NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035517

Metagenome / Metatranscriptome Family F035517

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035517
Family Type Metagenome / Metatranscriptome
Number of Sequences 172
Average Sequence Length 46 residues
Representative Sequence VSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIEN
Number of Associated Samples 157
Number of Associated Scaffolds 172

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.27 %
% of genes near scaffold ends (potentially truncated) 95.35 %
% of genes from short scaffolds (< 2000 bps) 90.12 %
Associated GOLD sequencing projects 151
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.767 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.116 % of family members)
Environment Ontology (ENVO) Unclassified
(23.837 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.581 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.54%    β-sheet: 0.00%    Coil/Unstructured: 59.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 172 Family Scaffolds
PF01523PmbA_TldD 59.88
PF01726LexA_DNA_bind 1.74
PF11361DUF3159 1.16
PF08241Methyltransf_11 0.58
PF02782FGGY_C 0.58
PF02467Whib 0.58
PF05103DivIVA 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 172 Family Scaffolds
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 59.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.77 %
UnclassifiedrootN/A5.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2044078002|MGR_F548DK202IVPQ6All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium504Open in IMG/M
2065487018|GPINP_F5MS3JC02FRMSSAll Organisms → cellular organisms → Bacteria519Open in IMG/M
2170459019|G14TP7Y01EMY65All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300000890|JGI11643J12802_11515217All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300003990|Ga0055455_10209206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300003998|Ga0055472_10186431All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300004070|Ga0055488_10141070All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005167|Ga0066672_10656925All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005172|Ga0066683_10697121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300005177|Ga0066690_10544229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300005179|Ga0066684_10729890All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005184|Ga0066671_10224288All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005187|Ga0066675_10203599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1392Open in IMG/M
3300005187|Ga0066675_10330070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1111Open in IMG/M
3300005328|Ga0070676_10654964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium763Open in IMG/M
3300005330|Ga0070690_100764003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300005341|Ga0070691_10067571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1729Open in IMG/M
3300005345|Ga0070692_10687345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300005364|Ga0070673_100508322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1090Open in IMG/M
3300005466|Ga0070685_10551677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium823Open in IMG/M
3300005467|Ga0070706_101007904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium768Open in IMG/M
3300005471|Ga0070698_100814971All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005540|Ga0066697_10067912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2043Open in IMG/M
3300005543|Ga0070672_100067413All Organisms → cellular organisms → Bacteria2836Open in IMG/M
3300005547|Ga0070693_100845745All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300005556|Ga0066707_10712437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300005558|Ga0066698_10746821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300005578|Ga0068854_100940805All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005598|Ga0066706_10202309All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300005719|Ga0068861_102208057All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005889|Ga0075290_1052076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300006032|Ga0066696_10838352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300006034|Ga0066656_10915437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300006046|Ga0066652_101134221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300006058|Ga0075432_10195114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300006163|Ga0070715_10188958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1038Open in IMG/M
3300006237|Ga0097621_100374879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1270Open in IMG/M
3300006237|Ga0097621_100994160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300006796|Ga0066665_10830249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300006800|Ga0066660_10187183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1567Open in IMG/M
3300006804|Ga0079221_10570857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300006806|Ga0079220_11401461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300006847|Ga0075431_100986877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium809Open in IMG/M
3300006894|Ga0079215_10392441All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300006903|Ga0075426_10716695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300006903|Ga0075426_11155676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300006904|Ga0075424_101639777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300006914|Ga0075436_100661982All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300006953|Ga0074063_13915994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300007076|Ga0075435_100948578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium751Open in IMG/M
3300009012|Ga0066710_100198546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2853Open in IMG/M
3300009012|Ga0066710_103899832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300009098|Ga0105245_11311099All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300009100|Ga0075418_11395805All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300009137|Ga0066709_103254428All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300009148|Ga0105243_11034598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300009148|Ga0105243_11399808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300009156|Ga0111538_10703782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1280Open in IMG/M
3300009162|Ga0075423_12936985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300009545|Ga0105237_10729508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium997Open in IMG/M
3300009792|Ga0126374_10648658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300009808|Ga0105071_1028155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium836Open in IMG/M
3300009812|Ga0105067_1085876All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009819|Ga0105087_1096686All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300009840|Ga0126313_10020329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4407Open in IMG/M
3300009873|Ga0131077_10475940Not Available1164Open in IMG/M
3300010039|Ga0126309_10108212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1442Open in IMG/M
3300010040|Ga0126308_10194723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1300Open in IMG/M
3300010044|Ga0126310_11155578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300010301|Ga0134070_10366214All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010321|Ga0134067_10138487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium861Open in IMG/M
3300010321|Ga0134067_10430452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300010322|Ga0134084_10109298All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300010322|Ga0134084_10430222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300010337|Ga0134062_10198117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300010375|Ga0105239_11765584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300010375|Ga0105239_12316179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300010396|Ga0134126_11171464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium855Open in IMG/M
3300010400|Ga0134122_10433506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1171Open in IMG/M
3300010868|Ga0124844_1219853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300011398|Ga0137348_1008554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1532Open in IMG/M
3300012001|Ga0120167_1027967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1360Open in IMG/M
3300012198|Ga0137364_11043817All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300012211|Ga0137377_11819064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300012356|Ga0137371_10064031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2847Open in IMG/M
3300012356|Ga0137371_10576242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium865Open in IMG/M
3300012474|Ga0157356_1007117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300012481|Ga0157320_1008977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300012512|Ga0157327_1031160All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300012896|Ga0157303_10006115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1687Open in IMG/M
3300012899|Ga0157299_10085204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300012905|Ga0157296_10265421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300012911|Ga0157301_10022595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1406Open in IMG/M
3300012915|Ga0157302_10229792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium683Open in IMG/M
3300012960|Ga0164301_11211652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300012971|Ga0126369_12712210All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012977|Ga0134087_10159907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium986Open in IMG/M
3300013763|Ga0120179_1026165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1409Open in IMG/M
3300014031|Ga0120173_1054028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300014150|Ga0134081_10040563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1372Open in IMG/M
3300014265|Ga0075314_1029403All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300014968|Ga0157379_10431925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1214Open in IMG/M
3300015371|Ga0132258_11529310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1685Open in IMG/M
3300017695|Ga0180121_10429814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300018089|Ga0187774_10373937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium857Open in IMG/M
3300018433|Ga0066667_10525938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
3300019255|Ga0184643_1074715All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300020002|Ga0193730_1074084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium966Open in IMG/M
3300021344|Ga0193719_10154381All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300022737|Ga0247747_1037036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300022880|Ga0247792_1015910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1210Open in IMG/M
3300024179|Ga0247695_1000688All Organisms → cellular organisms → Bacteria4917Open in IMG/M
3300024254|Ga0247661_1038408All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300024283|Ga0247670_1043210All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300024347|Ga0179591_1218725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2276Open in IMG/M
3300025898|Ga0207692_10226073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1111Open in IMG/M
3300025905|Ga0207685_10085007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1319Open in IMG/M
3300025905|Ga0207685_10196305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300025911|Ga0207654_10255924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1175Open in IMG/M
3300025914|Ga0207671_10868277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300025922|Ga0207646_10234988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1656Open in IMG/M
3300025928|Ga0207700_10652408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300026277|Ga0209350_1089860All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300026342|Ga0209057_1017609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4136Open in IMG/M
3300026527|Ga0209059_1335809All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300026550|Ga0209474_10693616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300026552|Ga0209577_10864572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300027169|Ga0209897_1066864All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300027637|Ga0209818_1144074All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300027775|Ga0209177_10421492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300027787|Ga0209074_10395614All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027909|Ga0209382_11296080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium738Open in IMG/M
3300028381|Ga0268264_11267435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300028707|Ga0307291_1055630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium957Open in IMG/M
3300028710|Ga0307322_10113674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300028718|Ga0307307_10283316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300028720|Ga0307317_10118208All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300028722|Ga0307319_10264833All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300028807|Ga0307305_10011257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3940Open in IMG/M
3300028819|Ga0307296_10083719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1701Open in IMG/M
3300028824|Ga0307310_10630298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300028880|Ga0307300_10061745All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300028880|Ga0307300_10351157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300028885|Ga0307304_10128978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1037Open in IMG/M
3300030006|Ga0299907_10546216All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300030619|Ga0268386_10251153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1301Open in IMG/M
3300031093|Ga0308197_10277502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300031228|Ga0299914_10500888All Organisms → cellular organisms → Bacteria1049Open in IMG/M
3300031229|Ga0299913_10059335All Organisms → cellular organisms → Bacteria3671Open in IMG/M
3300031820|Ga0307473_11503287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300031938|Ga0308175_101231154Not Available833Open in IMG/M
3300031938|Ga0308175_102443585All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031939|Ga0308174_11958782All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031996|Ga0308176_10975302All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300032003|Ga0310897_10228379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium824Open in IMG/M
3300032013|Ga0310906_11134956All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300032080|Ga0326721_11145706All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032122|Ga0310895_10276597All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300032126|Ga0307415_100875749All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300033233|Ga0334722_10267591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1252Open in IMG/M
3300033412|Ga0310810_10306534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1702Open in IMG/M
3300033412|Ga0310810_11206226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300033551|Ga0247830_10687617All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300033551|Ga0247830_10793563All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300034820|Ga0373959_0146180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.49%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.33%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.33%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.91%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.16%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.16%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.16%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.58%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.58%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.58%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.58%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.58%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.58%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.58%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.58%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.58%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.58%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.58%
Switchgrass, Maize And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.58%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.58%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2044078002Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, ILHost-AssociatedOpen in IMG/M
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005889Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300009812Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60EnvironmentalOpen in IMG/M
3300009819Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012512Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510Host-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014031Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017695Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2)EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027169Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MGR_12001602044078002Switchgrass, Maize And Miscanthus RhizosphereMTSAIELAERAVAAADGDGVEAIVQAEHSGFARFA
GPINP_013468402065487018SoilVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEV
4MG_050543802170459019Switchgrass, Maize And Mischanthus LitterVSALEIALRALDVAGGDTEALVHAERSGMARFAASEVHQPTLIENTIVQLRVASNGN
JGI11643J12802_1151521713300000890SoilVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSE
Ga0055455_1020920613300003990Natural And Restored WetlandsMSALELARRALAAAGEHAEVVVQSERSGLARFAASEVHQPTLIEN
Ga0055472_1018643113300003998Natural And Restored WetlandsVREAPEALELAARAVAAAEGDEVDALAHRERSGLARFAASVVHQPTLVEDASVT
Ga0055488_1014107013300004070Natural And Restored WetlandsVSRALDLAERAVKAAEGDEADVSVHVERSGFARFAASAVHQPTLISDE
Ga0066672_1065692523300005167SoilVTDALDLAQRALRAAEGDEALALANSERSGLARFAGSEVHQPTLIE
Ga0066683_1069712113300005172SoilVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVF
Ga0066690_1054422913300005177SoilVIDALETAERAVAAAEADEAEAVVLAERSGFARFAASEVHQPTLVEDATVCLRV
Ga0066684_1072989023300005179SoilLETARRALELAQADEAEAVVMAEHSGFARFAGSEVHQPTLVDNVVVTL
Ga0066671_1022428813300005184SoilVTDALETAERAVAAAEADEAEAVVLAERSGFARFAASEVHQPTLVEDATLS
Ga0066675_1020359913300005187SoilLETARRALELAQADEAEAVVMAEHSGFARFAGSEVHQPTLIE
Ga0066675_1033007033300005187SoilVTDALDLAERALRAAEGDEALALANSERSGLARFAGSEVHQPTLIEN
Ga0070676_1065496413300005328Miscanthus RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIEN
Ga0070690_10076400323300005330Switchgrass RhizosphereVTSAIELAERAVAAADGDGVEAIVQAEHSGFARFAGSEVHQPTLIENVSVFVR
Ga0070691_1006757133300005341Corn, Switchgrass And Miscanthus RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENET
Ga0070692_1068734513300005345Corn, Switchgrass And Miscanthus RhizosphereVNALDLAERALRVAEGDEALALVQSERSGMARFAGSEVHQPTLIENCSVVLQ
Ga0070673_10050832213300005364Switchgrass RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVE
Ga0070685_1055167723300005466Switchgrass RhizosphereVNALDLAGRALRVAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVE
Ga0070706_10100790423300005467Corn, Switchgrass And Miscanthus RhizosphereVSGLDIAARALAAASGDEAEAVVTVERFGFARFAGSEVHQPTLVDNVVVTLRVA
Ga0070698_10081497123300005471Corn, Switchgrass And Miscanthus RhizosphereVSGLDIAARALAAARGDEAEAVVTVERFGFARFAGSEVHQPTLVDNVVVTLRVSRDGK
Ga0066697_1006791243300005540SoilVSALELAAQALRCAEGDEALALVQSERSGMARFAGSEVHQP
Ga0070672_10006741313300005543Miscanthus RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIE
Ga0070693_10084574523300005547Corn, Switchgrass And Miscanthus RhizosphereVTSDGRALELAERAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLI
Ga0066707_1071243713300005556SoilVKGALELAERAVAAAEGDGVEAVVQAERSGFARFAGSE
Ga0066698_1074682113300005558SoilVISAIDLAERAVAAAEGDGIEAVVQAERSGVARFAGSEV
Ga0068854_10094080513300005578Corn RhizosphereMSDGRALELADRAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLISDESI
Ga0066706_1020230933300005598SoilVTDALDLAERALRAAEGDEALTLANSERSGLARFAGS
Ga0068861_10220805713300005719Switchgrass RhizosphereVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGS
Ga0075290_105207623300005889Rice Paddy SoilMSALELAERALRVAEGDEAVALVQSERSGMARFAGSEVHQPTL
Ga0066696_1083835223300006032SoilLSHVLDLAARALREAEGDEALVLVHGERSGLARFAGSEVHQ
Ga0066656_1091543713300006034SoilVISAIDLAERAVAAAEGDGIEAVVQAERSGVARFAGSEVHQPTLIENV
Ga0066652_10113422123300006046SoilLSGALDLAERALKAAEGDEALVLVHSERSGLARFAGSEVHQPTLIENEVVELQV
Ga0075432_1019511423300006058Populus RhizosphereMTSAIELAERAVAAADGDGVEAIVQAEHSGFARFAGSEVHQPTLIENVSVFVRV
Ga0070715_1018895823300006163Corn, Switchgrass And Miscanthus RhizosphereVSALDLATRALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVE
Ga0097621_10037487923300006237Miscanthus RhizosphereVTSAIELAERAVAAADGDGVEAVVQAEHSGFARFAGSEVHQPTLIENEVV
Ga0097621_10099416023300006237Miscanthus RhizosphereVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQP
Ga0066665_1083024923300006796SoilVTSALGLAERAVAAAEGDGVEAVVQTERSGFARFAGSEVHQPTLIENVSISL
Ga0066660_1018718323300006800SoilVIDALETAERAVAAAEADEAEAVVLAERSGFARFAA
Ga0079221_1057085713300006804Agricultural SoilMSAIDLAERAVAAAEGDGVEAIVQAERSGFARFAGSEVHQPTLIENVSV
Ga0079220_1140146113300006806Agricultural SoilVNALELAERALRAAEGDEVQALVQSERSGMARFAGSEVHQPTLIENEVVELQ
Ga0075431_10098687723300006847Populus RhizosphereVSAHELAEQALRSADGDEALVVVQSERSGLARFAGSEVHQPTLVENDVVEL
Ga0079215_1039244123300006894Agricultural SoilVIRGERAQALAERAQRKAQGDEADALVHLEESGFARFAGSEVHQPT
Ga0075426_1071669523300006903Populus RhizosphereVIDALELAETAVAAAEGDAAEAVVQTERSGFARFAGSEVHQPTLIE
Ga0075426_1115567613300006903Populus RhizosphereVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVE
Ga0075424_10163977723300006904Populus RhizosphereMSESTLELADRALAGAEGDQVEAVVQSERSGFARFADSEVHQPTLIEDAVV
Ga0075436_10066198223300006914Populus RhizosphereVTEALELAQRALRAAEGDEALVLVNSERSGLARFAGSEVHQPTLIENEVVE
Ga0074063_1391599413300006953SoilVSALELAGRALQAVEGDDALALVQTERSGMARFAGSEVHQPTLIE
Ga0075435_10094857813300007076Populus RhizosphereVSEALELAARLLSAAEGDEALALVHRERSGLARFARSEVHQPTLIEND
Ga0066710_10019854613300009012Grasslands SoilVNGQALDLAERALRSAEGDEAFALVQRERSGMARFAGSEVH
Ga0066710_10389983223300009012Grasslands SoilLSDTLDLAQRALRAAEGDEALALANSERSGLARFAGS
Ga0111539_1068667123300009094Populus RhizosphereMSEALELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPTLIDNQLVTLR
Ga0105245_1131109913300009098Miscanthus RhizosphereVTNAIDLAERAVASAEGDGAEAVVQTEHSGFARFAGS
Ga0075418_1139580513300009100Populus RhizosphereVIDALELAETAVAAAEGDAAEAVVQTERSGFARFAGSEVHQPTLIENVTI
Ga0066709_10325442823300009137Grasslands SoilVSRGLELAERAVRAAEGDEAQAIVRRERSGLARYASSEVHQP
Ga0105243_1103459813300009148Miscanthus RhizosphereMRPLELARRALEVAGAHAEVVVNRERWGMARFAASEVHQPTLVEDATLSLRVVRDGKV
Ga0105243_1139980823300009148Miscanthus RhizosphereVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVS
Ga0111538_1070378213300009156Populus RhizosphereVSEALELAGRLLSAAEGDEALALVHRERSGLARFAR
Ga0111538_1289230513300009156Populus RhizosphereMSEALELAQRACGLCEGDQAEAVVQREHSGFARFAASRVHQPTLIDNQLVTLRIVRGDR
Ga0075423_1293698513300009162Populus RhizosphereMSESALELADRALAGAEGDQVEAVVQSERSGFARFADSEVHQPTLIEDAVVQLR
Ga0105237_1072950813300009545Corn RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVELQVV
Ga0126374_1064865823300009792Tropical Forest SoilVSLLELAERALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIEN
Ga0105071_102815523300009808Groundwater SandVSEGRALELAERAWRAAEGDAADAFVHVEESGFARFASSEVHQPTLVRDE
Ga0105067_108587623300009812Groundwater SandVSRALELAERACRAAEGDEADALAHVEESGFARFAGSEVHQPTL
Ga0105087_109668613300009819Groundwater SandVSRALDLAERAVRTAEGDEADASVHVERSGFARFADSAVHQPTLVR
Ga0126313_1002032913300009840Serpentine SoilVSESALELAQRALAAAEGDQSEVVVQSERSGFARFADSEVHQPTLIENAVVQLRV
Ga0131077_1047594013300009873WastewaterMNGAGDAALELAEQAWQTADGDAADALVQVERSGLARFAASQVHQ
Ga0126309_1010821223300010039Serpentine SoilVSEALELAHRLLGAAEGEQALALVHSERSGMARFARSEVH
Ga0126308_1019472323300010040Serpentine SoilVSESALELAQRALAAADGDQAEVVVQSERSGFARFADSEVHQPTLIENAVVQLR
Ga0126310_1115557823300010044Serpentine SoilMSALELAERALAAARGDAIEVVVQTERSGFARFAGSEVHQPTLVENESVSVRVVRDR
Ga0134070_1036621423300010301Grasslands SoilLSHVLDLAERALKAAEGDEALVLAHSERSGLARFAGSEVHQPTLIEN
Ga0134067_1013848713300010321Grasslands SoilVSRGLELAERAVRAAEGDEAQAIVRRERSGLARYASSEVHQPTLVENEVVEL
Ga0134067_1043045223300010321Grasslands SoilVKGALELAERAVAAAEGDGVEAVVQAERSGFARFAGSEVHQPTLIE
Ga0134084_1010929823300010322Grasslands SoilVSRGLELAERAVRAAEGDEAQAIVRRERSGLARYASSE
Ga0134084_1043022213300010322Grasslands SoilVTRALEIAERAVAAADGDGVEAVVQAERSGFARFAGSEVHQPTLIENSSVFLRVI
Ga0134062_1019811723300010337Grasslands SoilVTNALELAERAVAAAKGDGVEAVVQAERSGFARFAGSEVHQPTLIENVSVFLR
Ga0126377_1112955713300010362Tropical Forest SoilVSETLELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPTLIDNQLVTLRIVRGD
Ga0105239_1176558413300010375Corn RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEV
Ga0105239_1231617913300010375Corn RhizosphereVKALDLAGRALRVAEGDEALALVQSERSGMARFAGSE
Ga0134126_1117146413300010396Terrestrial SoilVSEALELAGRLLRAAEGDEAFALVQSERSGLARFARSEVHQPTLIENDVLELQ
Ga0134122_1043350613300010400Terrestrial SoilVTRALELAEQAIAAVEGDAADAVIQTERSGFARFAGSEVHQPTLIENESISLRV
Ga0124844_121985323300010868Tropical Forest SoilVSHAVELAERALRAVDGDEAEAVVHADRSGLARAASSEVHQPTLIENTTVTV
Ga0137348_100855423300011398SoilLTRAIDLAERAVKAAEGDEADASVHVESSGFARFA
Ga0120167_102796733300012001PermafrostVSLELARRALEAAGGDAEAVVQSERSGFARFADSEVHQPTLVANTVVQLR
Ga0137364_1104381723300012198Vadose Zone SoilLSSALDLAERALKAVEGDEALVLVHSERSGLARFAGSEVHQPTLI
Ga0137377_1181906413300012211Vadose Zone SoilLSEALELAERALRAAEGDEALAFVSSERSGLARFAGSEVHQPTLIENEVVE
Ga0137371_1006403113300012356Vadose Zone SoilLSAAELAQRALQAAEGDEALALVQGERSGMARFAGSEVHQPTLIENEVV
Ga0137371_1057624223300012356Vadose Zone SoilVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVFLRVIR
Ga0157356_100711723300012474Unplanted SoilVSTLELAQRALRAAEGDEALALVQSERSGMARFAGSEVHQPTLIDN
Ga0157320_100897713300012481Arabidopsis RhizosphereVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVELQVV
Ga0157327_103116013300012512Arabidopsis RhizosphereVSALELAERALRAAEGDEALALVQSERSGMARFARSEVHQPTLIENDV
Ga0157303_1000611513300012896SoilVSALDLAEQALRSADGDEALVVVQSERSGLARFAGSEVHQPTLVENDV
Ga0157299_1008520423300012899SoilVSALDLAEQALRSADGDEALVVVQSERSGLARFAGSE
Ga0157296_1026542113300012905SoilVSALELAERALRAAEGDEALALVQSERSGMARFAGSEVHQP
Ga0157301_1002259523300012911SoilVSALDLAEQALRSADGDEALVVVQSERSGLARFAGSEVHQP
Ga0157302_1022979223300012915SoilVTSALDLAERAVAAAEGDGVDAIVQAERSGFARFAGS
Ga0164303_1135539923300012957SoilVKALDLAERALRVAEGDEALALVQSERSGMASFAGSAVHQPTLIETEVVELQVV
Ga0164301_1121165223300012960SoilVTSAIDLAERAVARAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENV
Ga0126369_1271221013300012971Tropical Forest SoilVSALELAERALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVE
Ga0134087_1015990713300012977Grasslands SoilMDALELAQRAVRAAEGDEALALVNRERSGQARFAGSEVHQPTLIENEVIELQ
Ga0120179_102616513300013763PermafrostVSLELARRALEAAGGDAEAVVQSERSGFARFADSEVHQPTLVANT
Ga0120123_101993813300013770PermafrostMSALELAERALEFGRRGDGVEAVVHRELSGLARFAGAE
Ga0120173_105402813300014031PermafrostVSLELARRALEAAGGDAEAVVQSERSGFARFADSEVHQPTLVANTVVQLRI
Ga0134081_1004056313300014150Grasslands SoilVTSVLELAERAVAAAEGDGVEAVVQAERSGFARFVG
Ga0075314_102940323300014265Natural And Restored WetlandsVREAPEALELAARAVAAAEGDEVDALAHRERSGLARFAASVV
Ga0157379_1043192523300014968Switchgrass RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVELQVVR
Ga0132258_1152931023300015371Arabidopsis RhizosphereVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIEN
Ga0180121_1042981423300017695Polar Desert SandVSDDAREIASRALRAVDGGDAEAHVLSERSGLARFASSEVHQPTLIENCVV
Ga0187774_1037393723300018089Tropical PeatlandLSRALELAERALRAAEGDEALALVQREVSGLARFAGSEVHQ
Ga0066667_1052593823300018433Grasslands SoilVINALELAERAVAAAEGDGLEAVVQAERSGFARFAGSEVHQPTLIENVSV
Ga0184643_107471513300019255Groundwater SedimentVSESSRALELAERACRATEGDEADALVHAQRSGFARFADSVVHQP
Ga0193730_107408413300020002SoilVTSALELAERAVAAAEGDGVEAVVQAERSGFARFAGSEVHQPTLIE
Ga0193719_1015438123300021344SoilVSALELAGKALQAVEGDEALALVQSERSGMARFARSEVHQPTLIENETVELQ
Ga0247747_103703623300022737SoilVSALDLAEQALRSADGDEALVVVQSERSGLARFAGSEVHQPT
Ga0247792_101591023300022880SoilVSALDLAEQALRSADGDEALVVVQSERSGLARFAG
Ga0247695_100068813300024179SoilVSALDLAARALRAVEGDEAQALVQSERSGMARFAGSE
Ga0247661_103840813300024254SoilVSALDLAARALRAAESDEAQALVQSERSGMARFAGSEVH
Ga0247670_104321013300024283SoilVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPT
Ga0179591_121872543300024347Vadose Zone SoilVTRALELAERAVAAAEGDAVEAVVQAERSGFARFAGSEVHQPT
Ga0207692_1022607313300025898Corn, Switchgrass And Miscanthus RhizosphereVSALDLATRALRAAEGDEAQALVQSERSGMARFAGSEVHQ
Ga0207685_1008500713300025905Corn, Switchgrass And Miscanthus RhizosphereVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVELQVVR
Ga0207685_1019630513300025905Corn, Switchgrass And Miscanthus RhizosphereVTRALELAERAVAAAEGDAVEAVVQAERSGFARFAGSEVHQPTLIENESV
Ga0207654_1025592413300025911Corn RhizosphereVTSAIELAERAVAAADGDDVEAVVQAEHSGFARFAGSEVHQPTLIENVSV
Ga0207671_1086827723300025914Corn RhizosphereVSALELAGKALQAAEGDEALALVQSERSGMARFAGSEVHQPTLIENETV
Ga0207646_1023498823300025922Corn, Switchgrass And Miscanthus RhizosphereVTRALELAERAVAAAEGDAVEAVVQAERSGFARFAGSEVHQPTLIENESVFIRVI
Ga0207700_1065240813300025928Corn, Switchgrass And Miscanthus RhizosphereVSALDLAARALRAAEGDEAQALVQSERSGMARFAGSEVHQPTLIENEVVEL
Ga0209350_108986013300026277Grasslands SoilLSQALDLAERALAAAEGDEAMVLVHSERSGLARFAG
Ga0209057_101760933300026342SoilVTNALELAERAVAAAKGDGVEAVVQAERSGFARFAGSTNRR
Ga0209059_133580923300026527SoilVIDALETAERAVAAAEADEAEAVVLAERSGFARFAGSEVHQPTLVE
Ga0209474_1069361613300026550SoilVTDALELAAEAVAAAEGDVAEALVQTERSGFARFAGSEVHQP
Ga0209577_1086457213300026552SoilVIDALETAERAVAAAEADEAEAVVLAERSGFARFAGSEVHQPTLVEDVSVSLRLVV
Ga0209897_106686423300027169Groundwater SandVSRALELAERACRAAEGDEADALAHVEESGFARFAGSEVHQPTLI
Ga0209818_114407413300027637Agricultural SoilVSRALELAERAVRAAEGDEADASVHVERSGFARFADSAVHQPTLIRDES
Ga0209177_1042149223300027775Agricultural SoilVSALDLAARALRATEGDEAQALVQSERSGMARFAGSEVHQPTLIENE
Ga0209074_1039561423300027787Agricultural SoilVNALDLAERALGVAEGDEALALVQSERSGMARFAGSEVHQPTLIENETVEL
Ga0209382_1129608013300027909Populus RhizosphereMSESALELADRALAGAEGDQVEAVVQSERSGFARFADSEVHQPTLIED
Ga0268264_1126743523300028381Switchgrass RhizosphereVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVFLRVI
Ga0247822_1088187823300028592SoilVSDALELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPTLIDNQLVTLRIVRGDRHGSA
Ga0307291_105563013300028707SoilVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQPTLIENVSVFLRV
Ga0307322_1011367413300028710SoilMSERLELAKRALRAAEGDETLALVHHERSGMARFASSEVHQPTLIENDVV
Ga0307307_1028331613300028718SoilVTSALELAERAVAAAEGDGVEAVVQAERSGFARFAGSEVHQPTLIENESVFLRVIR
Ga0307317_1011820813300028720SoilVSEALELAGRLLRAAEGDEALALVQSERSGLARFAR
Ga0307319_1026483313300028722SoilMSELLELAQRALRAAEGDETLALVHHERSGMARFASSEVHQPTLI
Ga0307305_1001125713300028807SoilVTSAIDLAERAVAAAEGDGAEAVVQTEHSGFARFAGSEVHQ
Ga0307296_1008371923300028819SoilMSEALDLAHHVLGAAEGEQALALVHSERSGMARFARSEVHQPTLIENDVL
Ga0307310_1063029813300028824SoilVTSALELAERAVAAAEGDGVEAVVQAERSGFARFAG
Ga0307300_1006174513300028880SoilMSEALDLAHHVLGAAEGEQALALVHSERSGMARFARSEVHQ
Ga0307300_1035115713300028880SoilVSALELAGKALQAVEGDEALALVQSERSGMARFAGSEVHQPTLIENEVVELQI
Ga0307304_1012897823300028885SoilVSETLELAHRLLGAAEGEQALALVHSERSGMARFACSE
Ga0299907_1054621613300030006SoilVREAPEALELAARAVRAAEGDGVDALVHRERSGLARFAASVVHQPT
Ga0268386_1025115323300030619SoilVREAPEALELATRAVAAAEGDEVDALVHRERSGLARFAASVVHQP
Ga0308197_1027750223300031093SoilVTRALELAEQAIAAAEGDAAEAVIQTERSGFARFAGSEVHQPTLIEN
Ga0299914_1050088813300031228SoilVREAPEALELAARAVRAAEGDEVDALVHRERSGLARFAASVV
Ga0299913_1005933533300031229SoilVREAPEALELAARAVAAAEGDEVDALAHRERSGLARFAASVVHQ
Ga0307473_1150328723300031820Hardwood Forest SoilVSEGLELAERAVRAAEGDEAQAIVRRERSGLARYAASEVHQPT
Ga0308175_10123115413300031938SoilMTSLDLAAEALRFAEADEADVFVHRERSGLARFATSVQHQPTLIENQVVTLRV
Ga0308175_10244358523300031938SoilVTRALELAERAVAAADGDGVEAVVQAEHSGFARFAGSEVHQPTLI
Ga0308174_1195878223300031939SoilVSEALELAGRLLGAAEGEEALAIVHSERSGLARFARSEV
Ga0308176_1097530213300031996SoilVSEGLELAQRALAALDGDEADVLVEAERSGLARFASSRVHQPTLIENAVVTVR
Ga0310897_1022837913300032003SoilVTSAIELAERAVAAADGDGVEAVVQAEHSGFARFAGSEV
Ga0310906_1113495613300032013SoilVTSDGRALELADRAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLIS
Ga0326721_1114570613300032080SoilVTSDGRALELAERAWRAAEADEADAVAQLEESGFARFAASEVHQPTLI
Ga0310895_1027659723300032122SoilVSRALDLAERAVRASEGDEADASVHVERSGFARFAASAVHQPTLIRDESVT
Ga0307415_10087574913300032126RhizosphereVSALDLAERALRAAEGDEAVALVQSERSGMARFARSEVHQPSLIET
Ga0334722_1026759113300033233SedimentMSRALELAEQALKLAEGDESDAVARTERSGLARFAGSEVHQPTLIADEGVT
Ga0310810_1030653433300033412SoilVSALDLAEQALGSADGDEALVVVQSERSGLARFAGSE
Ga0310810_1120622623300033412SoilMDALELAQRAVSVAEADETLALVNRERSGQARFAGSEVHQPTL
Ga0247830_1068761713300033551SoilVSDALELAQRACGLCEGDQAEAVVQRERSGFARFAASRVHQPT
Ga0247830_1079356313300033551SoilVSEALELAGRLLRVTEGDGALALVLSERSGLARFARSEVHQPTLIEHV
Ga0326723_0145401_876_10403300034090Peat SoilLSAVLELAERALRAAEGDEALAIVQRELSGMARYACSEVHQPTLIENEVVELQVV
Ga0373959_0146180_449_5953300034820Rhizosphere SoilMSDGRALELADRAWRAAEADEADAVVQVEESGFARFAGSEVHQPTLISD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.