Basic Information | |
---|---|
Family ID | F035023 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 173 |
Average Sequence Length | 40 residues |
Representative Sequence | PRDFGRREALERVAKHGDLFEPVLRGGQALGPALRKLRG |
Number of Associated Samples | 159 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.31 % |
% of genes near scaffold ends (potentially truncated) | 95.95 % |
% of genes from short scaffolds (< 2000 bps) | 94.22 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.127 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.543 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.324 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.289 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF13450 | NAD_binding_8 | 30.06 |
PF13419 | HAD_2 | 5.20 |
PF07690 | MFS_1 | 2.89 |
PF01872 | RibD_C | 2.31 |
PF13489 | Methyltransf_23 | 1.73 |
PF00801 | PKD | 1.73 |
PF12697 | Abhydrolase_6 | 1.73 |
PF00730 | HhH-GPD | 1.16 |
PF02782 | FGGY_C | 1.16 |
PF08448 | PAS_4 | 1.16 |
PF13683 | rve_3 | 1.16 |
PF01925 | TauE | 0.58 |
PF00106 | adh_short | 0.58 |
PF13191 | AAA_16 | 0.58 |
PF13458 | Peripla_BP_6 | 0.58 |
PF06210 | DUF1003 | 0.58 |
PF03618 | Kinase-PPPase | 0.58 |
PF02608 | Bmp | 0.58 |
PF00293 | NUDIX | 0.58 |
PF00581 | Rhodanese | 0.58 |
PF01078 | Mg_chelatase | 0.58 |
PF08546 | ApbA_C | 0.58 |
PF00903 | Glyoxalase | 0.58 |
PF00174 | Oxidored_molyb | 0.58 |
PF01593 | Amino_oxidase | 0.58 |
PF14362 | DUF4407 | 0.58 |
PF00561 | Abhydrolase_1 | 0.58 |
PF00211 | Guanylate_cyc | 0.58 |
PF01887 | SAM_HAT_N | 0.58 |
PF00528 | BPD_transp_1 | 0.58 |
PF00144 | Beta-lactamase | 0.58 |
PF11941 | DUF3459 | 0.58 |
PF07676 | PD40 | 0.58 |
PF06467 | zf-FCS | 0.58 |
PF00462 | Glutaredoxin | 0.58 |
PF07883 | Cupin_2 | 0.58 |
PF07730 | HisKA_3 | 0.58 |
PF13669 | Glyoxalase_4 | 0.58 |
PF01863 | YgjP-like | 0.58 |
PF10604 | Polyketide_cyc2 | 0.58 |
PF00089 | Trypsin | 0.58 |
PF12821 | ThrE_2 | 0.58 |
PF01230 | HIT | 0.58 |
COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.31 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.31 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.16 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.16 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.16 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.16 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.16 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.58 |
COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.58 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.58 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.58 |
COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.58 |
COG1806 | Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities) | Signal transduction mechanisms [T] | 0.58 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.58 |
COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.58 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.58 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.58 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.58 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.58 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.58 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.58 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.58 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.58 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.13 % |
Unclassified | root | N/A | 13.87 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig06852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1801 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101400766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300000550|F24TB_10167676 | All Organisms → cellular organisms → Bacteria | 3566 | Open in IMG/M |
3300000559|F14TC_101808135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1421 | Open in IMG/M |
3300000858|JGI10213J12805_10398390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 824 | Open in IMG/M |
3300000891|JGI10214J12806_10528921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
3300000956|JGI10216J12902_103288316 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
3300000956|JGI10216J12902_107524381 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300004114|Ga0062593_100805696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 935 | Open in IMG/M |
3300004156|Ga0062589_102572719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300004157|Ga0062590_101869638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 618 | Open in IMG/M |
3300004463|Ga0063356_100995928 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300004463|Ga0063356_105518466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 543 | Open in IMG/M |
3300004480|Ga0062592_101168821 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300004643|Ga0062591_102372234 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005340|Ga0070689_102181239 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005444|Ga0070694_100340592 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300005459|Ga0068867_101713425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 589 | Open in IMG/M |
3300005467|Ga0070706_100975682 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300005471|Ga0070698_100052626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4141 | Open in IMG/M |
3300005518|Ga0070699_101228681 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005530|Ga0070679_102077165 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005538|Ga0070731_10247349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1184 | Open in IMG/M |
3300005556|Ga0066707_11001199 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005564|Ga0070664_100206004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1756 | Open in IMG/M |
3300005569|Ga0066705_10432852 | Not Available | 824 | Open in IMG/M |
3300005840|Ga0068870_11240912 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005841|Ga0068863_102349219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300005842|Ga0068858_100610235 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300005844|Ga0068862_102314144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300006058|Ga0075432_10261015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
3300006175|Ga0070712_100394680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1141 | Open in IMG/M |
3300006237|Ga0097621_102084683 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300006572|Ga0074051_11769501 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300006845|Ga0075421_100644959 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300006847|Ga0075431_100793038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
3300006871|Ga0075434_101516991 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300006881|Ga0068865_100461529 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300006918|Ga0079216_10561955 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300006954|Ga0079219_10365132 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300009098|Ga0105245_11477280 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300009137|Ga0066709_101042087 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300009147|Ga0114129_10152224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3165 | Open in IMG/M |
3300009147|Ga0114129_10308923 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
3300009162|Ga0075423_13163842 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300009174|Ga0105241_10097971 | All Organisms → cellular organisms → Bacteria | 2326 | Open in IMG/M |
3300009174|Ga0105241_12699511 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300009553|Ga0105249_11360258 | Not Available | 782 | Open in IMG/M |
3300010037|Ga0126304_10932540 | Not Available | 591 | Open in IMG/M |
3300010041|Ga0126312_10254118 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300010041|Ga0126312_11426260 | Not Available | 513 | Open in IMG/M |
3300010166|Ga0126306_11299179 | Not Available | 600 | Open in IMG/M |
3300010301|Ga0134070_10158598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
3300010326|Ga0134065_10283509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300010335|Ga0134063_10594929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
3300010337|Ga0134062_10358240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
3300010362|Ga0126377_11411698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
3300010371|Ga0134125_10455171 | Not Available | 1419 | Open in IMG/M |
3300010375|Ga0105239_10738939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1126 | Open in IMG/M |
3300010399|Ga0134127_10234072 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300010399|Ga0134127_13124563 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300010401|Ga0134121_12408709 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010880|Ga0126350_10953778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
3300011106|Ga0151489_1673373 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300012022|Ga0120191_10072390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 654 | Open in IMG/M |
3300012210|Ga0137378_11417375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
3300012354|Ga0137366_10146484 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300012356|Ga0137371_10147279 | Not Available | 1845 | Open in IMG/M |
3300012356|Ga0137371_10187766 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300012361|Ga0137360_11070707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
3300012532|Ga0137373_10330997 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300012684|Ga0136614_10381067 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300012895|Ga0157309_10169501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300012897|Ga0157285_10160179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
3300012899|Ga0157299_10152591 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012907|Ga0157283_10325916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
3300012911|Ga0157301_10318852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300012914|Ga0157297_10039927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1175 | Open in IMG/M |
3300012915|Ga0157302_10137110 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300012943|Ga0164241_10415255 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300012961|Ga0164302_10951153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300012961|Ga0164302_11652213 | Not Available | 535 | Open in IMG/M |
3300012971|Ga0126369_11404049 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300012975|Ga0134110_10323610 | Not Available | 670 | Open in IMG/M |
3300012989|Ga0164305_12162617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300014150|Ga0134081_10021499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1818 | Open in IMG/M |
3300014157|Ga0134078_10007675 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
3300014301|Ga0075323_1044928 | Not Available | 850 | Open in IMG/M |
3300014497|Ga0182008_10177680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1076 | Open in IMG/M |
3300014745|Ga0157377_10964539 | Not Available | 643 | Open in IMG/M |
3300014745|Ga0157377_11769283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
3300014968|Ga0157379_10780718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
3300015200|Ga0173480_10172387 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300015357|Ga0134072_10035589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1323 | Open in IMG/M |
3300015372|Ga0132256_101310946 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300015373|Ga0132257_101750498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
3300015374|Ga0132255_101588539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 991 | Open in IMG/M |
3300016319|Ga0182033_11199751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
3300017657|Ga0134074_1228869 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300017965|Ga0190266_11090807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300018027|Ga0184605_10266221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
3300018071|Ga0184618_10249752 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300018073|Ga0184624_10441511 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300018077|Ga0184633_10367860 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300018089|Ga0187774_11481141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
3300018422|Ga0190265_11999532 | Not Available | 685 | Open in IMG/M |
3300018465|Ga0190269_10401308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium 70-9 | 848 | Open in IMG/M |
3300018476|Ga0190274_12698721 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300018482|Ga0066669_10545164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1010 | Open in IMG/M |
3300019377|Ga0190264_11158528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300020070|Ga0206356_11223356 | Not Available | 1266 | Open in IMG/M |
3300021344|Ga0193719_10475881 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300021560|Ga0126371_13514882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300022898|Ga0247745_1053922 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300023066|Ga0247793_1013584 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300024055|Ga0247794_10023913 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300025559|Ga0210087_1023151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1264 | Open in IMG/M |
3300025893|Ga0207682_10640655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300025906|Ga0207699_11468750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300025912|Ga0207707_10125148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 2248 | Open in IMG/M |
3300025922|Ga0207646_10757316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 866 | Open in IMG/M |
3300025923|Ga0207681_11702366 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300025944|Ga0207661_11073812 | Not Available | 741 | Open in IMG/M |
3300025945|Ga0207679_11490683 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300025961|Ga0207712_10904580 | Not Available | 780 | Open in IMG/M |
3300025972|Ga0207668_10529680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1018 | Open in IMG/M |
3300026078|Ga0207702_10873980 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300026089|Ga0207648_10190789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1816 | Open in IMG/M |
3300026312|Ga0209153_1119801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 996 | Open in IMG/M |
3300026944|Ga0207570_1009389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 702 | Open in IMG/M |
3300027706|Ga0209581_1016387 | All Organisms → cellular organisms → Bacteria | 4114 | Open in IMG/M |
3300027821|Ga0209811_10111283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 991 | Open in IMG/M |
3300027907|Ga0207428_10253588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1311 | Open in IMG/M |
3300027956|Ga0209820_1229809 | Not Available | 519 | Open in IMG/M |
3300028712|Ga0307285_10184064 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300028719|Ga0307301_10044990 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300028744|Ga0307318_10145224 | Not Available | 813 | Open in IMG/M |
3300028755|Ga0307316_10054625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1345 | Open in IMG/M |
3300028771|Ga0307320_10134128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
3300028784|Ga0307282_10431132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300028796|Ga0307287_10184559 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300028796|Ga0307287_10357612 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300028807|Ga0307305_10395618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300028811|Ga0307292_10015777 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
3300028811|Ga0307292_10080507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1260 | Open in IMG/M |
3300028811|Ga0307292_10462987 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300028812|Ga0247825_11183605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300028814|Ga0307302_10078034 | Not Available | 1566 | Open in IMG/M |
3300028814|Ga0307302_10624692 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300028876|Ga0307286_10361683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Miltoncostaeales → Miltoncostaeaceae → Miltoncostaea → Miltoncostaea marina | 541 | Open in IMG/M |
3300028880|Ga0307300_10089171 | Not Available | 920 | Open in IMG/M |
3300028881|Ga0307277_10587849 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300028884|Ga0307308_10153986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1101 | Open in IMG/M |
3300028884|Ga0307308_10286752 | Not Available | 789 | Open in IMG/M |
3300030336|Ga0247826_11140634 | Not Available | 623 | Open in IMG/M |
3300031199|Ga0307495_10214969 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300031547|Ga0310887_10561875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 695 | Open in IMG/M |
3300031562|Ga0310886_10532977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 713 | Open in IMG/M |
3300031670|Ga0307374_10549350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300031713|Ga0318496_10610338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
3300031720|Ga0307469_11872324 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300031779|Ga0318566_10335446 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300031819|Ga0318568_10591758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
3300031858|Ga0310892_10496996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 812 | Open in IMG/M |
3300031860|Ga0318495_10308642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300031910|Ga0306923_12550901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300031940|Ga0310901_10250210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
3300032001|Ga0306922_12257008 | Not Available | 523 | Open in IMG/M |
3300032180|Ga0307471_101399738 | Not Available | 860 | Open in IMG/M |
3300032892|Ga0335081_11366640 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300033158|Ga0335077_10842822 | Not Available | 929 | Open in IMG/M |
3300033412|Ga0310810_10249588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1953 | Open in IMG/M |
3300033550|Ga0247829_11581818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.05% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.31% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.31% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.16% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.16% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.16% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.16% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.16% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.16% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.16% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.58% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.58% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.58% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.58% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.58% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026944 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0852.00000660 | 2166559005 | Simulated | AVALERVGEHGDLFEPVLHGTQPLGPALKQLRAAA |
INPhiseqgaiiFebDRAFT_1014007661 | 3300000364 | Soil | RDFGRREVLDRIAKHGDLFEPVLRGGXALGPGLRRLRAARPDK* |
F24TB_101676765 | 3300000550 | Soil | WEELGEKVRPRDFGMREALDRVERYGDLFEQTLCGGQALGPALRKLRAASA* |
F14TC_1018081352 | 3300000559 | Soil | RWEELGEKVRPRDFGMREALDRVERYGDLFEQTLCGGQALGPALRKLRAASA* |
JGI10213J12805_103983902 | 3300000858 | Soil | DELTEDVTPRRFGMREALERVEQHGDLFGPVLAGGQALGRALKKLR* |
JGI10214J12806_105289213 | 3300000891 | Soil | MTIDAPNTXXXXPRRFGMREALDRVGRHGDLFEPVLAGGQALGRALRKLR* |
JGI10216J12902_1032883164 | 3300000956 | Soil | DFGMREALDRVERYGDLFEQTLCGGQALGPALRKLRAASA* |
JGI10216J12902_1075243811 | 3300000956 | Soil | DVTPRRFGMREVLERVDQYGDLFEPVLAGGQALGRALNKLS* |
Ga0062593_1008056962 | 3300004114 | Soil | FGRREALQRVEKHGDLFEPVLHGGQALSPALRRLRAGHTGD* |
Ga0062589_1025727191 | 3300004156 | Soil | DVTPRRFGMREALDRVERHGDLFEPVLAGGQALGRALKKNR* |
Ga0062590_1018696382 | 3300004157 | Soil | PRDFGRKEALARIEKHGDLFEPVLRGGQPLGPALRTLRS* |
Ga0063356_1009959282 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LTRKVTPRRFGMRQALERVEKHGDLFAPVLAAGQALGPALRTLL* |
Ga0063356_1055184661 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ELTAKVRPRDFGMREALERVEKHGDLYEPVLKGGQSLAAALRSLR* |
Ga0062592_1011688211 | 3300004480 | Soil | LTPRRFGMREALERVESHGDLFSPVLMGGQALGRASRKLRS* |
Ga0062591_1023722342 | 3300004643 | Soil | RVRPRDFGRKEVLDRVDKHGDLFAPVLRGGQALAPALRRLRAAKPE* |
Ga0070689_1021812392 | 3300005340 | Switchgrass Rhizosphere | RDFGRREALDRVAKHGDLFEPVLKGGQALAPGLRRLRAARPDK* |
Ga0070694_1003405921 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DFGRREALQRVQRHGDLFEPVLRGGQALAPALRRLRASGS* |
Ga0068867_1017134252 | 3300005459 | Miscanthus Rhizosphere | PRDFGRREALARLEKHGDLFEPVLQGGQALAPALRSLRAA* |
Ga0070706_1009756821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPRDFGRREALDRVAKHGDLFEPVLRGGQALGPALRRLRAAEPSK* |
Ga0070698_1000526261 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKKLR* |
Ga0070699_1012286812 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LGEKVRPRDFGRREALARIAKHGDLFEPVLGGGQALGPALRSLREPA* |
Ga0070679_1020771651 | 3300005530 | Corn Rhizosphere | VTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR* |
Ga0070731_102473492 | 3300005538 | Surface Soil | VALERVAARGDLFEPVLHGKQALGPALRELRASA* |
Ga0066707_110011992 | 3300005556 | Soil | ERIRPRDFGRREALDRVAKHGDLFEPVLKGGQALAPALRQLRASASG* |
Ga0070664_1002060043 | 3300005564 | Corn Rhizosphere | RFGMREALERVGRDGDLFEPVLAGGQALGRALRRLPG* |
Ga0066705_104328522 | 3300005569 | Soil | GRREALQRVHRHGDLFEPVLRGGQALAPALRRLRASES* |
Ga0068870_112409122 | 3300005840 | Miscanthus Rhizosphere | EDVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR* |
Ga0068863_1023492191 | 3300005841 | Switchgrass Rhizosphere | RFGMREALERVEQHGDLFEPVLAGGQALGRALRRLPG* |
Ga0068858_1006102351 | 3300005842 | Switchgrass Rhizosphere | DFGMREALARVQKHGDLFEPVLEGGQALGPALRKVRS* |
Ga0068862_1023141442 | 3300005844 | Switchgrass Rhizosphere | FGMREALERVGRDGDLFEPVLAGGQALGRALRRLPG* |
Ga0075432_102610152 | 3300006058 | Populus Rhizosphere | ALDRIEERGDLYEPVLKGGQALAPALKALRRSAQ* |
Ga0070712_1003946801 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DRVAKHGDLFEPVLRGGQALGPALRRLRAAEPSK* |
Ga0097621_1020846831 | 3300006237 | Miscanthus Rhizosphere | RFGMREALERVEQHGDLFEPVLAGGQALGRALRKLR* |
Ga0074051_117695013 | 3300006572 | Soil | EALERFEKHGDLFEPVLKGGQSLGPALRALRAQAE* |
Ga0075421_1006449591 | 3300006845 | Populus Rhizosphere | FGMREALERVEQHGDLFEPVLAGGQALGRALGKLR* |
Ga0075431_1007930382 | 3300006847 | Populus Rhizosphere | FGMREALERVERHGDLFAPVLEGGQALGRALGELR* |
Ga0075434_1015169911 | 3300006871 | Populus Rhizosphere | DFGMRDVLARVERHGDLFAPVLQGGQALNPALRNLRA* |
Ga0068865_1004615293 | 3300006881 | Miscanthus Rhizosphere | RFGMREALERVERHGDLFEPVLAGGQALGRAMKKTS* |
Ga0079216_105619551 | 3300006918 | Agricultural Soil | DLTPRHFGMREALERVERHGDLFAPVLAGGQALGRAMKKSRSSRPGA* |
Ga0079219_103651321 | 3300006954 | Agricultural Soil | DFGRREALERFEKHGDLFEPVLEGGQALGPAFRVLRAE* |
Ga0105245_114772801 | 3300009098 | Miscanthus Rhizosphere | RREALERVEKHGDLFEPVLRGGQALGPALRKLRADD* |
Ga0066709_1010420871 | 3300009137 | Grasslands Soil | DFGRREALARIEKHGDLFEPVLRGGQALGPALRSLRA* |
Ga0114129_101522247 | 3300009147 | Populus Rhizosphere | MREALERVDRHGDLFEPVLKGGQGIARALRQLRE* |
Ga0114129_103089231 | 3300009147 | Populus Rhizosphere | LGEKVRPRDFGRREVLARVQKHGDLFEPVLGGGQAPGPALRRLRAE* |
Ga0075423_131638421 | 3300009162 | Populus Rhizosphere | LHWEELGEEVKPRDFGRREALERIEKYGDMFEPVLQGGQALGPALRRLRAESES* |
Ga0105241_100979711 | 3300009174 | Corn Rhizosphere | FGRREALDRVAKYGDLFEPVLKGGQALAPALGRLRAEKPDK* |
Ga0105241_126995112 | 3300009174 | Corn Rhizosphere | TPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR* |
Ga0105249_113602581 | 3300009553 | Switchgrass Rhizosphere | PRRFGMLEALERVERHGDLFAPVLEGGQALGRALGKLR* |
Ga0126304_109325402 | 3300010037 | Serpentine Soil | RFGMREALERVEEHGDLFEPALAGGQALGRALKKLP* |
Ga0126312_102541182 | 3300010041 | Serpentine Soil | RRFGMREALERVEEHGDLFEPVLAGGQALGPALKKLP* |
Ga0126312_114262603 | 3300010041 | Serpentine Soil | ETLERVERHGDLFEPVLAGSQALGRALRKLRQSRG* |
Ga0126306_112991791 | 3300010166 | Serpentine Soil | IALERVERLGDLFEPVLRGKQALGPALKALRVDAA* |
Ga0134070_101585981 | 3300010301 | Grasslands Soil | ERVRPRDFGRREALARVAKHGDLFEPVLKGGQALGPALRKLRR* |
Ga0134065_102835091 | 3300010326 | Grasslands Soil | PRDFGRREALDRVAKHGDLFEPVLRGGQSLGPALRKLRS* |
Ga0134063_105949291 | 3300010335 | Grasslands Soil | PRRFGMREALERVEQHGDLFEPVLAGGQALGRALKKWRY* |
Ga0134062_103582401 | 3300010337 | Grasslands Soil | LTETVRPRDFGRREALDRLAKHGDLFEPVLRGGQSLGPALRTLRS* |
Ga0126377_114116981 | 3300010362 | Tropical Forest Soil | PRRFGMREALERVERLGDLFEPVLGGGQALGRALRRQPK* |
Ga0134125_104551711 | 3300010371 | Terrestrial Soil | RREVLDRVQKHGDLFEPVLQGGQALGPALRAVRK* |
Ga0105239_107389392 | 3300010375 | Corn Rhizosphere | MREALERVERHGDLFEPVLKGGQGIAKALRQLRAETIQQ* |
Ga0134127_102340721 | 3300010399 | Terrestrial Soil | LDRVAKYGDLFEPVLKGGQALAPALGRLRAEKPDE* |
Ga0134127_131245632 | 3300010399 | Terrestrial Soil | GEKVRPRAFGRKEALARIEKHGDLFEPVLRGGQALGPALRTLRA* |
Ga0134121_124087092 | 3300010401 | Terrestrial Soil | REALDRVAKHGDLFEPVLKGGQALAPGLRRLRAARPDK* |
Ga0126350_109537781 | 3300010880 | Boreal Forest Soil | ALERVERHGDLFEPVLRGGQSIGPALRTLRSSAAST* |
Ga0151489_16733732 | 3300011106 | Soil | EKVRPRDFGMREALARVQKHGDLFEPALEGGQALAPALRKLRA* |
Ga0120191_100723902 | 3300012022 | Terrestrial | ALTPPRLGMREALERVEQHGDLFEPVLAGGQALGRAMKKLR* |
Ga0137378_114173752 | 3300012210 | Vadose Zone Soil | RDFGRREALERAERHGDLFEPVLQGGQALGPALRRLRR* |
Ga0137366_101464841 | 3300012354 | Vadose Zone Soil | PRDFGRREALDRVAKHGDLFEPVLRGGQALAPALRQLRASG* |
Ga0137371_101472791 | 3300012356 | Vadose Zone Soil | RPRDFGLREALQRVERHGDLFEPVLQGGQALAPALRRLRG* |
Ga0137371_101877661 | 3300012356 | Vadose Zone Soil | PRDFGRREALDRVAKHGDLFEPVLRGGQALGPGLRRLRAAKPDK* |
Ga0137360_110707071 | 3300012361 | Vadose Zone Soil | ERVRPRDFGRREALDRIAKHGDLFEPVLRGGQALRPALRRLRAAGPNK* |
Ga0137373_103309971 | 3300012532 | Vadose Zone Soil | DFGMREALERVERHGDLFEPVLKGGQALSPPLRQLRG* |
Ga0136614_103810672 | 3300012684 | Polar Desert Sand | LRWEELTAKVRPRDFGMQEVLARVEQHGDLYEPVLGGGQALGPALRTLR* |
Ga0157309_101695011 | 3300012895 | Soil | RRFGMREALERVGRDGDLFEPVLAGGQALGRALRRLPG* |
Ga0157285_101601792 | 3300012897 | Soil | GRREALARIEKHGDLFEPVLRGGQALGPALRSLRA* |
Ga0157299_101525912 | 3300012899 | Soil | RPRDFGMREALERIERHGDLYEPVLKGGQSLAAALRSLR* |
Ga0157283_103259162 | 3300012907 | Soil | DELPEDVTPRRFGMHEALERVERHGDLFAPVLAGGQALGAALRKLR* |
Ga0157301_103188522 | 3300012911 | Soil | GRREALDRVAKHGDLFEPVLKGGQALAPGLRRLRAARPDK* |
Ga0157297_100399271 | 3300012914 | Soil | GRREALARVEKLGDLFEPVLRGGQSLGPALRHLRAE* |
Ga0157302_101371102 | 3300012915 | Soil | LERVERHGDLFEPVLANGQALGRALKRLRQDAHEITA* |
Ga0164241_104152552 | 3300012943 | Soil | RRFGMREALERVERHGDLFAPVLAGGQALAPALKNVR* |
Ga0164302_109511532 | 3300012961 | Soil | DFGRREALDRVAKHGDLFEPVLRGGQALGPALRRLRAAELSK* |
Ga0164302_116522131 | 3300012961 | Soil | DLTPRRFGMREALERVEQHGDLFGPVLAGGQALGQALKRLR* |
Ga0126369_114040491 | 3300012971 | Tropical Forest Soil | RREALERVERHGDLFEPVLRGGQALSPALRRLRG* |
Ga0134110_103236102 | 3300012975 | Grasslands Soil | FGMREALKRVDKHGDLFEPVLEGGQALGPALRSLRG* |
Ga0164305_121626171 | 3300012989 | Soil | MTPRRFGLREALERVEQHGDLFEPVLAGGQALGPASKR* |
Ga0134081_100214994 | 3300014150 | Grasslands Soil | PRDFGRREALERVAKHGDLFEPVLRGGQALGPALRKLRG* |
Ga0134078_100076751 | 3300014157 | Grasslands Soil | ERVQPRDFGRREALERVAKHGDLFEPVLRGGQALGPALRKLRG* |
Ga0075323_10449281 | 3300014301 | Natural And Restored Wetlands | ELIEEVTPRRFGMRETLEQVAVLAGGQALGRALKKLR* |
Ga0182008_101776802 | 3300014497 | Rhizosphere | GEKVRPRDFGRREALERFEKHGDLFEPVLQGGQALGPAFRVLRAE* |
Ga0157377_109645391 | 3300014745 | Miscanthus Rhizosphere | WDELTDDVTPRRFGMREALERVERHGDLFAPVLEGGQALGRALGKLR* |
Ga0157377_117692832 | 3300014745 | Miscanthus Rhizosphere | EKVRPRDFGRREALERLHLYGDLFEPVLQGGQALSPALRQLRG* |
Ga0157379_107807181 | 3300014968 | Switchgrass Rhizosphere | RREALQRVEKHGDLFAPVLRGGQALGPALRRLRAGT* |
Ga0173480_101723873 | 3300015200 | Soil | RREALARIEKHGDLFEPVLRGGQALGPALRSLRTESSVDVE* |
Ga0134072_100355891 | 3300015357 | Grasslands Soil | ELTESVRPRDFGRHEALDRVAKHGDLFEPVLRGGQALGPGLRRLRAAKPTK* |
Ga0132256_1013109461 | 3300015372 | Arabidopsis Rhizosphere | LTEDVTPRRFGMREALERVERHGDLFAPVLAGGQALGAALRKLR* |
Ga0132257_1017504982 | 3300015373 | Arabidopsis Rhizosphere | GMREALERVGQHGDLFEPVLAGGQALGRASRRLR* |
Ga0132255_1015885392 | 3300015374 | Arabidopsis Rhizosphere | VAPRQFGMREALERVEKHGDPFEPVLAGGQALGRALGKLR* |
Ga0182033_111997511 | 3300016319 | Soil | VRPRDFGTREALQRVELHGDLFEPVLHGGQALGPALRELRRLVA |
Ga0134074_12288692 | 3300017657 | Grasslands Soil | PTRLGMSEALERVKRDGDLFEPVLRGGQTLGPALRALRRGA |
Ga0190266_110908072 | 3300017965 | Soil | TAKVRPRDFGMREALERIERHGDLYEPVLKGGQSLAAALRSLR |
Ga0184605_102662211 | 3300018027 | Groundwater Sediment | RPRDFGRREALDRVAKHGDLFEPVLQGGQALAPALRLLRAANPSK |
Ga0184618_102497521 | 3300018071 | Groundwater Sediment | NVRPRDFGRREALARIEKHGDLFEPVLRGGQALGPALRSLRA |
Ga0184624_104415111 | 3300018073 | Groundwater Sediment | MREALARIEKHGDLFEPVLQGGQALGPALRSLRAA |
Ga0184633_103678601 | 3300018077 | Groundwater Sediment | FGMSEALERIEQHGDLYEPVLRGGQALGSALRSLRKSSVSDAS |
Ga0187774_114811412 | 3300018089 | Tropical Peatland | MVAALDRVARHGDLFEPVLRGGQALGPALRQLRERS |
Ga0190265_119995321 | 3300018422 | Soil | RFTMEAVLKRVEEHGDLFAPVLEGGQALGDALRRIG |
Ga0190269_104013081 | 3300018465 | Soil | RRFGMREALERVEQHGDLFGPVLAGGQALGRALKKLR |
Ga0190274_126987212 | 3300018476 | Soil | RDFGMREALERIERHGDLYEPVLKGGQSLAAALRSLR |
Ga0066669_105451641 | 3300018482 | Grasslands Soil | VGRREGLERVAKHGDLFEPVLRGGQALGPALKTLRR |
Ga0190264_111585282 | 3300019377 | Soil | FGMREALERVEQHGDLFEPVLAGGQALGRALKRLRSAS |
Ga0206356_112233561 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPRDFGRREALQRVQRHGDLFEPVLRGGQALAPALRRLRASGS |
Ga0193719_104758812 | 3300021344 | Soil | FGRREALDRVAKHGDLFEPVLRGGQALGPGLRRLRAARPDK |
Ga0126371_135148821 | 3300021560 | Tropical Forest Soil | RREALQRVEKLGDLFEPVLRRGQALGPALRRLRAD |
Ga0247745_10539221 | 3300022898 | Soil | DVGRKEALARIEKHGDLFEPVLRGGQALGPALRALRA |
Ga0247793_10135841 | 3300023066 | Soil | RWDELTDDVTPRRFGMREALERVERHGDLFAPVLEGGQALGRPLGKLR |
Ga0247794_100239133 | 3300024055 | Soil | GMREALERVERHGDLFEPVLKGGQGIAKALRQLRAETIQQ |
Ga0210087_10231512 | 3300025559 | Natural And Restored Wetlands | EDVTPRRFGMREALDRVERYGDLFEPVLAGGQALGRALKNLR |
Ga0207682_106406552 | 3300025893 | Miscanthus Rhizosphere | KVRPRDFGMREALARVQKHGDLFEPVLEGGQALGPALRKVRS |
Ga0207699_114687501 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAMQRVERYGDLYEPVLRGGQSLGPALRTLQADAGD |
Ga0207707_101251483 | 3300025912 | Corn Rhizosphere | RRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR |
Ga0207646_107573161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QVALDRVAKHGDLFEPVLHAQQALGSALKALRARA |
Ga0207681_117023662 | 3300025923 | Switchgrass Rhizosphere | GRREALHRVAKHGDLFEPVLRGGQALGPSLRRLRAARPDK |
Ga0207661_110738122 | 3300025944 | Corn Rhizosphere | KVRPRDFGRREVLARVQKHGDLFEPVLQGGQALGPALRAVRK |
Ga0207679_114906831 | 3300025945 | Corn Rhizosphere | FGRREVLQRVGKHGDLFEPVLRGGQAVAPALRRLRT |
Ga0207712_109045801 | 3300025961 | Switchgrass Rhizosphere | RRFGMLEALERVERHGDLFAPVLEGGQALGRALGKLR |
Ga0207668_105296803 | 3300025972 | Switchgrass Rhizosphere | FRMREALDRVERHGDLFAPVLAGGQALGAALRKLR |
Ga0207702_108739801 | 3300026078 | Corn Rhizosphere | DVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR |
Ga0207648_101907891 | 3300026089 | Miscanthus Rhizosphere | RFGMREALERVERHGDLFEPVLAGGQALGRAMKKTS |
Ga0209153_11198011 | 3300026312 | Soil | GRHEALDRVAKHGDLFEPVLRGGQALGPGLRRLRAAKPTK |
Ga0207570_10093892 | 3300026944 | Soil | MREALARVQKHGDLFEPVLEGGQALGPALRRLREEDAAG |
Ga0209581_10163876 | 3300027706 | Surface Soil | RDFSMAAALERVAARGDLFAPVLRGGQSLAAALRTLRGAG |
Ga0209811_101112833 | 3300027821 | Surface Soil | ELGEKVRPRDFGRREALERLHLYGDLFEPVLQGGQALSPALRQLRG |
Ga0207428_102535882 | 3300027907 | Populus Rhizosphere | LTEDLTPRRFGMREALERVESHGDLFAPVLMGGQALGRASRKLRS |
Ga0209820_12298091 | 3300027956 | Freshwater Sediment | RFGMREALERVEQHGDLFEPVLAGDQALGRALRKLR |
Ga0307285_101840642 | 3300028712 | Soil | FGRREALDRVQKHGDLFEPVLKGGQALGPALKRLRADRSQESV |
Ga0307301_100449903 | 3300028719 | Soil | MREALARIEKHGDLFEPVLQGGQALGPALRSLRAP |
Ga0307318_101452242 | 3300028744 | Soil | EKVRPRDFGRKEALARIEKHGDLFEPVLRGGQALGPALRTLRS |
Ga0307316_100546253 | 3300028755 | Soil | REALERVARHGDLFEPVLKGGQGLARALRQLRAETI |
Ga0307320_101341281 | 3300028771 | Soil | GMREALERVARHGDLFEPVLKGGQGLARALRQLRAETI |
Ga0307282_104311322 | 3300028784 | Soil | RDFGMREALARVEKHGDLFEPVLRGGQALGPALRKVRA |
Ga0307287_101845591 | 3300028796 | Soil | RDFGRHEALERVEKHGDLFEPVLRGGQALGPALRRLRADD |
Ga0307287_103576121 | 3300028796 | Soil | RREALARLEKHGDLFEPVLQGGQALGPALRSLRAA |
Ga0307305_103956182 | 3300028807 | Soil | SDFGRREALDRVAKHGDLFEPVLRGGQALAPALRQLRSSG |
Ga0307292_100157771 | 3300028811 | Soil | RDFGMREALARIEKHGDLFEPVLQGGQALGPALRSLRAP |
Ga0307292_100805071 | 3300028811 | Soil | LRWDELTEDVTPRRFGMREALKRVEQHGDLFSPALAGGQALGRALKKLR |
Ga0307292_104629871 | 3300028811 | Soil | KVRPRDFGRREALARLEKHGDLFEPVLQGGQALGPALRSLRAA |
Ga0247825_111836052 | 3300028812 | Soil | HFGMREALERVERHGDLFAPVLAGGQALGRAMKKSRSSRPGA |
Ga0307302_100780341 | 3300028814 | Soil | MREALKRVEKHGDLFEPVLQGGQALGPALRKLRSS |
Ga0307302_106246922 | 3300028814 | Soil | RREALERVEKHGDLFEPVLRGGQALGPALRRLRADD |
Ga0307286_103616831 | 3300028876 | Soil | LGEKVRLRDFGRREALARIEKHGDLFEAVLCGGQALGPALRSLRTESSVDVE |
Ga0307300_100891711 | 3300028880 | Soil | VRPRDFGRKEALARIEKHGDLFEPVLRGGQALGPALRTLRS |
Ga0307277_105878492 | 3300028881 | Soil | RDFGRREALDRVAKHGDLFEPVLRGGQPLGPGLRRLRAAKPDK |
Ga0307308_101539862 | 3300028884 | Soil | GRREALARVEKHGDLFEPVLQGGQALGPALRALRK |
Ga0307308_102867522 | 3300028884 | Soil | DFGMREALASVEKHGDLFEPVLQGGQALGPALRQLRT |
Ga0247826_111406342 | 3300030336 | Soil | DELKEDVTPRGFGLREAVERVEQHGDLSEPVLADGQALGRALKKLR |
Ga0307495_102149692 | 3300031199 | Soil | DFGRREALQRVEKHGDLFEPVLRGGQALGPALRRLRT |
Ga0310887_105618751 | 3300031547 | Soil | RFGMREAIDRVERHGDLFEPVLAGGQALGRALKKAR |
Ga0310886_105329771 | 3300031562 | Soil | DFGRREALDRVAKYGDLFEPVLKGGQALAPALGRLRAEKPDK |
Ga0307374_105493501 | 3300031670 | Soil | VAVDRIAALGDLFEPVLHGGQALGPALRELRGRGG |
Ga0318496_106103381 | 3300031713 | Soil | EGWTPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKTVR |
Ga0307469_118723241 | 3300031720 | Hardwood Forest Soil | RDFGRREALDRVATHGDLFEPVLRGGQALGPALRRLRAAEPSK |
Ga0318566_103354461 | 3300031779 | Soil | FGMREVLERIEQHGDLFEPVLAGGQALGRALKKWR |
Ga0318568_105917583 | 3300031819 | Soil | GWTPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKKSW |
Ga0310892_104969961 | 3300031858 | Soil | TPRRFGMREALDRVERHGDLFEPVLSAGQALGRALKKIR |
Ga0318495_103086422 | 3300031860 | Soil | VRPRDFGRREALQRVEKLGDLFEPVLRGGQALGPALRRLRAD |
Ga0306923_125509012 | 3300031910 | Soil | YSMEVALERVELHGDLFEPVLHATQSLAPALKSLR |
Ga0310901_102502101 | 3300031940 | Soil | PRRFGMREALERVERHGDLFEPALAGGQALGGALKKTS |
Ga0306922_122570081 | 3300032001 | Soil | TPRRFGMREALERVDQHGDLFAPVLAGGQALGRALKKSW |
Ga0307471_1013997381 | 3300032180 | Hardwood Forest Soil | ERVRPRDFGRREALDRVAKHGDLFAPVLRGGQALGPALRRLRAAEPSK |
Ga0335081_113666401 | 3300032892 | Soil | LGRVQRHGDLFAPVVKGGPALGPPLRALRAQSEQT |
Ga0335077_108428221 | 3300033158 | Soil | VRPRDFPMAVALERVEGLGDLFAPVLEGGQALGPALRELRRSRTA |
Ga0310810_102495883 | 3300033412 | Soil | ELMEDVTPRRFGMRVALERVEEHGDLFAPVLAGGQALGAALRKLR |
Ga0247829_115818181 | 3300033550 | Soil | RREALDRVAKHGDLFEPVLKGGQALAPALRQLRASASG |
⦗Top⦘ |