Metagenome / Metatranscriptome Family F035402

Basic Information
Family ID	F035402
Family Type	Metagenome / Metatranscriptome
Number of Sequences	172
Average Sequence Length	37 residues
Representative Sequence	MWFYVQMWFPLLTIALTAAICFSVASFIMGQPKPQR
Number of Associated Samples	135
Number of Associated Scaffolds	172

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	81.98 %
% of genes near scaffold ends (potentially truncated)	31.40 %
% of genes from short scaffolds (< 2000 bps)	66.86 %
Associated GOLD sequencing projects	129
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Most Common Taxonomy
Group	Bacteria (73.837 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.023 % of family members)
Environment Ontology (ENVO)	Unclassified (25.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (44.186 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 172 Family Scaffolds
PF00166	Cpn10	5.81
PF00011	HSP20	4.07
PF09361	Phasin_2	3.49
PF04392	ABC_sub_bind	2.33
PF13545	HTH_Crp_2	2.33
PF00118	Cpn60_TCP1	2.33
PF00027	cNMP_binding	1.74
PF00140	Sigma70_r1_2	1.16
PF04055	Radical_SAM	1.16
PF08281	Sigma70_r4_2	1.16
PF13472	Lipase_GDSL_2	1.16
PF02696	SelO	1.16
PF00872	Transposase_mut	1.16
PF02668	TauD	1.16
PF04539	Sigma70_r3	1.16
PF01135	PCMT	1.16
PF03401	TctC	0.58
PF01321	Creatinase_N	0.58
PF06240	COXG	0.58
PF00491	Arginase	0.58
PF05598	DUF772	0.58
PF07859	Abhydrolase_3	0.58
PF00903	Glyoxalase	0.58
PF13586	DDE_Tnp_1_2	0.58
PF02826	2-Hacid_dh_C	0.58
PF04280	Tim44	0.58
PF00313	CSD	0.58
PF01594	AI-2E_transport	0.58
PF02517	Rce1-like	0.58
PF14499	DUF4437	0.58
PF04546	Sigma70_ner	0.58
PF02543	Carbam_trans_N	0.58
PF03979	Sigma70_r1_1	0.58
PF00487	FA_desaturase	0.58
PF13340	DUF4096	0.58
PF14026	DUF4242	0.58
PF01266	DAO	0.58
PF02657	SufE	0.58
PF04545	Sigma70_r4	0.58
PF13924	Lipocalin_5	0.58
PF00536	SAM_1	0.58

COG ID	Name	Functional Category	% Frequency in 172 Family Scaffolds
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	5.81
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	4.07
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	3.49
COG0459	Chaperonin GroEL (HSP60 family)	Posttranslational modification, protein turnover, chaperones [O]	2.33
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.33
COG0397	Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O)	Posttranslational modification, protein turnover, chaperones [O]	1.16
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	1.16
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	1.16
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	1.16
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	1.16
COG2519	tRNA A58 N-methylase Trm61	Translation, ribosomal structure and biogenesis [J]	1.16
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	1.16
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	1.16
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	0.58
COG0010	Arginase/agmatinase family enzyme	Amino acid transport and metabolism [E]	0.58
COG0628	Predicted PurR-regulated permease PerM	General function prediction only [R]	0.58
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.58
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	0.58
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	0.58
COG2166	Sulfur transfer protein SufE, Fe-S cluster assembly	Posttranslational modification, protein turnover, chaperones [O]	0.58
COG2192	Predicted carbamoyl transferase, NodU family	General function prediction only [R]	0.58
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.58
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	0.58
COG3427	Carbon monoxide dehydrogenase subunit CoxG	Energy production and conversion [C]	0.58
COG4395	Predicted lipid-binding transport protein, Tim44 family	Lipid transport and metabolism [I]	0.58
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	0.58

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.84 %
Unclassified	root	N/A	26.16 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.84 %
Unclassified	root	N/A	26.16 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	73.84 %
Unclassified	root	N/A	26.16 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	55.23 %
Unclassified	root	N/A	26.16 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	49.42 %
Unclassified	root	N/A	26.16 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.16 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.16 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	22.09 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	19.77 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.16 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.16 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	18.60 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4.65 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	1.16 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.16 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1.16 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.16 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.58 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.58 %
Methylocystaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae	0.58 %
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.16 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	18.60 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4.65 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.16 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	1.16 %
Lautropia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia	1.16 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.16 %
Methylocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis	0.58 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.58 %
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	0.58 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.16 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	18.60 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	1.16 %
unclassified Lautropia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia	1.16 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.16 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.16 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.58 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.58 %
Methylocystis hirsuta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	0.58 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.58 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.58 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.16 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	18.60 %
Lautropia sp. SCN 69-89	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 69-89	1.16 %
Mesorhizobium sp. 113-3-9	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 113-3-9	1.16 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.16 %
Alphaproteobacteria bacterium 13_2_20CM_2_64_7	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	1.16 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.58 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.58 %
Methylocystis hirsuta	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	0.58 %
Pseudolabrys taiwanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	0.58 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.58 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_16577670	All Organisms → cellular organisms → Bacteria → Proteobacteria	2184	Open in IMG/M
2199352025\|deepsgr__Contig_189460	Not Available	622	Open in IMG/M
2228664022\|INPgaii200_c0663783	Not Available	505	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0630678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1643	Open in IMG/M
3300000550\|F24TB_10015679	Not Available	2067	Open in IMG/M
3300000955\|JGI1027J12803_100977175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	987	Open in IMG/M
3300000955\|JGI1027J12803_101341156	Not Available	545	Open in IMG/M
3300001545\|JGI12630J15595_10008461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2223	Open in IMG/M
3300001545\|JGI12630J15595_10010217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 69-89	2024	Open in IMG/M
3300001661\|JGI12053J15887_10046145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2442	Open in IMG/M
3300002914\|JGI25617J43924_10102637	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1021	Open in IMG/M
3300002917\|JGI25616J43925_10098796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1206	Open in IMG/M
3300004157\|Ga0062590_101397747	Not Available	696	Open in IMG/M
3300005184\|Ga0066671_10248016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1095	Open in IMG/M
3300005186\|Ga0066676_10900295	Not Available	594	Open in IMG/M
3300005435\|Ga0070714_101699426	Not Available	616	Open in IMG/M
3300005518\|Ga0070699_100785049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	871	Open in IMG/M
3300005552\|Ga0066701_10662291	Not Available	630	Open in IMG/M
3300005556\|Ga0066707_10041648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2614	Open in IMG/M
3300005556\|Ga0066707_10200160	Not Available	1288	Open in IMG/M
3300005557\|Ga0066704_10259413	All Organisms → cellular organisms → Bacteria	1180	Open in IMG/M
3300005559\|Ga0066700_10178129	Not Available	1457	Open in IMG/M
3300005560\|Ga0066670_10195033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1212	Open in IMG/M
3300005587\|Ga0066654_10022852	All Organisms → cellular organisms → Bacteria	2523	Open in IMG/M
3300005921\|Ga0070766_10142595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1459	Open in IMG/M
3300006031\|Ga0066651_10544022	Not Available	615	Open in IMG/M
3300006038\|Ga0075365_10027327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3630	Open in IMG/M
3300006038\|Ga0075365_10623794	Not Available	762	Open in IMG/M
3300006046\|Ga0066652_100810917	Not Available	895	Open in IMG/M
3300006046\|Ga0066652_100857752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	868	Open in IMG/M
3300006175\|Ga0070712_100066128	All Organisms → cellular organisms → Bacteria → Proteobacteria	2568	Open in IMG/M
3300006175\|Ga0070712_100149310	Not Available	1793	Open in IMG/M
3300006576\|Ga0074047_10485070	Not Available	507	Open in IMG/M
3300006796\|Ga0066665_10489093	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300006797\|Ga0066659_10456210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1017	Open in IMG/M
3300006844\|Ga0075428_100181980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2274	Open in IMG/M
3300006845\|Ga0075421_100047219	All Organisms → cellular organisms → Bacteria	5456	Open in IMG/M
3300006845\|Ga0075421_100069859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4434	Open in IMG/M
3300006845\|Ga0075421_100699245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1178	Open in IMG/M
3300006846\|Ga0075430_100180563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1755	Open in IMG/M
3300006854\|Ga0075425_100237291	All Organisms → cellular organisms → Bacteria → Proteobacteria	2098	Open in IMG/M
3300006854\|Ga0075425_101420779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	785	Open in IMG/M
3300006871\|Ga0075434_100097653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2942	Open in IMG/M
3300006871\|Ga0075434_100192058	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2062	Open in IMG/M
3300006871\|Ga0075434_100712640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1021	Open in IMG/M
3300006871\|Ga0075434_100928908	Not Available	885	Open in IMG/M
3300006880\|Ga0075429_100491516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1075	Open in IMG/M
3300006903\|Ga0075426_10620305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	808	Open in IMG/M
3300006904\|Ga0075424_102470536	Not Available	544	Open in IMG/M
3300006953\|Ga0074063_13639662	All Organisms → cellular organisms → Bacteria → Proteobacteria	2073	Open in IMG/M
3300006954\|Ga0079219_10012976	Not Available	2868	Open in IMG/M
3300007076\|Ga0075435_100092726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2494	Open in IMG/M
3300007258\|Ga0099793_10017825	All Organisms → cellular organisms → Bacteria	2871	Open in IMG/M
3300007265\|Ga0099794_10002591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6709	Open in IMG/M
3300009038\|Ga0099829_10023964	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4244	Open in IMG/M
3300009090\|Ga0099827_10344554	Not Available	1267	Open in IMG/M
3300009100\|Ga0075418_10790641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1024	Open in IMG/M
3300009101\|Ga0105247_10244371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1224	Open in IMG/M
3300009137\|Ga0066709_101414203	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300009137\|Ga0066709_102254775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	749	Open in IMG/M
3300009168\|Ga0105104_10315454	Not Available	861	Open in IMG/M
3300010036\|Ga0126305_10239676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1163	Open in IMG/M
3300010037\|Ga0126304_10206866	Not Available	1284	Open in IMG/M
3300010303\|Ga0134082_10026647	All Organisms → cellular organisms → Bacteria	2156	Open in IMG/M
3300010321\|Ga0134067_10045680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1398	Open in IMG/M
3300010337\|Ga0134062_10018563	All Organisms → cellular organisms → Bacteria	2639	Open in IMG/M
3300010373\|Ga0134128_10754901	Not Available	1079	Open in IMG/M
3300011119\|Ga0105246_10751507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	860	Open in IMG/M
3300011120\|Ga0150983_11738071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	860	Open in IMG/M
3300011120\|Ga0150983_13288346	Not Available	647	Open in IMG/M
3300011120\|Ga0150983_13288684	Not Available	636	Open in IMG/M
3300011120\|Ga0150983_16485155	Not Available	517	Open in IMG/M
3300012096\|Ga0137389_10031521	All Organisms → cellular organisms → Bacteria	3853	Open in IMG/M
3300012199\|Ga0137383_10364725	Not Available	1058	Open in IMG/M
3300012200\|Ga0137382_10036676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2977	Open in IMG/M
3300012200\|Ga0137382_10210197	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 113-3-9	1339	Open in IMG/M
3300012201\|Ga0137365_10530439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	864	Open in IMG/M
3300012204\|Ga0137374_10089011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2955	Open in IMG/M
3300012204\|Ga0137374_11017145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300012206\|Ga0137380_10123556	Not Available	2364	Open in IMG/M
3300012206\|Ga0137380_10485288	All Organisms → cellular organisms → Bacteria	1090	Open in IMG/M
3300012206\|Ga0137380_10631006	Not Available	935	Open in IMG/M
3300012209\|Ga0137379_10010217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	8918	Open in IMG/M
3300012209\|Ga0137379_10193606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1946	Open in IMG/M
3300012209\|Ga0137379_10194876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1939	Open in IMG/M
3300012211\|Ga0137377_10058756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3572	Open in IMG/M
3300012361\|Ga0137360_10624249	All Organisms → cellular organisms → Bacteria	923	Open in IMG/M
3300012361\|Ga0137360_10745263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta	842	Open in IMG/M
3300012363\|Ga0137390_10980692	All Organisms → cellular organisms → Bacteria → Proteobacteria	797	Open in IMG/M
3300012917\|Ga0137395_10015428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4306	Open in IMG/M
3300012925\|Ga0137419_10732864	Not Available	804	Open in IMG/M
3300012941\|Ga0162652_100030233	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	808	Open in IMG/M
3300012957\|Ga0164303_10784614	Not Available	653	Open in IMG/M
3300012961\|Ga0164302_10267024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1097	Open in IMG/M
3300012976\|Ga0134076_10577064	Not Available	522	Open in IMG/M
3300014745\|Ga0157377_10292098	All Organisms → cellular organisms → Bacteria	1073	Open in IMG/M
3300015077\|Ga0173483_10232370	Not Available	867	Open in IMG/M
3300015242\|Ga0137412_10065216	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2963	Open in IMG/M
3300015245\|Ga0137409_10304623	All Organisms → cellular organisms → Bacteria	1400	Open in IMG/M
3300015371\|Ga0132258_10526700	All Organisms → cellular organisms → Bacteria	2959	Open in IMG/M
3300015371\|Ga0132258_10573394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2830	Open in IMG/M
3300015371\|Ga0132258_12930035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1185	Open in IMG/M
3300015372\|Ga0132256_101319012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	834	Open in IMG/M
3300017657\|Ga0134074_1042751	Not Available	1527	Open in IMG/M
3300018000\|Ga0184604_10006459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2252	Open in IMG/M
3300018433\|Ga0066667_10271366	All Organisms → cellular organisms → Bacteria	1300	Open in IMG/M
3300018465\|Ga0190269_10839110	All Organisms → cellular organisms → Bacteria	668	Open in IMG/M
3300018468\|Ga0066662_10852382	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300018469\|Ga0190270_10867021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	917	Open in IMG/M
3300019887\|Ga0193729_1283297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	502	Open in IMG/M
3300021178\|Ga0210408_10128990	All Organisms → cellular organisms → Bacteria → Proteobacteria	1997	Open in IMG/M
3300021178\|Ga0210408_10157778	Not Available	1798	Open in IMG/M
3300021178\|Ga0210408_10251381	Not Available	1408	Open in IMG/M
3300021432\|Ga0210384_10546214	All Organisms → cellular organisms → Bacteria	1042	Open in IMG/M
3300021475\|Ga0210392_10867670	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300021478\|Ga0210402_11604452	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300021479\|Ga0210410_10073402	All Organisms → cellular organisms → Bacteria	3000	Open in IMG/M
3300022557\|Ga0212123_10022516	All Organisms → cellular organisms → Bacteria → Proteobacteria	7024	Open in IMG/M
3300024347\|Ga0179591_1182051	All Organisms → cellular organisms → Bacteria	2309	Open in IMG/M
3300025910\|Ga0207684_10063125	All Organisms → cellular organisms → Bacteria	3145	Open in IMG/M
3300025910\|Ga0207684_10176227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1843	Open in IMG/M
3300025910\|Ga0207684_10675133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	879	Open in IMG/M
3300025915\|Ga0207693_10005265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10819	Open in IMG/M
3300025928\|Ga0207700_11606377	Not Available	575	Open in IMG/M
3300025961\|Ga0207712_11768841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554	Open in IMG/M
3300026304\|Ga0209240_1280422	Not Available	514	Open in IMG/M
3300026310\|Ga0209239_1000866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	17730	Open in IMG/M
3300026310\|Ga0209239_1018557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7	3494	Open in IMG/M
3300026343\|Ga0209159_1019732	All Organisms → cellular organisms → Bacteria	3818	Open in IMG/M
3300026538\|Ga0209056_10092096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2507	Open in IMG/M
3300026550\|Ga0209474_10699291	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	525	Open in IMG/M
3300026551\|Ga0209648_10021904	All Organisms → cellular organisms → Bacteria → Proteobacteria	5585	Open in IMG/M
3300026552\|Ga0209577_10352897	All Organisms → cellular organisms → Bacteria	1081	Open in IMG/M
3300026555\|Ga0179593_1135850	All Organisms → cellular organisms → Bacteria	2198	Open in IMG/M
3300026555\|Ga0179593_1221432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3734	Open in IMG/M
3300027181\|Ga0208997_1002845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2027	Open in IMG/M
3300027521\|Ga0209524_1006091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2318	Open in IMG/M
3300027605\|Ga0209329_1024930	All Organisms → cellular organisms → Bacteria	1223	Open in IMG/M
3300027610\|Ga0209528_1023791	All Organisms → cellular organisms → Bacteria	1349	Open in IMG/M
3300027651\|Ga0209217_1017719	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia → unclassified Lautropia → Lautropia sp. SCN 69-89	2299	Open in IMG/M
3300027655\|Ga0209388_1001758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	5134	Open in IMG/M
3300027875\|Ga0209283_10057963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2479	Open in IMG/M
3300027907\|Ga0207428_10443521	All Organisms → cellular organisms → Bacteria	947	Open in IMG/M
3300027909\|Ga0209382_10042475	All Organisms → cellular organisms → Bacteria	5445	Open in IMG/M
3300027909\|Ga0209382_10077020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3934	Open in IMG/M
3300027909\|Ga0209382_10443662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1439	Open in IMG/M
3300028536\|Ga0137415_10017406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7128	Open in IMG/M
3300028708\|Ga0307295_10065664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	950	Open in IMG/M
3300028712\|Ga0307285_10189385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	574	Open in IMG/M
3300028796\|Ga0307287_10242938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	682	Open in IMG/M
3300028814\|Ga0307302_10031494	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis	2438	Open in IMG/M
3300028819\|Ga0307296_10044140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2351	Open in IMG/M
3300029636\|Ga0222749_10790827	Not Available	519	Open in IMG/M
3300030884\|Ga0265758_105141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	620	Open in IMG/M
3300030986\|Ga0308154_113657	Not Available	558	Open in IMG/M
3300030987\|Ga0308155_1000481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 113-3-9	1859	Open in IMG/M
3300031093\|Ga0308197_10467340	Not Available	510	Open in IMG/M
3300031099\|Ga0308181_1007855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1459	Open in IMG/M
3300031198\|Ga0307500_10032264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1192	Open in IMG/M
3300031226\|Ga0307497_10288861	Not Available	748	Open in IMG/M
3300031231\|Ga0170824_110849876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	735	Open in IMG/M
3300031231\|Ga0170824_126346284	Not Available	503	Open in IMG/M
3300031424\|Ga0308179_1026731	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	665	Open in IMG/M
3300031424\|Ga0308179_1054100	Not Available	527	Open in IMG/M
3300031573\|Ga0310915_10016967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4355	Open in IMG/M
3300031720\|Ga0307469_11600469	Not Available	626	Open in IMG/M
3300032174\|Ga0307470_10363861	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300032180\|Ga0307471_100581324	All Organisms → cellular organisms → Bacteria	1277	Open in IMG/M
3300032180\|Ga0307471_103976497	Not Available	522	Open in IMG/M
3300034643\|Ga0370545_014196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1257	Open in IMG/M
3300034643\|Ga0370545_028762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	987	Open in IMG/M
3300034680\|Ga0370541_000971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1936	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.56%
Host-Associated	Host-Associated	17.44%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	80.81%
Plants	Host-Associated → Plants	17.44%
Aquatic	Environmental → Aquatic	1.74%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	80.23%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.53%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.74%
Roots	Host-Associated → Plants → Roots	1.16%
Freshwater	Environmental → Aquatic → Freshwater	0.58%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.58%
Sediment	Environmental → Aquatic → Sediment	0.58%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.58%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	66.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.95%
Loam	Environmental → Terrestrial → Soil → Loam	13.37%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.74%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	1.16%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.58%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.58%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.58%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.58%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.58%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	19.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.95%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.23%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.74%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.16%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	1.16%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.58%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.58%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.58%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.58%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.58%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	18.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.37%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	11.63%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	6.98%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.23%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.65%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.74%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.74%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.16%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.16%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	1.16%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.16%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.58%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.58%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.58%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.58%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.58%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.58%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.58%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.58%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental	Open in IMG/M
3300002917	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006576	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012941	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026343	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300027181	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027521	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027605	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027610	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027651	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental	Open in IMG/M
3300028712	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139	Environmental	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030884	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030986	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030987	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031093	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031424	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300034643	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034680	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F035402

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_01624340	2088090014	Soil	MWFYLQMWLPLLTVALTTAICFSVASFIMGQPKPQR
deepsgr_03264530	2199352025	Soil	MWFYVQMWFPVLTIALTAAICFSVASFIMGHTKPQR
INPgaii200_06637832	2228664022	Soil	MWAYLQMWFPLLTVALTAAICLSTVSFIMGQSKPQR
ICChiseqgaiiDRAFT_06306783	3300000033	Soil	VWFYVQMWFSILTIVLTVAIGIGVVSFIMGHAKPHV*
F24TB_100156793	3300000550	Soil	MWFYVQMSFPLLTVALTAAICLSVVSFIMGQAKPQR*
JGI1027J12803_1009771752	3300000955	Soil	MWSYVQMWYPLLIIALTAAICLSVVSFIMGQTKPQP*
JGI1027J12803_1013411562	3300000955	Soil	FYIQTWFPLLTIALTAAICFSVASFIMGHAKPQRR*
JGI12630J15595_100084614	3300001545	Forest Soil	MWFYFQMWFPLLTVVLTAAICFSVTSFIMGQASPQA*
JGI12630J15595_100102172	3300001545	Forest Soil	MLFYIQTWLPLLTIALTAAICFSVASFIMGQARPQA*
JGI12053J15887_100461455	3300001661	Forest Soil	MWFYVQMWFPLLTIALTAAICFSVVSFIMGRSVKP
JGI25617J43924_101026371	3300002914	Grasslands Soil	PQEDRQMWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR*
JGI25616J43925_100987961	3300002917	Grasslands Soil	EHRQMWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR*
Ga0062590_1013977471	3300004157	Soil	MWLYVQTWLPILTIALTAAICFGVASFMMGYHTKRQPWVL*
Ga0066671_102480162	3300005184	Soil	MWFYVQMWFPLLTIALAAAICFSVVSFIMGHAQPQPMIEDQA*
Ga0066676_109002951	3300005186	Soil	PPPQEDRQMWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR*
Ga0070714_1016994262	3300005435	Agricultural Soil	DRQMWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR*
Ga0070699_1007850491	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	EDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA*
Ga0066701_106622912	3300005552	Soil	MWLYVQTWLPLLTIGLTAAICFSVAAFIMGQPQRRQ*
Ga0066707_100416486	3300005556	Soil	MWFYVQMLFPLLTIALTAAICLSVVSFIMGHAKPQR*
Ga0066707_102001601	3300005556	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKP
Ga0066704_102594132	3300005557	Soil	MWLYVQMWFPLLTVALTAAICFSVMSFIMGYSKPHA*
Ga0066700_101781291	3300005559	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMERSVKPHQL*
Ga0066670_101950331	3300005560	Soil	MWFYVQMWFPLLTIALTAAICFSVASFIMGQPKPQR*
Ga0066654_100228523	3300005587	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPQR*
Ga0070766_101425954	3300005921	Soil	MWFYIQMVLPLLTFGLAAAICFSVVSSIVAHAKPHP*
Ga0066651_105440221	3300006031	Soil	RQMWSYVEMWSPLLTIALAAAICLGVVSYIMGQAKPQP*
Ga0075365_100273279	3300006038	Populus Endosphere	MWFYVQMWLPVLTVALTAAICFSVASFIMAGSVKPHQL*
Ga0075365_106237942	3300006038	Populus Endosphere	QMWSYVQMWYPLLTIALTAAICLSVVSFIMGQTKLQP*
Ga0066652_1008109171	3300006046	Soil	GRQMWFYVQMLFPLLTIALTAAICLSVVSFIMGKAKPHP*
Ga0066652_1008577521	3300006046	Soil	GRQMWFYVQMLFPLLTIALTAAICLSVVSFIMGHAKPQR*
Ga0070712_1000661284	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQR*
Ga0070712_1001493103	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MWFYVQMGFPLLTIALTAAICLTVVSFIMGQGKIHR*
Ga0074047_104850701	3300006576	Soil	EDRQMWFYVQMGLPLLTIALTAAICLSVVSFIMGQAKPQR*
Ga0066665_104890931	3300006796	Soil	MWFYVQMWFPLLTIALTAAICFSVASFIMGRSVKPQR*
Ga0066659_104562104	3300006797	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPHQP
Ga0075428_1001819802	3300006844	Populus Rhizosphere	MWFYVQMWLPIFTVALTAAICFSVAAFIMGRSVKPHQL*
Ga0075421_10004721911	3300006845	Populus Rhizosphere	MWFYTQMLFPVLLVGLTAAICFSVASFMVGQPKPHP*
Ga0075421_1000698592	3300006845	Populus Rhizosphere	MWSYVQMSYPLLTIALAAAMCFVVVSFIMGQSKPHR*
Ga0075421_1006992452	3300006845	Populus Rhizosphere	MWSYVQMWYPLLTIALTAAICLSVVSFIMGQAKPQP*
Ga0075430_1001805634	3300006846	Populus Rhizosphere	MWFYVQMWFPLLTVVLTAAVCLSVVSFIMGQAKPQS*
Ga0075425_1002372913	3300006854	Populus Rhizosphere	MWFYIQTWFPFLTIALTAAICFSVASFIMGQARPQA*
Ga0075425_1014207792	3300006854	Populus Rhizosphere	MWPDVQTWLPLFTIVLSAAVGLSVVSFIMGQAKVGR*
Ga0075434_1000976535	3300006871	Populus Rhizosphere	MWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA*
Ga0075434_1001920583	3300006871	Populus Rhizosphere	MWLHIQTWLPLLTIALTAALCFSVASFIMGQTRPEKR*
Ga0075434_1007126402	3300006871	Populus Rhizosphere	MWSFIQMWSPLLTVAFAAAICLSVVSFIMGQAKKPHP*
Ga0075434_1009289081	3300006871	Populus Rhizosphere	MWFHFQTWFPLLTVALTATICFGVVSFIIGHTKPH
Ga0075429_1004915162	3300006880	Populus Rhizosphere	MWSYVQMWFPLLTIVLTAAICLSVVSFIVRQPKVHR*
Ga0075426_106203052	3300006903	Populus Rhizosphere	MWSYVQMWSPLLTVALAAAVCFGVVSVIMAQAKPH
Ga0075424_1024705363	3300006904	Populus Rhizosphere	EDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA*
Ga0074063_136396623	3300006953	Soil	MWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA*
Ga0079219_100129763	3300006954	Agricultural Soil	MWLYIQAWLPLFTVALTAAICFSVASFVMAQAKVQP*
Ga0075435_1000927264	3300007076	Populus Rhizosphere	MWFYVQMLFPLLTIALTAAICLSVVSFIMGQAKPQR*
Ga0099793_100178253	3300007258	Vadose Zone Soil	MWLYVQMWFPLLTVALTAAICFSVVSFIMGHTKLHA*
Ga0099794_100025919	3300007265	Vadose Zone Soil	MWFDVQMLFPLLTIALTAAICLSVVSFIMGQAKPQR*
Ga0099829_100239646	3300009038	Vadose Zone Soil	MWSNVQMWFPVLTIVLTAAICISVVSFIVGQSKPQS*
Ga0099827_103445543	3300009090	Vadose Zone Soil	RQMWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR*
Ga0075418_107906412	3300009100	Populus Rhizosphere	MWSYVQMWYPLLTIALTAAICLSVVSFIMGQTKLQP*
Ga0105247_102443713	3300009101	Switchgrass Rhizosphere	MWPHVQTWLPLFTIVLSAAVGLSVASFIMGQTQVHR*
Ga0066709_1014142031	3300009137	Grasslands Soil	MWFYVQMGFPLLTVALTAAICFSVVSFIMGHAKPYA*
Ga0066709_1022547752	3300009137	Grasslands Soil	MWFYVQMWFPLLTIALTAAICISVVSFIMGQAKPHP*
Ga0105104_103154541	3300009168	Freshwater Sediment	MMWSYVQMLFPLLTVALAAAICLVVVSFIVGQPKSQP*
Ga0126305_102396761	3300010036	Serpentine Soil	RQDSLEDRQMWHYVQMWVPLLTIGLTAAMCFSVAAFLIAQPRGR*
Ga0126304_102068663	3300010037	Serpentine Soil	MSFYVQMFSPLLTIALAAAICFGVTSYIVGLAKLRP*
Ga0134082_100266472	3300010303	Grasslands Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPHQL*
Ga0134067_100456804	3300010321	Grasslands Soil	MWFYVQMGFPLLTIALTAAICFSVVSFIMGHAKPYAHA
Ga0134062_100185634	3300010337	Grasslands Soil	MWFYVQMWLPVWTVAFTAAICFSVASFIMGRSVKPQR*
Ga0134128_107549011	3300010373	Terrestrial Soil	MWFYVQTWFPLLTVTLTAAICFSVVSFIMGHAKPHA*
Ga0105246_107515072	3300011119	Miscanthus Rhizosphere	MWIYVQMWLPSLAVALTAAICFSVASFIMGQTKPQ*
Ga0150983_117380713	3300011120	Forest Soil	MWFYIQMWLPVWTVALTAAICFSVASFIMRRSVKPHQ
Ga0150983_132883462	3300011120	Forest Soil	MWSYVQMWYPLLTIALTAAICLSVVSFIMGQTKPQP*
Ga0150983_132886841	3300011120	Forest Soil	MWLYIQTWLPLLTIALTAAICFSVTSFIMGQAKPQA*
Ga0150983_164851551	3300011120	Forest Soil	PPPQEDRQMWFYVQMWFPLLTIALTAAICFSVASLIMGQATPQR*
Ga0137389_100315211	3300012096	Vadose Zone Soil	MWFYVQMWLPVFTVALTAAICFSVTSFIMGRSVKPHQL*
Ga0137383_103647251	3300012199	Vadose Zone Soil	MWFYVQMWFPLLTIALTAAICFSVVSFIMGQPKLQR*
Ga0137382_100366762	3300012200	Vadose Zone Soil	MWFYVQMWFPLLPVVLTAAVCLSVVSFIMGQAKPHP*
Ga0137382_102101972	3300012200	Vadose Zone Soil	MWSYVQMWSPLLTVTLAAAICLSVVSFIMGKAKPHP*
Ga0137365_105304392	3300012201	Vadose Zone Soil	MWLYVQMWFPLLTVALTAAICFSVVSFIMGYSKPHISG*
Ga0137374_100890113	3300012204	Vadose Zone Soil	MWFYVQTWLPILAVALTAAICFSVASFVMGQSVKPHQQ*
Ga0137374_110171452	3300012204	Vadose Zone Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMRRSVKPHQP
Ga0137380_101235562	3300012206	Vadose Zone Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKAQR*
Ga0137380_104852882	3300012206	Vadose Zone Soil	MWLYFQMWFPLLTVALTAAICFSVVSFIMGHAKPYA*
Ga0137380_106310063	3300012206	Vadose Zone Soil	WFHIQTWFPLLTIILSAAICLSVVSFIMRQAKPQP*
Ga0137379_100102175	3300012209	Vadose Zone Soil	MWFHIQTWFPLLTIILSAAICLSVVSFIMRQAKPQP*
Ga0137379_101936061	3300012209	Vadose Zone Soil	MWFYVQMGLPLLTIALTAAICLSVASFIMGQAKIHR*
Ga0137379_101948762	3300012209	Vadose Zone Soil	MWFYVQMWFPLLTVALTAAICFSVASFIMGRSVKPQR*
Ga0137377_100587562	3300012211	Vadose Zone Soil	MWFYVQMWFPLLTIALTAGICFSVVSFIMGQPKLQR*
Ga0137360_106242492	3300012361	Vadose Zone Soil	MWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQ
Ga0137360_107452631	3300012361	Vadose Zone Soil	RVGAPQEDRQMSFYVQTWLPLLTVALTAAICFSVASFMMGHTKPQR*
Ga0137390_109806921	3300012363	Vadose Zone Soil	DTGQFQEDRQMWLYIQTWLPLLTIALTAAICFSVASFIMGQARPQRR*
Ga0137395_100154286	3300012917	Vadose Zone Soil	MWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR*
Ga0137419_107328642	3300012925	Vadose Zone Soil	MLPYVQMWFPLLTIALTAAICLSVVSFIMGQGKIHP*
Ga0162652_1000302333	3300012941	Soil	MWFYVQMWFPLLTIALTAAICFSVVSFIMGRSVKPR
Ga0164303_107846141	3300012957	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMRRSVKSHQL*
Ga0164302_102670242	3300012961	Soil	MWFYVQMWLPIVTVALTAAICFSVASFIMGRSVKPHQLQSLHPFRA*
Ga0134076_105770642	3300012976	Grasslands Soil	MWLYVQTWLPLLTIGLTAAICFSVAAFIMAQPQRAVGSHVRR
Ga0157377_102920982	3300014745	Miscanthus Rhizosphere	MWFYVQMWFPLLTVALTAAICFSVVSFIIGRGVKPRQL*
Ga0173483_102323703	3300015077	Soil	MWFYIRTWFPLLTIALTAAICFSVASFIMGQTRPQ
Ga0137412_100652164	3300015242	Vadose Zone Soil	MWFYVQMWFPLLTIALTAAICLSVVSFIMGQGKIHP*
Ga0137409_103046233	3300015245	Vadose Zone Soil	MWSYVQMWVPLLTIALAAAICFSVVSFIMGRAKPHRL*
Ga0132258_105267005	3300015371	Arabidopsis Rhizosphere	MWFYVQMWFPLLTVALTAAICFSVVSFIMGHAKPHA*
Ga0132258_105733946	3300015371	Arabidopsis Rhizosphere	MWFYVQTWFPLFTIALTAAICFSVVSLIMGHAKPHA*
Ga0132258_129300351	3300015371	Arabidopsis Rhizosphere	MWFYIQMWFPLLTIVLTAAICFSVATFIMGQAKPHA*
Ga0132256_1013190122	3300015372	Arabidopsis Rhizosphere	MWSNVQMWYPLLTMSLTAAICLSVVSFIMGQTKPQP*
Ga0134074_10427512	3300017657	Grasslands Soil	MWFYVQMWLPVWTVALTAAICFGVASFIMGRSVKPHQL
Ga0184604_100064594	3300018000	Groundwater Sediment	MWFYVQMWFPLLTIALTAAICFSVVSFIMGRSVKPRQL
Ga0066667_102713663	3300018433	Grasslands Soil	MWFYVQMWFPLLTIALTAAICFSVASFIMGQPKPQR
Ga0190269_108391102	3300018465	Soil	MWFYVQMWLPLLTVALTAAICFSVASFIMGQPKPQ
Ga0066662_108523821	3300018468	Grasslands Soil	EDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA
Ga0190270_108670213	3300018469	Soil	MWFYVQMWFPLLTIALTAAICFSVVSFIMGQSVKPRQL
Ga0193729_12832971	3300019887	Soil	VVLWQMWFPLLTIALTAAICFSVVSFIMGRSVKPR
Ga0210408_101289901	3300021178	Soil	MFFYIQTWLPLPDNRLTAAICFSVTSFIMKHSEPHP
Ga0210408_101577785	3300021178	Soil	MWLYIQTWLPLLTIALTAAICFSVTSFIMGQAKPQA
Ga0210408_102513814	3300021178	Soil	MWLYIQTWLPLLTVALTVAICFSVTSFIMGQAKPQA
Ga0210384_105462142	3300021432	Soil	MWFYVQMWFPLLTIALTAAICFSVASLIMGQATPQR
Ga0210392_108676702	3300021475	Soil	MWFYVQMLFPLLTIALTAAICLSVVSFIMGHAKPQR
Ga0210402_116044522	3300021478	Soil	MWFYVQMWLPIVTVALTAAICFSVASFIMGRSVKP
Ga0210410_100734021	3300021479	Soil	MWLYIQTWLPLLTIALTAAICFSVTSFIMGQPKPQR
Ga0212123_100225162	3300022557	Iron-Sulfur Acid Spring	MWLHIQTWLPLLTIALTAAICFSVASFIMGQAGPQRP
Ga0179591_11820513	3300024347	Vadose Zone Soil	MWFYVQMGLPLLTIALTAAICLSVVSFIMGRAKTQL
Ga0207684_100631252	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MWFYVQMWLPLVTVALTAAICFSVASFIMGQSKPQA
Ga0207684_101762272	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA
Ga0207684_106751332	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA
Ga0207693_100052653	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MLFYIQTWLPLLTIALTAAICFSVTSFIMKHSEPHP
Ga0207700_116063771	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	AEPEDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQTRPQA
Ga0207712_117688412	3300025961	Switchgrass Rhizosphere	AEPEDRQMWFYIQTWFPLLTIALTAAICFSVASFIMGQARPQA
Ga0209240_12804221	3300026304	Grasslands Soil	MWLYVQMWFPLLTVALTAAICFSVVSFIMGHTKLHA
Ga0209239_100086616	3300026310	Grasslands Soil	MWFYVQMWFPLLPVVLTAAVCLSVVSFIMGQAKPHP
Ga0209239_10185573	3300026310	Grasslands Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPHQL
Ga0209159_10197326	3300026343	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPH
Ga0209056_100920963	3300026538	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMGRSVKPQR
Ga0209474_106992912	3300026550	Soil	MWFYVQMWFPLLTIALAAAICFSVVSFIMGHAQPQPMIEDQA
Ga0209648_100219042	3300026551	Grasslands Soil	MWFYVQMWLPVWTIALTAAICFSVASFMMRRSVKPRQL
Ga0209577_103528971	3300026552	Soil	MWLYVQMWFPLLTVALTAAICFSVMSFIMGYSKPHA
Ga0179593_11358504	3300026555	Vadose Zone Soil	MWFYVQTWFPLLTIALTAAICLSVLSFIMGQAKPQR
Ga0179593_12214322	3300026555	Vadose Zone Soil	MWFYVQMWFPLLTIALTAALCFCVVSFIRGHTKQPHRR
Ga0208997_10028452	3300027181	Forest Soil	MWFYVQTWFPLLSIALTAAICFSVASFILGHTEPKRR
Ga0209524_10060914	3300027521	Forest Soil	MWFYVQMGFPLLTVALTAALCFSVVSFIMSHAKPYA
Ga0209329_10249302	3300027605	Forest Soil	MWFYVQMLFPLLTIALTAAICLSVVSFIMGQAKPLR
Ga0209528_10237912	3300027610	Forest Soil	MWFYVQMGFPLLTVALAAALCFSVVSFIMSHAKPYA
Ga0209217_10177193	3300027651	Forest Soil	MLFYIQTWLPLLTIALTAAICFSVASFIMGQARPQA
Ga0209388_10017588	3300027655	Vadose Zone Soil	MWFDVQMLFPLLTIALTAAICLSVVSFIMGQAKPQR
Ga0209283_100579633	3300027875	Vadose Zone Soil	MWSNVQMWFPVLTIVLTAAICISVVSFIVGQSKPQS
Ga0207428_104435212	3300027907	Populus Rhizosphere	DRQMWSYVQMWFPLLTIVLTAAICLSVVSFIVRQPKVHR
Ga0209382_100424757	3300027909	Populus Rhizosphere	MWFYTQMLFPVLLVGLTAAICFSVASFMVGQPKPHP
Ga0209382_100770206	3300027909	Populus Rhizosphere	MWSYVQMSYPLLTIALAAAMCFVVVSFIMGQSKPHR
Ga0209382_104436621	3300027909	Populus Rhizosphere	MWFYVQMWLPIFTVALTAAICFSVAAFIMGRSVKPHQL
Ga0137415_100174065	3300028536	Vadose Zone Soil	MLLYVQMWFPLLTISLTAAICLSVMSFIMGQGKIHR
Ga0307295_100656641	3300028708	Soil	VLFYVQMWSPLLTIALTAAICFSVVSFIIGRGVKPRQL
Ga0307285_101893852	3300028712	Soil	MWFYVQMWFPLLTIALTAAICFSVVSFIMGQSVKP
Ga0307287_102429382	3300028796	Soil	VLFYVQMWSPLLTIALTAAICFSVVSFIIGRGVKPR
Ga0307302_100314943	3300028814	Soil	MWLYIQAWLPLFTVALTAAICFSVASFVMAQAKPQP
Ga0307296_100441403	3300028819	Soil	MWLFIQTWLPLLGIILTASVCFAAASFFMAQARPQRR
Ga0222749_107908271	3300029636	Soil	PQKDRQMWFYVQMWFPLLTIALTAAICLSVVSFIMGQAKPQR
Ga0265758_1051412	3300030884	Soil	MWFYAQMALPLLTVGLAAAICFSVASFIVAHAEPHS
Ga0308154_1136571	3300030986	Soil	MWSYVQMWYPLWTVALTAAICLSVVSFIMGQAKPQP
Ga0308155_10004812	3300030987	Soil	MWSYVQMWSPLLTVGLAAAICLSVVSFIMGKAKPHP
Ga0308197_104673401	3300031093	Soil	MWLYVQMWFPLLTIALTAAICLSVVSFIMGQAKPQP
Ga0308181_10078551	3300031099	Soil	RERRQMWSYVQMWYPLWTVALTAAICLSVVSFIMGQAKPQP
Ga0307500_100322641	3300031198	Soil	MWFYVQMWFPLLTVALTAAICFSVVSFIMGHTKSQR
Ga0307497_102888613	3300031226	Soil	MFYVQMWFPVLTVALTAAICFSVASFIMGHTKPGEDQA
Ga0170824_1108498761	3300031231	Forest Soil	QDDRQMWLFIQTFLPLLTIALTAAICFSVESFIIGQARPQ
Ga0170824_1263462841	3300031231	Forest Soil	WFYVQMGFPLLAIALTAAICLTVVSFIMGQGKIHR
Ga0308179_10267312	3300031424	Soil	MWSYVQMWSPFLTVALAAAICVGVVSFIMGKTKPHP
Ga0308179_10541002	3300031424	Soil	MWLYVQMWFPLLTIALTAAICLSVVSFIMGQGKIHR
Ga0310915_100169672	3300031573	Soil	MWFYVQMLFPLLTVALTAAICLSVVSFIMGHAKPQR
Ga0307469_116004691	3300031720	Hardwood Forest Soil	MWFYVQTGFPLLAIALTAAICFGVVSFIMGTPPTH
Ga0307470_103638612	3300032174	Hardwood Forest Soil	MWFYVQMWFPLLTVALTAAICFSVASFIMGQPKPQ
Ga0307471_1005813242	3300032180	Hardwood Forest Soil	MWFYVQMWLPIVTVALTAAICFSVASFIMGRSVKPHQLQSLHPFRA
Ga0307471_1039764972	3300032180	Hardwood Forest Soil	MWLYVQMWFPLLTIALTAAICFSVVSFIMGHAKPQRNR
Ga0370545_014196_1071_1178	3300034643	Soil	MWLYVQMWLPTLAVALTAAICFSIASFIMEHTKPQ
Ga0370545_028762_344_451	3300034643	Soil	MWFYVQMWLPTLAVALTAAICFSVASFIMGHTKPQ
Ga0370541_000971_365_481	3300034680	Soil	MWFYVQMWLPVWTVALTAAICFSVASFIMRRSVKPHQL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign