLKRRFVATMEWLRLWPKPGFFPQTAQTLDIGRAV |
Ga0207642_109918152 | 3300025899 | Miscanthus Rhizosphere | TRCRFGLKRRLVATMEWLRLFPKPGFFPQMAQIFDMTGGAV |
Ga0207695_106043502 | 3300025913 | Corn Rhizosphere | SKTRTRWRLGLKRRFVATIEWLRLFPNPGFFPQIAQTLDIGGGV |
Ga0207671_105400562 | 3300025914 | Corn Rhizosphere | LKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR |
Ga0207663_104282391 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GLKRRLVATIEWLRLWPNPGFFAQIAHTLDIGGGV |
Ga0207701_110701691 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | TRTRWRFGSKRLFVATIEWLRLFPKDGFFPQIAQILATTAAV |
Ga0207709_103867231 | 3300025935 | Miscanthus Rhizosphere | FGLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQCS |
Ga0207670_103625723 | 3300025936 | Switchgrass Rhizosphere | GLKRRFVATMEWLRLWPKPGFFPQTAQTLDIGRAV |
Ga0207640_108173682 | 3300025981 | Corn Rhizosphere | LKRRFVATIEWLRLFPKPGFFPQTEQTLDTARQCS |
Ga0207677_108558801 | 3300026023 | Miscanthus Rhizosphere | LKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQCS |
Ga0207702_109187622 | 3300026078 | Corn Rhizosphere | RWRFGSKRRFVATIEWLRWLPNPGFFPQIAQTLDIGGPE |
Ga0207698_106317851 | 3300026142 | Corn Rhizosphere | GLKRRFVATMEWLRLWPNPGFLAQITHTLDTAAEYR |
Ga0209027_10690463 | 3300026300 | Grasslands Soil | SSTRTRWRFGLKRRFVATIEWLRLLPNPGFFPQTAQTLDTAGQCS |
Ga0209238_12023871 | 3300026301 | Grasslands Soil | RFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDTARQCS |
Ga0209686_11277763 | 3300026315 | Soil | GSKRRFVATIEWLRLLPKLGFFPHTAHTFDIGRAV |
Ga0209474_107383082 | 3300026550 | Soil | GSKRRLVATIEWLRWWPKPGFFPQIAQTFDIGAPV |
Ga0209074_105352622 | 3300027787 | Agricultural Soil | FGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGY |
Ga0209985_101416081 | 3300027806 | Freshwater Lake | RRFVATMEWLRLLPKDGPRPQELQTRDMRAVCWTLR |
Ga0209811_100034461 | 3300027821 | Surface Soil | RTRWRFGLKRRFVATIEWLRLLPKPGFFPQIAHTLDIGGAV |
Ga0265337_11082002 | 3300028556 | Rhizosphere | PSRNMRTRWRFGSKRRFVATIEWLRWCPKLGFFPQITHTLDIGGAV |
Ga0265318_103262732 | 3300028577 | Rhizosphere | RWRLGLKRRLVATIEWLRLLPNDGFFPQMEQILDIGGEV |
Ga0247828_103319711 | 3300028587 | Soil | RTRCRFGLKRRLVATIEWLRLFPKDGFLPQDAQTLDIGPGV |
Ga0307295_100771802 | 3300028708 | Soil | RRTRTRWRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV |
Ga0307293_100446781 | 3300028711 | Soil | FGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL |
Ga0307303_101602712 | 3300028713 | Soil | LKRRFVATIEWLRFWPKEGFFPQIAQILDTAAESS |
Ga0307298_100644201 | 3300028717 | Soil | FGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV |
Ga0307298_102117201 | 3300028717 | Soil | RCRFGLKRRFVATIEWLRLFPKPGFFPQTAQTLDTARQCS |
Ga0307301_100091091 | 3300028719 | Soil | RWRLGLKRRFVATIEWLRLFPKPGFFPQTAQTLDIGSAV |
Ga0307317_1000094112 | 3300028720 | Soil | FGLNRRFVATIEWLLLFPNAGPFPQTAQIFDIGAPV |
Ga0307317_101147421 | 3300028720 | Soil | RLGLKRRFVATIEWLRLLPKPGFFPQIAQTLDIGGGV |
Ga0307316_103091272 | 3300028755 | Soil | MRTLWRFGSKRRLVATIEWLRLFPKLGFFPQTAQTLDIGGGF |
Ga0307290_100072202 | 3300028791 | Soil | MRTRWRFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL |
Ga0307299_101372472 | 3300028793 | Soil | GSKRRFVATIEWLRLFPKEGPFPQTEQTLDIGDGV |
Ga0307284_103261481 | 3300028799 | Soil | TRTRWRFGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV |
Ga0307284_104766702 | 3300028799 | Soil | RFGLNLLFVATIEWLRLWPKEGPFPHTAQTFDMVSGGL |
Ga0247824_104003811 | 3300028809 | Soil | MRTRTRCRFGLKRRLVATIEWLRLFPKDGFLPQDAQTLDIGRGV |
Ga0307294_103291851 | 3300028810 | Soil | FGLNRRFVATIEWLLLCPNAGAFPQTAHTFDISARNYS |
Ga0307302_100336921 | 3300028814 | Soil | PRSMTRTRWRLGLKRRFVATIEWLRLFPKPGFFPQTAQTLDIGSAV |
Ga0307312_105590341 | 3300028828 | Soil | RWRLGLKRRFVATIEWLRLLPKPGFFPQTAQTLDIGRAV |
Ga0307286_101772902 | 3300028876 | Soil | MRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTEQTLDIGDGV |
Ga0307286_102061741 | 3300028876 | Soil | WRFGSKRRFVATIEWLQLFPKDGFFPQIAQILATTAAV |
Ga0307300_101231322 | 3300028880 | Soil | WRFGLNRRLVATIEWLRLLPNDGSFRQIAQTLDTAASVAK |
Ga0307300_102883912 | 3300028880 | Soil | MRTRWRFGSKRRFVATIEWLRLFPKEGPFPQTEQTFDIGDGV |
Ga0307277_102850382 | 3300028881 | Soil | TRWRFGSKRRFVATIEWLRLWPNDGFFPQMAQILDTAAECS |
Ga0307277_105327421 | 3300028881 | Soil | RTRWRFGLKRRFVATIEWLRLWPKLGFFPQTAQTLDIGGGL |
Ga0247827_103196761 | 3300028889 | Soil | RTRWRLGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGECS |
Ga0311333_114842121 | 3300030114 | Fen | TRCRFGSKRRRVATIEWLRLLPKAGFLPQTEQTLDIAGAV |
Ga0247826_105224031 | 3300030336 | Soil | FGLNRRFVATIEWLLLFPNAGPFPQTAQIFDIGRPV |
Ga0307497_100281051 | 3300031226 | Soil | RWRFGLKRRFVATMEWLRLWPKPGFFPQTAQTLDIGRAV |
Ga0310886_107293272 | 3300031562 | Soil | TRTRWRLGLKRRFVATIEWLRLWPKDGFFPQIAHTLDIGGGV |
Ga0318492_107504162 | 3300031748 | Soil | SMRTRWRFGSNRRFVATIECDRLWPNPGFLPQTEQTFDIGETG |
Ga0318546_101917561 | 3300031771 | Soil | RFGSKRRFVATIEWLRLCPKLGFLPQIAQTFDIGAPV |
Ga0318568_101583422 | 3300031819 | Soil | MRTRWRFGSNRRFVATIECDRLWPNPGFLPQTEQTFDIGPTG |
Ga0315901_109026611 | 3300031963 | Freshwater | SKRRFVATMEWLRLLPKDGPRPQELQTRDMRAVCWTLR |
Ga0326597_115316082 | 3300031965 | Soil | WARPASMTRTRWRFGLKRRFVATIEWLRLWPNDGFFPQIAQTFDMAGGV |
Ga0310906_108141051 | 3300032013 | Soil | RFGLKRRFVATIEWLRLWPKPGFFPQIAQTLDIGGGV |
Ga0315281_112072622 | 3300032163 | Sediment | MRCRFGLNRRFVATIEWLRLFPNPGFFPQMAQTLDTAAKCSGRGLTAAAG |
Ga0307472_1009979731 | 3300032205 | Hardwood Forest Soil | GLNRRFVATMEWLLLCPNAGAFPQTAQTFDMGRPV |
Ga0335085_106911353 | 3300032770 | Soil | APTMIRTRWRFGLKRRFVATIEWLREFPNAGPLPQIAHTFDIAGGV |
Ga0335070_108943092 | 3300032829 | Soil | MIRTFWRFGSNRRFVATIEWLRLCPNEGPLPQLWHTFDIVGKP |
Ga0310914_111125981 | 3300033289 | Soil | FGSNRRLVATIEWLRLWPNPGFLPQIAQTLDIDDPV |
Ga0326726_122796481 | 3300033433 | Peat Soil | RWRFGLKRRFVATIEWLREFPNAGPLPQIAHTFDIAGGV |
Ga0247830_114409981 | 3300033551 | Soil | GLKRRFVATIEWLRLFPKPGFFPQIAQTLDIGGGV |
Ga0314865_062897_13_141 | 3300033806 | Peatland | MRTRWRFGSKRRFAATIEWLRWCPKLGFFPQMAHTFDIGAPV |
Ga0364924_081791_598_717 | 3300033811 | Sediment | FWRFGLKRRRVATIEWLRLFPNDGFLPQVTQTLDIGRGV |
Ga0326723_0407830_241_390 | 3300034090 | Peat Soil | MGVAPTMIRTRWRFGLKRRLVATMEWLREFPNAGPLPQIAHTFDMAGGV |
Ga0370481_0165244_92_226 | 3300034281 | Untreated Peat Soil | MRTRWRFGLKRRFEATFEWLRLLPMTGFFPQQVHTLDMRIPWLD |
⦗Top⦘ |