NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035099

Metagenome / Metatranscriptome Family F035099

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035099
Family Type Metagenome / Metatranscriptome
Number of Sequences 173
Average Sequence Length 39 residues
Representative Sequence ALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Number of Associated Samples 151
Number of Associated Scaffolds 173

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.33 %
% of genes near scaffold ends (potentially truncated) 96.53 %
% of genes from short scaffolds (< 2000 bps) 86.13 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.173 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.387 % of family members)
Environment Ontology (ENVO) Unclassified
(24.855 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.023 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.84%    β-sheet: 0.00%    Coil/Unstructured: 67.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 173 Family Scaffolds
PF00072Response_reg 26.01
PF00158Sigma54_activat 11.56
PF02954HTH_8 4.05
PF13426PAS_9 3.47
PF00480ROK 2.89
PF00753Lactamase_B 2.89
PF10996Beta-Casp 2.31
PF08837DUF1810 1.73
PF00581Rhodanese 1.16
PF01850PIN 1.16
PF00441Acyl-CoA_dh_1 1.16
PF01266DAO 1.16
PF00989PAS 0.58
PF01156IU_nuc_hydro 0.58
PF01966HD 0.58
PF02371Transposase_20 0.58
PF05163DinB 0.58
PF13714PEP_mutase 0.58
PF08448PAS_4 0.58
PF13650Asp_protease_2 0.58
PF13520AA_permease_2 0.58
PF07297DPM2 0.58
PF00069Pkinase 0.58
PF07883Cupin_2 0.58
PF104171-cysPrx_C 0.58
PF00459Inositol_P 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 173 Family Scaffolds
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 5.78
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.31
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 1.73
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.16
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.58
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.58
COG3547TransposaseMobilome: prophages, transposons [X] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.75 %
UnclassifiedrootN/A9.25 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908007|FWIRElOz_GKZ9IRQ02GAE5IAll Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae512Open in IMG/M
2170459022|GZEQPF102HCLIUAll Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300001593|JGI12635J15846_10283657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1045Open in IMG/M
3300001686|C688J18823_10343532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium973Open in IMG/M
3300002245|JGIcombinedJ26739_100294515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1507Open in IMG/M
3300002558|JGI25385J37094_10157506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300004082|Ga0062384_100032084All Organisms → cellular organisms → Bacteria → Acidobacteria2383Open in IMG/M
3300004152|Ga0062386_100817617Not Available768Open in IMG/M
3300004156|Ga0062589_100892246All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300004479|Ga0062595_100284715All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1101Open in IMG/M
3300004635|Ga0062388_101621619Not Available658Open in IMG/M
3300005445|Ga0070708_100052576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3613Open in IMG/M
3300005533|Ga0070734_10505332All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300005541|Ga0070733_10570127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300005561|Ga0066699_10475202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300005713|Ga0066905_101384206All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300005764|Ga0066903_103186138All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300005842|Ga0068858_101424325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7683Open in IMG/M
3300006047|Ga0075024_100470157All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300006163|Ga0070715_10388670All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300006176|Ga0070765_101196929All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300007076|Ga0075435_101873890All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300007265|Ga0099794_10033406All Organisms → cellular organisms → Bacteria → Acidobacteria2419Open in IMG/M
3300009038|Ga0099829_11383529All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300009089|Ga0099828_10406872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1227Open in IMG/M
3300009089|Ga0099828_10552978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1037Open in IMG/M
3300009089|Ga0099828_11925991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7518Open in IMG/M
3300009090|Ga0099827_11820070All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300009174|Ga0105241_12203247All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300009523|Ga0116221_1330316Not Available661Open in IMG/M
3300009645|Ga0116106_1063389Not Available1220Open in IMG/M
3300009759|Ga0116101_1188995All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300010043|Ga0126380_10041113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2426Open in IMG/M
3300010358|Ga0126370_11694957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300010358|Ga0126370_12566929All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300010359|Ga0126376_11415085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300010360|Ga0126372_10854218All Organisms → cellular organisms → Bacteria → Acidobacteria908Open in IMG/M
3300010360|Ga0126372_10941568All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300010361|Ga0126378_11342519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300010366|Ga0126379_10615782All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1173Open in IMG/M
3300010366|Ga0126379_11198363All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300010376|Ga0126381_102631155All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300010396|Ga0134126_11858882All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300010398|Ga0126383_11428612All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300011270|Ga0137391_11453227Not Available531Open in IMG/M
3300011271|Ga0137393_10431205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1130Open in IMG/M
3300012096|Ga0137389_11243820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300012096|Ga0137389_11717251All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300012189|Ga0137388_10763554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium897Open in IMG/M
3300012189|Ga0137388_11800335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300012199|Ga0137383_11189732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300012205|Ga0137362_10190804All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1762Open in IMG/M
3300012205|Ga0137362_11523609Not Available555Open in IMG/M
3300012207|Ga0137381_11405747All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300012361|Ga0137360_10819276All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300012361|Ga0137360_11623158All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300012362|Ga0137361_11747616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300012363|Ga0137390_11898298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300012388|Ga0134031_1021458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300012685|Ga0137397_10024277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4289Open in IMG/M
3300012685|Ga0137397_11061026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300012922|Ga0137394_10265115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1469Open in IMG/M
3300012923|Ga0137359_10897879All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300012923|Ga0137359_11101811All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300012925|Ga0137419_10903634All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300012927|Ga0137416_11592545All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300012929|Ga0137404_11253794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300012930|Ga0137407_10901311All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300012961|Ga0164302_11085286All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300012971|Ga0126369_10327450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1545Open in IMG/M
3300014151|Ga0181539_1105522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300014199|Ga0181535_10728669Not Available563Open in IMG/M
3300015052|Ga0137411_1233914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3644Open in IMG/M
3300015241|Ga0137418_10288816All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300015371|Ga0132258_11134863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1976Open in IMG/M
3300015374|Ga0132255_100097113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3988Open in IMG/M
3300016270|Ga0182036_11077971All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300016294|Ga0182041_10268061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1399Open in IMG/M
3300016387|Ga0182040_11715988Not Available536Open in IMG/M
3300017823|Ga0187818_10199830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales872Open in IMG/M
3300017935|Ga0187848_10406103All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300017959|Ga0187779_10767291All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300017961|Ga0187778_10013164All Organisms → cellular organisms → Bacteria → Acidobacteria5118Open in IMG/M
3300017973|Ga0187780_10006860All Organisms → cellular organisms → Bacteria8465Open in IMG/M
3300017974|Ga0187777_11344923All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300017975|Ga0187782_10208986All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300017975|Ga0187782_11403657All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300018012|Ga0187810_10120674All Organisms → cellular organisms → Bacteria → Acidobacteria1040Open in IMG/M
3300018060|Ga0187765_10788703All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300018062|Ga0187784_10808993Not Available748Open in IMG/M
3300020199|Ga0179592_10476874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300020579|Ga0210407_10033858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3801Open in IMG/M
3300020579|Ga0210407_10083215All Organisms → cellular organisms → Bacteria → Acidobacteria2414Open in IMG/M
3300020580|Ga0210403_10358830All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1192Open in IMG/M
3300020580|Ga0210403_10542035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea943Open in IMG/M
3300020581|Ga0210399_10331788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1270Open in IMG/M
3300020582|Ga0210395_10946030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300021178|Ga0210408_10201773All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300021401|Ga0210393_10002876All Organisms → cellular organisms → Bacteria14031Open in IMG/M
3300021402|Ga0210385_11112763All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300021402|Ga0210385_11463140Not Available522Open in IMG/M
3300021404|Ga0210389_10259629All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300021405|Ga0210387_10052762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3278Open in IMG/M
3300021407|Ga0210383_10355315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1263Open in IMG/M
3300021432|Ga0210384_10602831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300021444|Ga0213878_10248961All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300021474|Ga0210390_10438240All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300021474|Ga0210390_11499482All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300021476|Ga0187846_10153428All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300021559|Ga0210409_10387155Not Available1253Open in IMG/M
3300022840|Ga0224549_1020064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis925Open in IMG/M
3300024347|Ga0179591_1053758All Organisms → cellular organisms → Bacteria → Acidobacteria2642Open in IMG/M
3300025910|Ga0207684_10391806All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300025928|Ga0207700_11804320All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300025939|Ga0207665_10601572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae858Open in IMG/M
3300025961|Ga0207712_10639687All Organisms → cellular organisms → Bacteria → Acidobacteria923Open in IMG/M
3300025961|Ga0207712_11332175All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300026297|Ga0209237_1235636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300026304|Ga0209240_1167028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300026309|Ga0209055_1273474All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300026319|Ga0209647_1241134All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300026322|Ga0209687_1059507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1240Open in IMG/M
3300026335|Ga0209804_1011934All Organisms → cellular organisms → Bacteria4684Open in IMG/M
3300026356|Ga0257150_1073513All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300026361|Ga0257176_1091278All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300026537|Ga0209157_1114679All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300026557|Ga0179587_10505574All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300027024|Ga0207819_1013105All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300027047|Ga0208730_1010543All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium988Open in IMG/M
3300027049|Ga0207806_1043235All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300027313|Ga0207780_1062906All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300027562|Ga0209735_1085182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300027643|Ga0209076_1085136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300027651|Ga0209217_1050342All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300027651|Ga0209217_1052034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1232Open in IMG/M
3300027737|Ga0209038_10213787All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300027787|Ga0209074_10174159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300027787|Ga0209074_10270082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300027795|Ga0209139_10256284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales618Open in IMG/M
3300027875|Ga0209283_10051985All Organisms → cellular organisms → Bacteria2612Open in IMG/M
3300027884|Ga0209275_10006683All Organisms → cellular organisms → Bacteria4832Open in IMG/M
3300027911|Ga0209698_11115966All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300028047|Ga0209526_10390121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium926Open in IMG/M
3300028536|Ga0137415_10077300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3187Open in IMG/M
3300028759|Ga0302224_10028957All Organisms → cellular organisms → Bacteria2042Open in IMG/M
3300028906|Ga0308309_11018271All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300030399|Ga0311353_10938294Not Available729Open in IMG/M
3300031057|Ga0170834_107828319All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031057|Ga0170834_110308553Not Available811Open in IMG/M
3300031231|Ga0170824_125863549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Pyronemataceae → Wilcoxina → Wilcoxina mikolae1295Open in IMG/M
3300031234|Ga0302325_10208560All Organisms → cellular organisms → Bacteria3346Open in IMG/M
3300031236|Ga0302324_101486740All Organisms → cellular organisms → Bacteria → Proteobacteria881Open in IMG/M
3300031446|Ga0170820_12041354Not Available724Open in IMG/M
3300031545|Ga0318541_10257723All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300031682|Ga0318560_10771987All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300031720|Ga0307469_10269799All Organisms → cellular organisms → Bacteria1383Open in IMG/M
3300031720|Ga0307469_10437286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1128Open in IMG/M
3300031753|Ga0307477_10913681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300031754|Ga0307475_10782655All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300031754|Ga0307475_10904950All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300031795|Ga0318557_10471666All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300031820|Ga0307473_10473061All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031821|Ga0318567_10599756All Organisms → cellular organisms → Bacteria → Acidobacteria625Open in IMG/M
3300031890|Ga0306925_10171456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 832338Open in IMG/M
3300031962|Ga0307479_10006932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10431Open in IMG/M
3300032010|Ga0318569_10399441All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300032067|Ga0318524_10614060Not Available573Open in IMG/M
3300032261|Ga0306920_100797187All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300032893|Ga0335069_10379797All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300032897|Ga0335071_10016965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7385Open in IMG/M
3300033158|Ga0335077_10273010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1863Open in IMG/M
3300033977|Ga0314861_0105291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1434Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.05%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.47%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.31%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.73%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.16%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.16%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.16%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.16%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.16%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.16%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.58%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.58%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.58%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.58%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.58%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.58%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908007Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2EnvironmentalOpen in IMG/M
2170459022Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition)EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012388Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027024Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027049Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRElOz_094859002124908007SoilEGAAAGAIAAYLMESGRGHELDLPKGAKLELELERALYLVKE
FA2_070155302170459022Grass SoilLEAYLMEAGRGQEIELPKGVKLELELERTLYLVRE
JGI12635J15846_1028365723300001593Forest SoilEGAAAAAIAAYLIESGRGHEIDLPKGAKLELELERALYLLKE*
C688J18823_1034353233300001686SoilAIAAYLMESGRGHELDLPKGAKLELELERALYLVK*
JGIcombinedJ26739_10029451523300002245Forest SoilIAAYLMESGRGHEIDLPKGAKLELELERSLYLLKE*
JGI25385J37094_1015750623300002558Grasslands SoilTAEGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0062384_10003208443300004082Bog Forest SoilEAAAMAAFAAYLAESGRGHEISFQHGVKFELELERALYLLKE*
Ga0062386_10081761713300004152Bog Forest SoilALCALEAYLAEAGRGQELDMPKGAKLELELGRALYLVKE*
Ga0062589_10089224613300004156SoilAVAALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE*
Ga0062595_10028471513300004479SoilAAVAALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE*
Ga0062388_10162161923300004635Bog Forest SoilAMAAFAAYLAESGRGHELNFERGVKFELELARALYLLKE*
Ga0070708_10005257613300005445Corn, Switchgrass And Miscanthus RhizosphereGAAEAALAAYLMEAGRGHELQLVKGSKLEIELDRALYLLRE*
Ga0070734_1050533223300005533Surface SoilAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN*
Ga0070733_1057012723300005541Surface SoilMAALTAYLIESGRGHELELPKGVKLELELERALYLVKE*
Ga0066699_1047520213300005561SoilVTRAAESALAAYLMESGRGHEIVLPKGAKLELELERALYLVKE*
Ga0066905_10138420623300005713Tropical Forest SoilAVGALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE*
Ga0066903_10318613813300005764Tropical Forest SoilLEAYLMESGRGHEMNLPKGAKLELELERALYLVKD*
Ga0068858_10142432513300005842Switchgrass RhizosphereEAAEYAAVAALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE*
Ga0075024_10047015723300006047WatershedsGAAMGALEAYLMEAGRGQELNLPKGAKLELELERALYLVRE*
Ga0070715_1038867023300006163Corn, Switchgrass And Miscanthus RhizosphereEGAALGALAAYLVEAGRGQEIELPKGSKLELELERALYLVRE*
Ga0070765_10119692933300006176SoilEVAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD*
Ga0075435_10187389013300007076Populus RhizosphereEYAAVAALEAYLMEAGRGHEMNLPKGSKLELELERNLYLVKE*
Ga0099794_1003340643300007265Vadose Zone SoilGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0099829_1138352913300009038Vadose Zone SoilGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0099828_1040687213300009089Vadose Zone SoilALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0099828_1055297833300009089Vadose Zone SoilLGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0099828_1192599123300009089Vadose Zone SoilEGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0099827_1182007023300009090Vadose Zone SoilLGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0105241_1220324713300009174Corn RhizosphereVAALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE*
Ga0116221_133031613300009523Peatlands SoilEAYLMEAGRGQELDLAKGAKLELELGRALYLVKE*
Ga0116106_106338913300009645PeatlandLGALEAYLMEAGRGQELDLAKGAKLELELGRALYLVKE*
Ga0116101_118899523300009759PeatlandEGAAMGALTAYLAEIGRGQEMNLPKGTKLELELERALYLVKE*
Ga0126380_1004111313300010043Tropical Forest SoilTKAAEAALAAYLMESGRGHEIVLPKGSKLELELERALYLVKE*
Ga0126370_1169495713300010358Tropical Forest SoilITAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0126370_1256692923300010358Tropical Forest SoilTKAAESALAAYLMESGRGHEIILPKGAKLELELERALYLVKE*
Ga0126376_1141508513300010359Tropical Forest SoilAALGALTAYLMESGRGHELNLPKGAKLELELERALYLLKE*
Ga0126372_1085421823300010360Tropical Forest SoilEAYLMEAGRGHELQLPRGAKLELELERALYLVKP*
Ga0126372_1094156823300010360Tropical Forest SoilEAAAIAALEAYLMEAGRGEELDLPKGTKLELELGRALYLVKE*
Ga0126378_1134251923300010361Tropical Forest SoilAALGAITAYLMESGRGHELNLPKGAKLELELERALYLVKD*
Ga0126379_1061578223300010366Tropical Forest SoilGAALAALEAYLTEAGRGQEIELARGTKLELELERSLYLIRE*
Ga0126379_1119836313300010366Tropical Forest SoilAAVAALEAYLMESGRGHEMNLPKGAKLELELERALYLVKD*
Ga0126381_10263115513300010376Tropical Forest SoilAIAAYLMESGRGHELDLPKGAKLELELERALYLVKE*
Ga0134126_1185888213300010396Terrestrial SoilGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN*
Ga0126383_1142861213300010398Tropical Forest SoilALEAYLMESGRGQEIDLPHGAKLELELERALYLVKD*
Ga0137391_1145322713300011270Vadose Zone SoilEAAEGAAEAALAAYLMEAGRGHELELVKGSKLEIELERALYLLRE*
Ga0137393_1043120513300011271Vadose Zone SoilLGALTAYLMESGRGQELNLPKGAKLELELERALYLVKE*
Ga0137389_1124382013300012096Vadose Zone SoilGAAVGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE*
Ga0137389_1171725123300012096Vadose Zone SoilAAYLMESGRGHEIDLPKGAKLELELERALYLLKE*
Ga0137388_1076355423300012189Vadose Zone SoilEGAAVGASAAYLMESGRGHEIDLPKGAKLELELERSLYLLKE*
Ga0137388_1180033523300012189Vadose Zone SoilGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0137383_1118973213300012199Vadose Zone SoilIGAITAYLMESGRGHELNLPKGAKLELELERSLYLVKE*
Ga0137362_1019080423300012205Vadose Zone SoilAALGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0137362_1152360923300012205Vadose Zone SoilAAEAALAAYLMEAGRGHELELVKGSKLEIELERALYLLRE*
Ga0137381_1140574713300012207Vadose Zone SoilGAAEAALAAYLMEAGRGHELQLPKGAKLEIELERALYLVKE*
Ga0137360_1081927623300012361Vadose Zone SoilAAYLMEAGRGHELELVKGSKLEIELDRALYLLRE*
Ga0137360_1162315823300012361Vadose Zone SoilYLMESGRGHELNLPKGAKLELELERALYLVKEKVCDGYS*
Ga0137361_1174761623300012362Vadose Zone SoilAAAAALAAYLMESGRGHEIDLPKGAKLELELERALYLLKE*
Ga0137390_1189829823300012363Vadose Zone SoilAITAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0134031_102145823300012388Grasslands SoilAEGAALGALTAYLMEVGRGHELNLPKGAKLELELERALYLVKE*
Ga0137397_1002427713300012685Vadose Zone SoilSAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE*
Ga0137397_1106102613300012685Vadose Zone SoilLAAYLMESGRGHEIDLPKGAKLELELERALYLLKE*
Ga0137394_1026511513300012922Vadose Zone SoilRAAESALAAYLLETGRGHEIVLPKGAKLELELERALYLVKE*
Ga0137359_1089787923300012923Vadose Zone SoilEAALAAYLMEAGRGHESQLAKGSKLEIELERALYLLKE*
Ga0137359_1110181123300012923Vadose Zone SoilAEGAAVGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE*
Ga0137419_1090363413300012925Vadose Zone SoilGALAGAIAAYLMESGRGHELNLLKGAKLELELERALYLVKE*
Ga0137416_1159254513300012927Vadose Zone SoilLTAYLMESGRGRELNLPKGAKLELELERALYLVKE*
Ga0137404_1125379433300012929Vadose Zone SoilAEAALAAYLMEAGRGHELQLPKGSKLEIELERALYLVKE*
Ga0137407_1090131113300012930Vadose Zone SoilGAALGALEAYLMDAGRGQEIDLPKGAKLELELERALYLTRE*
Ga0164302_1108528633300012961SoilIAAYLMESGRGHELDLPKGAKLELELERALYLLKE*
Ga0126369_1032745013300012971Tropical Forest SoilEAALAAYLMETGRGHEIDLPKGAKLELELERALYLVRD*
Ga0181539_110552243300014151BogEAYLAEAGRGQELDLPKGAKLELELGRALYLVKE*
Ga0181535_1072866913300014199BogAALGALEAYLAEAGRGQELDLPKGSKVELELGRALYLVKE*
Ga0137411_123391413300015052Vadose Zone SoilAVTRAAEAALAAYLTESGRGHEIVLPKGAKLELELERALYLVKE*
Ga0137418_1028881623300015241Vadose Zone SoilGAAEAALAAYLMEAGRGHELELVRGSKLEIELERTLYLLRE*
Ga0132258_1113486333300015371Arabidopsis RhizosphereAAYLMETGRGHELDLPKGAKLELELERALYLVKE*
Ga0132255_10009711313300015374Arabidopsis RhizosphereALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE*
Ga0182036_1107797123300016270SoilGAALGALQAYLTEAGRGQELDLPKGAKLELELERALYLVRE
Ga0182041_1026806123300016294SoilLGALEAYLLETGRGQELDLPKGAKLELELERTLYLVKP
Ga0182040_1171598813300016387SoilAAEGAAMGALEAYLMEAGRGQELELPKGAKLELELERALYLVKE
Ga0187818_1019983013300017823Freshwater SedimentEGAALAALTAYLAESGRGHELNLPKGAKLELELERALYLVKE
Ga0187848_1040610313300017935PeatlandALCALEAYLAEAGRGQELNLPKGAKLELELGRALYLVKE
Ga0187779_1076729123300017959Tropical PeatlandLEAYLREAGRGEELNLPRGAKLELELERALYLVKE
Ga0187778_1001316413300017961Tropical PeatlandIGALEAYLMEAGRGQELDLPKGAKMELELERALYLVKD
Ga0187780_1000686013300017973Tropical PeatlandAAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0187777_1134492313300017974Tropical PeatlandEGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0187782_1020898623300017975Tropical PeatlandALEAYLMEAGRGEVLDLPKGAKLELELERALYLVKD
Ga0187782_1140365713300017975Tropical PeatlandIAAYLMESGRGHELDLPKGAKLELELERALYLVKE
Ga0187810_1012067413300018012Freshwater SedimentAEGAAMGALEAYLMEEGRGQELNLPKGAKVELELERALYLVRE
Ga0187765_1078870313300018060Tropical PeatlandAALEAYLMEAGRGQEIELERGTKLELELERSLYLVKE
Ga0187784_1080899313300018062Tropical PeatlandAQGAAIGALEAYLTEAGRGQELDLPKGAKLELELERALYLVKD
Ga0179592_1047687423300020199Vadose Zone SoilGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0210407_1003385813300020579SoilEGALAGAIAAYLMESGRGHELDLPKGTKLELELERALYLVRE
Ga0210407_1008321513300020579SoilLGALTAYLVESGRGHELDLPKGVKLELELERALYLVKE
Ga0210403_1035883023300020580SoilITAYLVESGRGRELELPKGVKLELELERALFLVKE
Ga0210403_1054203513300020580SoilAGAAAAAIAAYLMESGRGHEIDLPKGAKMELELERALYLLKE
Ga0210399_1033178813300020581SoilAAAGAIAAYLMESGRGHELDLPKGAKLELELERALYLIKD
Ga0210395_1094603013300020582SoilAITAYLLESGRGRELELPKGVKLELELERALYLVKE
Ga0210408_1020177323300021178SoilEVAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN
Ga0210393_10002876133300021401SoilEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD
Ga0210385_1111276313300021402SoilGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVKD
Ga0210385_1146314013300021402SoilEVAEGAMAAASAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD
Ga0210389_1025962923300021404SoilAAIAAYLAESGRGHEVDLPRGAKLEVELERALYLVRD
Ga0210387_1005276213300021405SoilIGALTAYLVESGRGHELDLQKGAKLELELERALYLVKE
Ga0210383_1035531513300021407SoilLEAYLMEAGRGQELELPKGAKLELELERALYLVKE
Ga0210384_1060283113300021432SoilAALGALEAYLMDAGRGQEIDLPKGAKLELELERALYLTRE
Ga0213878_1024896123300021444Bulk SoilALGALEAYLAEAGRGQEIELGKGTKLELELERALYLLRE
Ga0210390_1043824013300021474SoilEAAEEAAMGALEAYLMEAGRGQELDLPKGAKLELELERALYLVRE
Ga0210390_1149948213300021474SoilAALGALEAYLVEAGRGQEIDLPKGAKLELELERALYLVRE
Ga0187846_1015342823300021476BiofilmALGALTAYLMESGRGHELNLPKGAKLELELERTLYLVRE
Ga0210409_1038715523300021559SoilALGALEAYLMEAGRGQEIELPKGAKLELELERALYLVKE
Ga0224549_102006413300022840SoilAMASFAAYLAESGRGQEINLQHGIKFELELERALYLLKE
Ga0179591_105375823300024347Vadose Zone SoilMGALTAYLVESGRGHELNLPKGAKLELELERALYLLKE
Ga0207684_1039180633300025910Corn, Switchgrass And Miscanthus RhizosphereAAEAALAAYLMEAGRGHELQLPKGSKLEIELERALYLVKE
Ga0207700_1180432013300025928Corn, Switchgrass And Miscanthus RhizosphereAAEYAAVAALEAYLMEAGRGHELNLPKGSKLELELVRALYLVRE
Ga0207665_1060157233300025939Corn, Switchgrass And Miscanthus RhizosphereAALAAYLMESGRGHEIDLPKGAKLELELERALYLLKE
Ga0207712_1063968733300025961Switchgrass RhizosphereEAAEYAAVAALEAYLMESGRGHEMNLPKGSKLELELERALYLVKE
Ga0207712_1133217513300025961Switchgrass RhizosphereAALEAYLMEAGRGHEMNLPKGAKLELELERALYLVRE
Ga0209237_123563613300026297Grasslands SoilLTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0209240_116702823300026304Grasslands SoilLAAYLMESGRGHEIDLPKGAKLELELERALYLLKE
Ga0209055_127347423300026309SoilLGALTAYLMEVGRGHELNLPKGAKLELELERALYLVKE
Ga0209647_124113413300026319Grasslands SoilTRAAESALAAYLTESGRGHEIVLPKGAKLELELGRALYLVRE
Ga0209687_105950723300026322SoilGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0209804_101193453300026335SoilAGAAVGALTAYLMESGRGHELKLPKGAKLELELERALYLVKE
Ga0257150_107351313300026356SoilEGALAGAIAAYLMESGRGHELDLPKGAKLELELERALYLVKD
Ga0257176_109127813300026361SoilGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0209157_111467913300026537SoilALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0209577_1013928013300026552SoilALTAYLMESGRGHELKLPKGAKLELELERPLYLVKE
Ga0179587_1050557423300026557Vadose Zone SoilGALTAYLMESGRGHELNLPKGAKLELELERALYLVRE
Ga0207819_101310523300027024Tropical Forest SoilAEGAALGALEAYLAESGRGEELNLPRGAKLELELERALYLVKE
Ga0208730_101054323300027047Forest SoilAEGAATAALAAYLIESGRGHELDLPKGAKLELELGRALYLVKE
Ga0207806_104323523300027049Tropical Forest SoilLEAYLAESGRGEELNLPRGAKLELELERALYLVKE
Ga0207780_106290613300027313Tropical Forest SoilAEGAAMAALEAYLMESGRGQELNLPKGAKLELELGRALYLLKE
Ga0209735_108518223300027562Forest SoilEGAAAAAIAAYLIESGRGHEIDLPKGAKLELELERALYLVKE
Ga0209076_108513613300027643Vadose Zone SoilAAVGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE
Ga0209217_105034223300027651Forest SoilLTAYLVESGRGHELNLPKGAKLELELERALYLLKE
Ga0209217_105203423300027651Forest SoilGAAMGALQAYLMEVGRGQELNLPKGAKLELELERALYLVQE
Ga0209038_1021378723300027737Bog Forest SoilAFTAYLAESGRGHELTFQHGAKLELELERALYLLKE
Ga0209074_1017415923300027787Agricultural SoilEGAALGAITAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0209074_1027008213300027787Agricultural SoilEGAALGAITAYLMESGRGHELNLPKGAKLELELERALYLLKE
Ga0209139_1025628423300027795Bog Forest SoilMGALEAYLMEAGRGQDLNLPKGAKLELELERALYLVRE
Ga0209283_1005198533300027875Vadose Zone SoilLGAITAYLMESGRGHELKLPKGAKLELELERALYLVKE
Ga0209275_1000668353300027884SoilALGALEAYLMEAGRGQEIELPKGAKLELELERALYLVRE
Ga0209698_1111596623300027911WatershedsAEGAAIVALEAYLMEAGRGQELDLPKGAKLELELERALYLVKE
Ga0209526_1039012123300028047Forest SoilGAAAGAIAAYLMESGRGHELDLPKGAKLELELERALYLVKE
Ga0137415_1007730033300028536Vadose Zone SoilAITAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0302224_1002895743300028759PalsaMAAFAAYLAESGRGQEINLQHGIKFELELERALYLLKE
Ga0308309_1101827123300028906SoilEVAEGAMAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRD
Ga0311353_1093829413300030399PalsaEAAAMAAFTAYLAESGRGHEITFQRGVKFELELERSLYLLKD
Ga0170834_10782831913300031057Forest SoilGAAAAAIAAYLMESGRGHEIDLPKGAKMELELERALYLLKE
Ga0170834_11030855313300031057Forest SoilLGALEAYLTEAGRGQEIELPKGAKLELELERALYLVRE
Ga0170824_12586354933300031231Forest SoilAEGAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0302325_1020856013300031234PalsaAAMAAFTAYLAESGRGHEITFQRGVKFELELERSLYLLKD
Ga0302324_10148674013300031236PalsaKAAAEAAAMAAFTAYLAESGRGHEITFQRGVKFELELERSLYLLKD
Ga0170820_1204135413300031446Forest SoilGAAEAALAAYLMEAGRGHELELAKGAKLEIELERALYLLKE
Ga0318541_1025772323300031545SoilGESAALGALEAYLLETGRGQELDLPKGAKLELELARTLYLVKP
Ga0318560_1077198713300031682SoilYAAVAALEAYLMEAGRGHEMSLPKGSKLELELERALYLVRE
Ga0307469_1026979913300031720Hardwood Forest SoilAEAAALGALTAYLMESGRGHELNLPKGAKLELELERALYLVKE
Ga0307469_1043728623300031720Hardwood Forest SoilGALEAYLMEAGRGQEIELPKGAKLELELERALYLTRE
Ga0307477_1091368123300031753Hardwood Forest SoilGAAAGAIAAYLMESGRGHEIDLPKGAKLELELERALYLLKE
Ga0307475_1078265523300031754Hardwood Forest SoilAALGALEAYLMEAGRGQEIELPKGAKLELELERALYLVRE
Ga0307475_1090495013300031754Hardwood Forest SoilEGAALGALEAYLMDAGRGQEIDLPKGAKLELELERALYLTRE
Ga0318557_1047166613300031795SoilYAAVAALEAYLMEAGRGHEMNLPKGSKLELELERALYLVRE
Ga0307473_1047306133300031820Hardwood Forest SoilAIAAYLMASGRGHELDLPKGAKLELELERALYLVKE
Ga0318567_1059975613300031821SoilAESAALGALEAYLLETGRGQELDLPKGAKLELELARTLYLVKP
Ga0306925_1017145633300031890SoilLGALEAYLMEAGRGQELDLPKGAKLELELERALYLVRE
Ga0307479_1000693213300031962Hardwood Forest SoilTAALAAYLIESGRGHELDLPKGAKLELELGRALYLVKE
Ga0318569_1039944113300032010SoilALEAYLLETGRGQELDLPKGAKLELELERTLYLVKP
Ga0318524_1061406013300032067SoilSAALGALEAYLQETGRGQELDLPKGAKLELELERALYLVKE
Ga0306920_10079718713300032261SoilGALEAYLMEAGCGEELNLPRGCKLELELERTLYLVKE
Ga0335069_1037979713300032893SoilAAAIAAYLVESGRGHEVDLPRGAKLEVELERALYLVRN
Ga0335071_1001696513300032897SoilAALGALEAYLMEAGRGEELSLARGCKLELELERALYLVKD
Ga0335077_1027301013300033158SoilGALEAYLTEAGRGQELELPKGAKLELELERALYLVRE
Ga0314861_0105291_1304_14203300033977PeatlandMGALEAYLTESGWGQELDLPKGAKLELELERALYLVRE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.