Basic Information | |
---|---|
Family ID | F035094 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 173 |
Average Sequence Length | 40 residues |
Representative Sequence | KRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV |
Number of Associated Samples | 132 |
Number of Associated Scaffolds | 173 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 13.17 % |
% of genes near scaffold ends (potentially truncated) | 95.38 % |
% of genes from short scaffolds (< 2000 bps) | 91.33 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.017 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (54.913 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.197 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.133 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 173 Family Scaffolds |
---|---|---|
PF13340 | DUF4096 | 75.14 |
PF01609 | DDE_Tnp_1 | 2.31 |
PF07883 | Cupin_2 | 1.16 |
PF00072 | Response_reg | 0.58 |
PF00891 | Methyltransf_2 | 0.58 |
PF13561 | adh_short_C2 | 0.58 |
PF01475 | FUR | 0.58 |
PF00903 | Glyoxalase | 0.58 |
PF13459 | Fer4_15 | 0.58 |
PF13586 | DDE_Tnp_1_2 | 0.58 |
PF00486 | Trans_reg_C | 0.58 |
PF03237 | Terminase_6N | 0.58 |
PF00872 | Transposase_mut | 0.58 |
PF02743 | dCache_1 | 0.58 |
PF13419 | HAD_2 | 0.58 |
PF13692 | Glyco_trans_1_4 | 0.58 |
PF04828 | GFA | 0.58 |
PF13181 | TPR_8 | 0.58 |
PF04551 | GcpE | 0.58 |
PF13683 | rve_3 | 0.58 |
PF03458 | Gly_transporter | 0.58 |
COG ID | Name | Functional Category | % Frequency in 173 Family Scaffolds |
---|---|---|---|
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.31 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.31 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.31 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.31 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.31 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.31 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.58 |
COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.58 |
COG2860 | Uncharacterized membrane protein YeiH | Function unknown [S] | 0.58 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.58 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.58 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.02 % |
Unclassified | root | N/A | 10.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000733|JGI12408J11912_1007439 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300001141|JGI12638J13249_101081 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300001154|JGI12636J13339_1043925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300001636|JGI20236J16297_100712 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300001649|JGI20272J16309_100358 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300001650|JGI20280J16326_100326 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300001658|JGI20282J16327_100317 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300001867|JGI12627J18819_10402717 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
3300001867|JGI12627J18819_10472342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300002886|JGI25612J43240_1020104 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300005602|Ga0070762_10339247 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300006050|Ga0075028_100451072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
3300006163|Ga0070715_10624761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300006172|Ga0075018_10101598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
3300006172|Ga0075018_10697267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300006175|Ga0070712_101398197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
3300006237|Ga0097621_101769940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300006354|Ga0075021_11036902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
3300006606|Ga0074062_12707686 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300009792|Ga0126374_10186313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
3300010301|Ga0134070_10162924 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300010320|Ga0134109_10080455 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300016319|Ga0182033_10481643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1063 | Open in IMG/M |
3300016357|Ga0182032_11752620 | Not Available | 542 | Open in IMG/M |
3300016371|Ga0182034_10326279 | Not Available | 1239 | Open in IMG/M |
3300019789|Ga0137408_1290101 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300020199|Ga0179592_10070766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1596 | Open in IMG/M |
3300020199|Ga0179592_10179865 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300020579|Ga0210407_10394683 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300020581|Ga0210399_10850603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 742 | Open in IMG/M |
3300020583|Ga0210401_10591091 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300021088|Ga0210404_10195054 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300021168|Ga0210406_10489372 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300021170|Ga0210400_10531396 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300021170|Ga0210400_10531732 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300021170|Ga0210400_10542543 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300021170|Ga0210400_11553232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300021178|Ga0210408_10460078 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300021178|Ga0210408_10710046 | Not Available | 791 | Open in IMG/M |
3300021180|Ga0210396_10551248 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300021181|Ga0210388_10573964 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300021401|Ga0210393_10217314 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
3300021402|Ga0210385_10309002 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300021406|Ga0210386_10546069 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300021407|Ga0210383_10604184 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300021407|Ga0210383_10714687 | Not Available | 861 | Open in IMG/M |
3300021420|Ga0210394_10985451 | Not Available | 731 | Open in IMG/M |
3300021420|Ga0210394_11094151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
3300021474|Ga0210390_10534064 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300021474|Ga0210390_11528524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300021475|Ga0210392_10405029 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300021476|Ga0187846_10182809 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300021478|Ga0210402_10635248 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300021479|Ga0210410_10604647 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300021559|Ga0210409_10952689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300024049|Ga0233359_1000531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2807 | Open in IMG/M |
3300025916|Ga0207663_10468368 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300026309|Ga0209055_1123449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 976 | Open in IMG/M |
3300026335|Ga0209804_1151852 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300026355|Ga0257149_1018981 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300026369|Ga0257152_1018416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
3300026376|Ga0257167_1023714 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300026467|Ga0257154_1001655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2592 | Open in IMG/M |
3300026475|Ga0257147_1013743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
3300026481|Ga0257155_1019941 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300026497|Ga0257164_1058053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300026514|Ga0257168_1045445 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300026514|Ga0257168_1094543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
3300026523|Ga0209808_1125571 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300026847|Ga0207802_1018628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300026909|Ga0207858_1011198 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300027014|Ga0207815_1014506 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300027024|Ga0207819_1032537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
3300027071|Ga0209214_1013355 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300027076|Ga0208860_1007606 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300027105|Ga0207944_1007042 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300027297|Ga0208241_1004885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1726 | Open in IMG/M |
3300027583|Ga0209527_1033684 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300027645|Ga0209117_1066083 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300027655|Ga0209388_1075135 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300027680|Ga0207826_1050734 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300027903|Ga0209488_10303938 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300027915|Ga0209069_10176604 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300028799|Ga0307284_10251697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
3300028906|Ga0308309_10413859 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300030847|Ga0075405_11953753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1304 | Open in IMG/M |
3300031231|Ga0170824_109044494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2118 | Open in IMG/M |
3300031231|Ga0170824_110746749 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300031446|Ga0170820_16159811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
3300031543|Ga0318516_10219003 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300031561|Ga0318528_10206983 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300031561|Ga0318528_10489426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300031668|Ga0318542_10149906 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300031668|Ga0318542_10579288 | Not Available | 585 | Open in IMG/M |
3300031681|Ga0318572_10198969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1169 | Open in IMG/M |
3300031682|Ga0318560_10233904 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300031682|Ga0318560_10417290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300031715|Ga0307476_10074096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2366 | Open in IMG/M |
3300031715|Ga0307476_10391839 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300031723|Ga0318493_10240121 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300031723|Ga0318493_10474788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300031724|Ga0318500_10205656 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300031747|Ga0318502_10211093 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300031747|Ga0318502_10236672 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300031748|Ga0318492_10521916 | Not Available | 631 | Open in IMG/M |
3300031753|Ga0307477_10181937 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300031753|Ga0307477_10366444 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300031768|Ga0318509_10252241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis → Nitrobacter hamburgensis X14 | 985 | Open in IMG/M |
3300031770|Ga0318521_10141581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1359 | Open in IMG/M |
3300031770|Ga0318521_10581369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
3300031778|Ga0318498_10187493 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300031781|Ga0318547_10606210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 679 | Open in IMG/M |
3300031782|Ga0318552_10383198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
3300031793|Ga0318548_10189681 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300031793|Ga0318548_10450057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 630 | Open in IMG/M |
3300031798|Ga0318523_10355277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
3300031821|Ga0318567_10250572 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300031821|Ga0318567_10272815 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300031833|Ga0310917_10183583 | Not Available | 1394 | Open in IMG/M |
3300031833|Ga0310917_10665921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300031859|Ga0318527_10121485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
3300031880|Ga0318544_10074593 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300031880|Ga0318544_10135469 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300031880|Ga0318544_10239756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300031890|Ga0306925_10741098 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300031893|Ga0318536_10191470 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
3300031896|Ga0318551_10026660 | All Organisms → cellular organisms → Bacteria | 2754 | Open in IMG/M |
3300031896|Ga0318551_10227602 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300031897|Ga0318520_10400996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
3300031910|Ga0306923_10186145 | Not Available | 2372 | Open in IMG/M |
3300031910|Ga0306923_10832453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila | 1016 | Open in IMG/M |
3300031910|Ga0306923_11358729 | Not Available | 750 | Open in IMG/M |
3300031910|Ga0306923_11499567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300031912|Ga0306921_10326299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1796 | Open in IMG/M |
3300031912|Ga0306921_11703504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 681 | Open in IMG/M |
3300031942|Ga0310916_10485469 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300031945|Ga0310913_10183697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1456 | Open in IMG/M |
3300031945|Ga0310913_10429634 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300031946|Ga0310910_10088487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2275 | Open in IMG/M |
3300031947|Ga0310909_10142822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1962 | Open in IMG/M |
3300031947|Ga0310909_10461162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1066 | Open in IMG/M |
3300031947|Ga0310909_10523437 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300031954|Ga0306926_10016778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8308 | Open in IMG/M |
3300031954|Ga0306926_12273824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
3300032001|Ga0306922_10966429 | Not Available | 881 | Open in IMG/M |
3300032001|Ga0306922_11789185 | Not Available | 605 | Open in IMG/M |
3300032010|Ga0318569_10205789 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300032025|Ga0318507_10171774 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300032035|Ga0310911_10213246 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300032041|Ga0318549_10123991 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300032043|Ga0318556_10230424 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300032043|Ga0318556_10396995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
3300032054|Ga0318570_10302207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300032065|Ga0318513_10211190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 936 | Open in IMG/M |
3300032068|Ga0318553_10216013 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300032090|Ga0318518_10053687 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
3300032090|Ga0318518_10213949 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300032090|Ga0318518_10435812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300032180|Ga0307471_101035206 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300032205|Ga0307472_101923950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
3300032261|Ga0306920_100773891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1410 | Open in IMG/M |
3300032515|Ga0348332_12492034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
3300032770|Ga0335085_11183661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
3300033289|Ga0310914_10041100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3766 | Open in IMG/M |
3300033289|Ga0310914_11844349 | Not Available | 509 | Open in IMG/M |
3300033290|Ga0318519_10299947 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300033290|Ga0318519_10498085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 54.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.47% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.73% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.58% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.58% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.58% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000733 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 | Environmental | Open in IMG/M |
3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001636 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 | Environmental | Open in IMG/M |
3300001649 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 | Environmental | Open in IMG/M |
3300001650 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 | Environmental | Open in IMG/M |
3300001658 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12408J11912_10074392 | 3300000733 | Tropical Forest Soil | KRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV* |
JGI12638J13249_1010812 | 3300001141 | Forest Soil | RLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSPEV* |
JGI12636J13339_10439251 | 3300001154 | Forest Soil | KRLTENELSDFSRLWHDGCGEAIIEAQNVDRNHSA* |
JGI20236J16297_1007122 | 3300001636 | Forest Soil | LTENELSDFSRLWHDGCVKAITEAQDVDRNHSAQV* |
JGI20272J16309_1003581 | 3300001649 | Forest Soil | AKWLTENELSDLSRLWHDGCVKATIETQDVDRNHSSEV* |
JGI20280J16326_1003262 | 3300001650 | Forest Soil | PRGPAVEKLFHETLKRLTENELIDFSRLWHDGCVKAIIEAQDVDRNHSAKV* |
JGI20282J16327_1003171 | 3300001658 | Forest Soil | WLTENELSDLSRLWHDGCVKATIETQDVDRNHSSEV* |
JGI12627J18819_104027172 | 3300001867 | Forest Soil | KRLTENELSDFSRLWHDGCVDAIIEAQDVDRNHSTQV* |
JGI12627J18819_104723421 | 3300001867 | Forest Soil | RLTENELSDFSYLWHDGCAEAITEAQDVDRNHSAEV* |
JGI25612J43240_10201041 | 3300002886 | Grasslands Soil | SSIAGAEKSKRPTENELSDFSRLWHDGCGKAIIGAQDVDRNHSPEV* |
Ga0070762_103392471 | 3300005602 | Soil | RLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAKV* |
Ga0075028_1004510721 | 3300006050 | Watersheds | RLTENELSDFSRLWHDGCSEAIIEAQDVDRNHSPEV* |
Ga0070715_106247612 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVNYIESTKRLTENELSDFRRLWHHGCGETIIEAQDVDQNRSPEV* |
Ga0075018_101015983 | 3300006172 | Watersheds | SKRLTENELSDFSRLWHDGCSEAIIEAQDVDRNHSPEV* |
Ga0075018_106972672 | 3300006172 | Watersheds | PKRLTENELSDFSRLWHDGCVETITEAQDVDRNHSAEV* |
Ga0070712_1013981972 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TKRLTENELSDFSRLWHDGCVDAIIEAQDVDRNHSTQV* |
Ga0097621_1017699401 | 3300006237 | Miscanthus Rhizosphere | RLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV* |
Ga0075021_110369022 | 3300006354 | Watersheds | TENELSDFSRLWHDGCVKAIIEAQDVDRNHSAKV* |
Ga0074062_127076862 | 3300006606 | Soil | KRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAKV* |
Ga0126374_101863133 | 3300009792 | Tropical Forest Soil | VQESIFQRLTENELSDFNWLCDDGCGEAIIETQYVDR |
Ga0134070_101629242 | 3300010301 | Grasslands Soil | SLTENELSDFQSVWHDGCGQEIIEAQNVERNHSAEV* |
Ga0134109_100804551 | 3300010320 | Grasslands Soil | RLTENELSDFSRLWHDGCDKAIIEAQDVDRNHSPKV* |
Ga0137361_109986422 | 3300012362 | Vadose Zone Soil | MLAFGSGSKRLTENELSDFSRLWHDGCVEAIIEAQDVD |
Ga0137361_113022451 | 3300012362 | Vadose Zone Soil | MISGRVREPASKRLTENELSDFSRLWHDGCVEAITEAQDVDRNHS |
Ga0137390_100976201 | 3300012363 | Vadose Zone Soil | MGIPRLEILSKRLTENELSDFSRLWHDGCVEAIIEAQDVDRNHSTQ |
Ga0182033_104816431 | 3300016319 | Soil | VRARFVRPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSA |
Ga0182032_117526201 | 3300016357 | Soil | MPKRLTENELSDFSRLWHGGCGETIIEAQHVDRNHSPE |
Ga0182034_103262791 | 3300016371 | Soil | MTPKRLTENELSDFSRLCHDGCGKTIIEAQDVDQNHSA |
Ga0137408_12901011 | 3300019789 | Vadose Zone Soil | RPTENELKRPTENELSDFSRLCHDGCVKAITEAQDVDRNHSAEV |
Ga0179592_100707663 | 3300020199 | Vadose Zone Soil | CNLFPAPKRLTENELSDFSRLWHDGCVEAIIEAQDVDRNHSTQV |
Ga0179592_101798652 | 3300020199 | Vadose Zone Soil | KRLTENELSDFSRLWDDGCVKAIIEAQNVDRNHSA |
Ga0210407_103946831 | 3300020579 | Soil | RLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0210399_108506031 | 3300020581 | Soil | LIESSKRLTENEFIDFSRLWHDGCVKAIIEAQDVDR |
Ga0210401_105910911 | 3300020583 | Soil | SCRANRPKWLTENELSDFSRLWHDGCVKATIEAQDVDRNHSSEV |
Ga0210404_101950542 | 3300021088 | Soil | ESGELSVPKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0210406_104893721 | 3300021168 | Soil | MPPKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHPAK |
Ga0210400_105313962 | 3300021170 | Soil | VQSSKRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV |
Ga0210400_105317321 | 3300021170 | Soil | ESRPGKNLAKRLTENELSDFSRLWHDGCGETIIEAQHVDRNHSPEV |
Ga0210400_105425432 | 3300021170 | Soil | VRNLGTEWLTENELSDFSRLWHDGCVKATIEAQDVDRNHSSEV |
Ga0210400_115532321 | 3300021170 | Soil | CLERTKRPTENELSDFSRLWHDGCGKTIIEAQNVD |
Ga0210408_104600781 | 3300021178 | Soil | ARQIRATTKRLTENELSDFSRLWHDGCVEVITEAQDVDRNHSSEV |
Ga0210408_107100461 | 3300021178 | Soil | MSAKWLTENELSDFSRLWHDGCVKATIEAQDVDRN |
Ga0210396_105512481 | 3300021180 | Soil | TELGGAKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0210388_105739642 | 3300021181 | Soil | GSKTVAVKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHPAKV |
Ga0210393_102173143 | 3300021401 | Soil | FSNALFKRLTENELSNFSRLCHDGCSEAIIEAQDVDRNHSPEV |
Ga0210385_103090021 | 3300021402 | Soil | LTENELSDFRRLWHDGCGETIIEAQDVDRNHSPEV |
Ga0210386_105460692 | 3300021406 | Soil | TGMHALAKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0210383_106041841 | 3300021407 | Soil | VQADAAKRLTENELSDFRRLWHDGCGETIIEAQDVDRNHSPEV |
Ga0210383_107146871 | 3300021407 | Soil | MRQAAGAQRLTENEFIDFSRLWHDGCVKAIIEAQDVDRN |
Ga0210394_109854511 | 3300021420 | Soil | MGQLAQWLTENELSDFSRLWHDGCVKETIEAQDVDRNHSSEVSARGPA |
Ga0210394_110941512 | 3300021420 | Soil | PQAAKRLTENELSDFRPLWHDGCGETIIEAQDVDRNHSPEV |
Ga0210390_105340642 | 3300021474 | Soil | TIVFEAKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0210390_115285242 | 3300021474 | Soil | LTENELSNFSRLCHDGCSEAIIEAQDVDRNHSPEV |
Ga0210392_104050291 | 3300021475 | Soil | AVSAERLTENELIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0187846_101828092 | 3300021476 | Biofilm | RLNENELSDFSRLWHGGCGETIIEAQHVDRNHSAEV |
Ga0210402_106352481 | 3300021478 | Soil | YAAANIAKRLTENELSYFNRLWHDGCGKAIIEAQHVD |
Ga0210410_106046472 | 3300021479 | Soil | PQPAEWLTENELSDFSRLWHDGCVKATIEAQDVDRNHSSEV |
Ga0210409_109526891 | 3300021559 | Soil | IRLRTKRLTENELSDFSRLWHDGCVEVITEAQDVDRNHSSEV |
Ga0233359_10005315 | 3300024049 | Soil | TKRLTENELSDFRRLWHDGCGETIIEAQDVDRNHSPEV |
Ga0207663_104683681 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DTKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0209055_11234493 | 3300026309 | Soil | IRAAKRLTENELSDFSRLCHDGCVEAIIEAQDVDRNHSTEV |
Ga0209804_11518522 | 3300026335 | Soil | YQFPSKRLTENEMSDFSRLWHDGCVEAIIESQDVD |
Ga0257149_10189811 | 3300026355 | Soil | PQRLTENELSDFSRLWHDGCVKAIIEAQNVDRNHSAEV |
Ga0257152_10184161 | 3300026369 | Soil | LTENELSDFSRLWHDGCVKAIIEAQNVDRNHSAEV |
Ga0257167_10237141 | 3300026376 | Soil | AKRLTENELSDFSRLWHDGCGEAIIEAQNVDRNHSA |
Ga0257154_10016551 | 3300026467 | Soil | LAQRLTENELSDFRRLWHDGCGETIIEAQDVDRNHSPEV |
Ga0257147_10137431 | 3300026475 | Soil | AGAERLTENELSDFSRLWHDGCVEAIIEAQDVDRNHSTQV |
Ga0257155_10199412 | 3300026481 | Soil | TESQRLTENELSDFSRLWHDGCVKAIIEAQNVDQNHSAEV |
Ga0257164_10580531 | 3300026497 | Soil | THAKRLTENELSDFSRLWHDGCVEEIIKAQDVDRNHSTQV |
Ga0257168_10454452 | 3300026514 | Soil | VDAQRLTENELSDFSRLWHDGCVKAIIEAQNVDRNHSAEV |
Ga0257168_10945431 | 3300026514 | Soil | STKRLTENELSDFSRLWHDGCVEAIIEAQDVDRNHSTQV |
Ga0209808_11255711 | 3300026523 | Soil | LGLTSQRLTENELSDFSRLCHDGCVEAIIESQDVDRNHSTEV |
Ga0179587_108980111 | 3300026557 | Vadose Zone Soil | LTKEAFEAGSKRLTENELSDFSRLWHDGCVEAIIEAQDVD |
Ga0207802_10186281 | 3300026847 | Tropical Forest Soil | KTKRLTENELSDFSRFWHHGCGEAIIEAQDVDGNHSPAV |
Ga0207858_10111982 | 3300026909 | Tropical Forest Soil | HTFPNIPERLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV |
Ga0207815_10145062 | 3300027014 | Tropical Forest Soil | IWVENTVDFSKRLTENELSDFSQLWHGGCGKTIIEAQDVDRNHSTEV |
Ga0207819_10325371 | 3300027024 | Tropical Forest Soil | SKRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV |
Ga0209214_10133551 | 3300027071 | Forest Soil | RLTKNELSDFSQLWQDGCSEAIIEAQNVDRNHSAEV |
Ga0208860_10076062 | 3300027076 | Forest Soil | VAKRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0207944_10070423 | 3300027105 | Forest Soil | LTENELSDFSRLWHDGCVKATIEAQDVDRNHSSEV |
Ga0209215_10147762 | 3300027266 | Forest Soil | TTETFEAGSKRLTENELSDFSRLWHDGCDKAIIEAQDVDRNHSA |
Ga0208241_10048851 | 3300027297 | Forest Soil | KTKRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0209527_10336841 | 3300027583 | Forest Soil | EFLRLTKRLTENELSDFRRLWHDGCGKTIIEAQDVDRNHSPEV |
Ga0209117_10660832 | 3300027645 | Forest Soil | FDPTKRLTENELSDFSRLWHDGCGEAIIEAQNVDRNHSA |
Ga0209388_10751352 | 3300027655 | Vadose Zone Soil | PMAKRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV |
Ga0207826_10507342 | 3300027680 | Tropical Forest Soil | GLLAVADSSVLGEAKRLTENELSDFSRLWHDGCVKAIIEAQDVDRNHSAQV |
Ga0209693_102180162 | 3300027855 | Soil | NPAVILIDQLKWLTENELSDLSRLWHDGCVKATIETQDVDRNHSSEV |
Ga0209488_103039383 | 3300027903 | Vadose Zone Soil | DGMHKRLTENELSDFSRLWHDGCVEQITEAQDVDRNHSSEV |
Ga0209069_101766042 | 3300027915 | Watersheds | FHETERPTENELSDFSMLWHDGCGKTIIEAQDVDRNHSPEV |
Ga0307284_102516971 | 3300028799 | Soil | KYHNPVTKRLTENELSDFSRLCHDGCVEAIIEAQDVDRNHSTEV |
Ga0308309_104138592 | 3300028906 | Soil | LVTPERLTENELSDFRRLWHDGCGETIIEAQDVDRNHSPEV |
Ga0075405_119537533 | 3300030847 | Soil | KRLTENELSDFRLLWHDGCDETIIEAQDVDRNHSPEV |
Ga0170824_1090444941 | 3300031231 | Forest Soil | MPKRLTENELSDFSRLWHDGCGKAIIEIQDVDRNHSPEI |
Ga0170824_1107467491 | 3300031231 | Forest Soil | KRLTENEFIDFSRLWHDGCVKAIIEAQDVDRNHSAKV |
Ga0170820_161598113 | 3300031446 | Forest Soil | ETDITKRPTENELSDFSRLWHDGCVEAITEAQDVDRNHSSEV |
Ga0318516_102190031 | 3300031543 | Soil | SKLAAPKRLTENELSDFSRLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318528_102069831 | 3300031561 | Soil | PSTERCPEKPSENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318528_104894262 | 3300031561 | Soil | SKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318542_101499063 | 3300031668 | Soil | KRLTENELSDFSLLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318542_105792881 | 3300031668 | Soil | VVVSPAELSTERLSENELSDFSWLWHHGCGVAIIEAHHVDRNDAAEV |
Ga0318572_101989693 | 3300031681 | Soil | FVQAERPTENELSDSSRLWHDGCGKTIIEAQDVDRDHSSEI |
Ga0318560_102339043 | 3300031682 | Soil | KRPTENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318560_104172902 | 3300031682 | Soil | LGRFTAKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0307476_100740963 | 3300031715 | Hardwood Forest Soil | MSAFDEITKRLTENELSDFSRLWHDGCVKAITEAQDVDRNHSAQV |
Ga0307476_103918391 | 3300031715 | Hardwood Forest Soil | QSRCQEQDCFTLKRLTENELSDFSRLWHDGCGETIIEAQHVDRNHSPEV |
Ga0318493_102401212 | 3300031723 | Soil | RLTENELSDFSRLWHDGCGKTIIEAQDVEQNHSPEV |
Ga0318493_104747881 | 3300031723 | Soil | KRLTENELSDFSWLCDDGCGEAIIEAQHVDRNHSTEI |
Ga0318500_102056562 | 3300031724 | Soil | SMALIENAKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318502_102110931 | 3300031747 | Soil | MSKRLTENELSYFSWLWHHGCGVAIIEAHHVDRNDAAV |
Ga0318502_102366723 | 3300031747 | Soil | AKRLTENELSDFSLLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318492_105219162 | 3300031748 | Soil | VRARFVRPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0307477_101819371 | 3300031753 | Hardwood Forest Soil | VALDYQGNVVSKRPTENELSDFSRLWHDGCGKTIIEAQNVDQN |
Ga0307477_103664441 | 3300031753 | Hardwood Forest Soil | TTSGIPSAERLTENELSDFSQLWHDGCVEAIIEAQDVDRNHSAEV |
Ga0318509_102522411 | 3300031768 | Soil | AKRPTENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318521_101415811 | 3300031770 | Soil | PKRLTENELSDFSLLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318521_105813691 | 3300031770 | Soil | ALIENAKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318498_101874931 | 3300031778 | Soil | HPKRLTENELSDFSWLCDDGCGKAIIEAQYVDRNHSTEI |
Ga0318547_106062101 | 3300031781 | Soil | LTEDELSDFSRFWHDGCGEAIIEAQDVERNHASEV |
Ga0318552_103831981 | 3300031782 | Soil | FNQDGKRLTENELSGFSQLWHDDCGETIIGAQDVDRNHSPEV |
Ga0318548_101896812 | 3300031793 | Soil | SKRPTENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318548_104500571 | 3300031793 | Soil | KRLTENELSDFSWLCDDGCGKAIIEAQYVDRNHSTEI |
Ga0318523_103552771 | 3300031798 | Soil | PSENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318567_102505722 | 3300031821 | Soil | KRLTENELSDFSRLWHDGCGKTIIEAQDVEQNHSPEV |
Ga0318567_102728151 | 3300031821 | Soil | TGDGVRARFVRPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0310917_101835831 | 3300031833 | Soil | LRNGGLCSQRLTENELSDFSRLWHDGCGKTIIEAQDVEQ |
Ga0310917_106659212 | 3300031833 | Soil | RLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318527_101214851 | 3300031859 | Soil | VSKRLTENELSYFSQLCHNGCGKAIIEAQNVDRNHSPEV |
Ga0318544_100745931 | 3300031880 | Soil | APLKRLTENELSDFSRLWHDGCGKTIIEAQDVEQNHSPEV |
Ga0318544_101354691 | 3300031880 | Soil | LTKRLTENELSDFSWLCDDGCGKAIIEAQYVDRNHSTEI |
Ga0318544_102397561 | 3300031880 | Soil | SDRFEPKKPTENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0306925_107410981 | 3300031890 | Soil | EIARSIYHFPFSKRPTENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318536_101914701 | 3300031893 | Soil | PEKPSENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318551_100266601 | 3300031896 | Soil | GTKRLTENELSDFSRLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318551_102276021 | 3300031896 | Soil | PNYGDEVESYLPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318520_104009963 | 3300031897 | Soil | LEVTENELSDFSQLRDDGCGTEIVEAQNVDRNYSPEA |
Ga0306923_101861451 | 3300031910 | Soil | MTPKRLTENELSDFSRLCHDGCGKTIIEAQDVDQNHSAQV |
Ga0306923_108324531 | 3300031910 | Soil | MGVRWTQRLTENELSDFSRLWHGGCDETIIEAQHVDRNHSPEVSARGT |
Ga0306923_113587291 | 3300031910 | Soil | LAQHRKRLTENELSDFSRLWHDGCGKTIIEAQDVEQ |
Ga0306923_114995672 | 3300031910 | Soil | TKRPTENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0306921_103262991 | 3300031912 | Soil | VRARFVRPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQN |
Ga0306921_117035041 | 3300031912 | Soil | MVYKAPKRLTENELSDFSRLWHGSCGDTIIEAQHVDRNH |
Ga0310916_104854691 | 3300031942 | Soil | LAAPKRLTENELSDFSRLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0310913_101836971 | 3300031945 | Soil | AELSTERLSENELSDFSWLWHHGCGVAIIEAHHVDRNHSAEV |
Ga0310913_104296342 | 3300031945 | Soil | RLTENELSDFSWLCDDGCGKAIIEAQYVDRNHSTEI |
Ga0310910_100884871 | 3300031946 | Soil | MTKRLTENELSDFSRLWHGGCGETIIEAQHVDRNHSPEV |
Ga0310909_101428221 | 3300031947 | Soil | LAQHRKRLTENELSDFSRLWHDGCGKTIIEAQDVEQN |
Ga0310909_104611622 | 3300031947 | Soil | MPKRLTENELSDFSLLWHDGCGKAIIEAQNVEQNY |
Ga0310909_105234372 | 3300031947 | Soil | PLLMPKRLTENELSDFSLLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0306926_1001677813 | 3300031954 | Soil | MTPKRLTENELSDFSRLCHDGCGKTIIEAQDVDQN |
Ga0306926_122738241 | 3300031954 | Soil | MEFSSTLASATSERLTENELSDFSRLWHGGCGETIIEAQHVDRNH |
Ga0306922_109664294 | 3300032001 | Soil | VTKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNH |
Ga0306922_117891853 | 3300032001 | Soil | MTPKRLTENELSDFSRLCHDGCGKTIIEAQDVDQNHS |
Ga0318569_102057892 | 3300032010 | Soil | APKRLTENELSDFSRLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318507_101717742 | 3300032025 | Soil | VNARARYPKRLTENELSDFSWLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0310911_102132461 | 3300032035 | Soil | DPPKRPSENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318549_101239913 | 3300032041 | Soil | STAPLKRLTENELSDFSRLWHDGCGKTIIEAQDVEQNHSPEV |
Ga0318556_102304241 | 3300032043 | Soil | SLSAIRAKRLTENELSDFSRLCQDGCGQTITEVQDVDRNHSAEV |
Ga0318556_103969951 | 3300032043 | Soil | PIWSAKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318570_103022071 | 3300032054 | Soil | LPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
Ga0318513_102111902 | 3300032065 | Soil | PKRLTENELSDFSWLCDDGCGKAIIEAQYVDRNHSTEI |
Ga0318553_102160132 | 3300032068 | Soil | MLFANSASVSRGSKRLTENELSDFSRLWHDGCGKTIIEAQDVEQNHSPEV |
Ga0318518_100536875 | 3300032090 | Soil | PKRLTENELSDFSRLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318518_102139493 | 3300032090 | Soil | KPSENELSDFSRLWHNDCSEAIIEAQDVDRNHSPEV |
Ga0318518_104358121 | 3300032090 | Soil | LSAFGTKRLTENELSDFSRLWHDGCGKTIIEAQDVEQNHSPEV |
Ga0307471_1010352063 | 3300032180 | Hardwood Forest Soil | LRRVLMTKRLTENELSDFSLLWHDGCVETITEAQDVDRNHSAEV |
Ga0307472_1019239501 | 3300032205 | Hardwood Forest Soil | QRLTENELSDFSRLWHDGCVDAIIEAQDVDRNHSTQV |
Ga0306920_1007738914 | 3300032261 | Soil | CGEFLLRKRLTENELSGFSQLWHDDCGETIIGAQDVDRNHSPEV |
Ga0348332_124920341 | 3300032515 | Plant Litter | TQRLTENELSDFSRLWHDGCGKAIIEIQDVDRNHSPEI |
Ga0335085_111836613 | 3300032770 | Soil | PLPPKRLTENELSDFSRLWHDGCVEAIIEAQDVDRNHSAEV |
Ga0310914_100411001 | 3300033289 | Soil | NEIASAAPKRLTENELSDFSRLWHDGCGKAIIEAQNVDQNHSPEV |
Ga0310914_118443491 | 3300033289 | Soil | MAFKRLTENELSDFSRLWHGGCDDTNIEAQHVDRNHSPEVSAN |
Ga0318519_102999471 | 3300033290 | Soil | LDLVNARARYPKRLTENELSDFSWLWHDGCGKTIIEAQNVEQNYSTEV |
Ga0318519_104980851 | 3300033290 | Soil | LEWAIKHQPKRLTENELSDFSRLWHDGCGKTIIEAQDVDQNHSAQV |
⦗Top⦘ |