NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035521

Metagenome / Metatranscriptome Family F035521

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035521
Family Type Metagenome / Metatranscriptome
Number of Sequences 172
Average Sequence Length 42 residues
Representative Sequence IKPGEEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQIEAA
Number of Associated Samples 113
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 39.88 %
% of genes near scaffold ends (potentially truncated) 37.79 %
% of genes from short scaffolds (< 2000 bps) 85.47 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (69.186 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.605 % of family members)
Environment Ontology (ENVO) Unclassified
(23.256 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.140 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.88%    Coil/Unstructured: 69.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF13473Cupredoxin_1 2.92
PF14019DUF4235 2.34
PF00571CBS 1.75
PF07885Ion_trans_2 1.17
PF00565SNase 1.17
PF04545Sigma70_r4 1.17
PF07366SnoaL 1.17
PF03793PASTA 1.17
PF00989PAS 0.58
PF00912Transgly 0.58
PF14572Pribosyl_synth 0.58
PF02494HYR 0.58
PF03795YCII 0.58
PF14446Prok-RING_1 0.58
PF00140Sigma70_r1_2 0.58
PF08281Sigma70_r4_2 0.58
PF13602ADH_zinc_N_2 0.58
PF04542Sigma70_r2 0.58
PF00392GntR 0.58
PF00589Phage_integrase 0.58
PF13668Ferritin_2 0.58
PF13560HTH_31 0.58
PF13229Beta_helix 0.58
PF04906Tweety 0.58
PF04326AlbA_2 0.58
PF07690MFS_1 0.58
PF10083DUF2321 0.58
PF05103DivIVA 0.58
PF00300His_Phos_1 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.17
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.58
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.58
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.58
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.58
COG2865Predicted transcriptional regulator, contains HTH domainTranscription [K] 0.58
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.58
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.58
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A69.19 %
All OrganismsrootAll Organisms30.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig70108Not Available743Open in IMG/M
2170459002|F0B48LX02HPNDANot Available541Open in IMG/M
2170459003|FZ032L002HVOPWNot Available523Open in IMG/M
2170459023|GZGNO2B01DCPDOAll Organisms → cellular organisms → Bacteria513Open in IMG/M
2189573000|GPBTN7E01BQZYJNot Available521Open in IMG/M
2189573001|GZR05M101A050VNot Available514Open in IMG/M
2189573002|GZIGXIF02IR83ONot Available531Open in IMG/M
2189573003|GZIR7W402JEBQZNot Available548Open in IMG/M
3300000956|JGI10216J12902_100671097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2029Open in IMG/M
3300000956|JGI10216J12902_114602920Not Available806Open in IMG/M
3300001535|A3PFW1_10533175Not Available806Open in IMG/M
3300001535|A3PFW1_10615084Not Available512Open in IMG/M
3300001536|A1565W1_10036262All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300001536|A1565W1_10083813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2589Open in IMG/M
3300002568|C688J35102_118903785Not Available611Open in IMG/M
3300002568|C688J35102_120949224All Organisms → cellular organisms → Bacteria2854Open in IMG/M
3300004114|Ga0062593_100578279Not Available1065Open in IMG/M
3300004156|Ga0062589_100206203All Organisms → cellular organisms → Bacteria → Terrabacteria group1425Open in IMG/M
3300004156|Ga0062589_100929386Not Available804Open in IMG/M
3300004157|Ga0062590_100492889Not Available1041Open in IMG/M
3300004157|Ga0062590_100666759Not Available929Open in IMG/M
3300004157|Ga0062590_101909706Not Available613Open in IMG/M
3300004479|Ga0062595_100089951Not Available1589Open in IMG/M
3300004479|Ga0062595_100571347Not Available872Open in IMG/M
3300004479|Ga0062595_101335635Not Available648Open in IMG/M
3300004480|Ga0062592_101370077Not Available672Open in IMG/M
3300004480|Ga0062592_102431330Not Available526Open in IMG/M
3300004643|Ga0062591_100032655All Organisms → cellular organisms → Bacteria2742Open in IMG/M
3300005178|Ga0066688_10940845Not Available530Open in IMG/M
3300005184|Ga0066671_10293714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300005332|Ga0066388_103113954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300005332|Ga0066388_105231861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300005337|Ga0070682_100316278Not Available1151Open in IMG/M
3300005337|Ga0070682_101879701Not Available524Open in IMG/M
3300005434|Ga0070709_10009955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5255Open in IMG/M
3300005434|Ga0070709_10035653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3024Open in IMG/M
3300005434|Ga0070709_10307125Not Available1160Open in IMG/M
3300005434|Ga0070709_10330322Not Available1121Open in IMG/M
3300005434|Ga0070709_10672078Not Available803Open in IMG/M
3300005435|Ga0070714_100724248Not Available961Open in IMG/M
3300005439|Ga0070711_100022572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter4080Open in IMG/M
3300005439|Ga0070711_100093480Not Available2172Open in IMG/M
3300005529|Ga0070741_11350354Not Available594Open in IMG/M
3300005535|Ga0070684_101241461Not Available701Open in IMG/M
3300005553|Ga0066695_10307427Not Available999Open in IMG/M
3300005614|Ga0068856_102690517Not Available503Open in IMG/M
3300005764|Ga0066903_100557197Not Available1968Open in IMG/M
3300005764|Ga0066903_100725101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1759Open in IMG/M
3300005764|Ga0066903_100876308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1620Open in IMG/M
3300005764|Ga0066903_100981681Not Available1541Open in IMG/M
3300005764|Ga0066903_101262261Not Available1377Open in IMG/M
3300005764|Ga0066903_103191308Not Available887Open in IMG/M
3300006046|Ga0066652_100339830Not Available1347Open in IMG/M
3300006059|Ga0075017_100041217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3074Open in IMG/M
3300006059|Ga0075017_100524944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia900Open in IMG/M
3300006059|Ga0075017_101237600All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300006102|Ga0075015_100624304Not Available633Open in IMG/M
3300006163|Ga0070715_10138330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1180Open in IMG/M
3300006173|Ga0070716_100098672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1785Open in IMG/M
3300006175|Ga0070712_100528976Not Available991Open in IMG/M
3300006175|Ga0070712_100834515Not Available792Open in IMG/M
3300006175|Ga0070712_101445842Not Available600Open in IMG/M
3300006800|Ga0066660_11413208Not Available546Open in IMG/M
3300006871|Ga0075434_100062752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3699Open in IMG/M
3300009012|Ga0066710_103281355Not Available619Open in IMG/M
3300009098|Ga0105245_12203402Not Available605Open in IMG/M
3300009137|Ga0066709_100263577All Organisms → cellular organisms → Bacteria2316Open in IMG/M
3300009174|Ga0105241_11985680Not Available572Open in IMG/M
3300009177|Ga0105248_12524661Not Available586Open in IMG/M
3300009553|Ga0105249_12842198Not Available555Open in IMG/M
3300010154|Ga0127503_10703056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
3300010154|Ga0127503_10994324Not Available554Open in IMG/M
3300010321|Ga0134067_10211348Not Available717Open in IMG/M
3300010360|Ga0126372_10278290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1455Open in IMG/M
3300010366|Ga0126379_13516726Not Available525Open in IMG/M
3300010373|Ga0134128_11028136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium910Open in IMG/M
3300010373|Ga0134128_11713061Not Available692Open in IMG/M
3300010373|Ga0134128_12870981Not Available531Open in IMG/M
3300010375|Ga0105239_12682562Not Available581Open in IMG/M
3300010398|Ga0126383_11599752Not Available741Open in IMG/M
3300010401|Ga0134121_10371487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1284Open in IMG/M
3300011994|Ga0120157_1052822All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300011996|Ga0120156_1102641All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012199|Ga0137383_10546962Not Available847Open in IMG/M
3300012199|Ga0137383_11363977Not Available503Open in IMG/M
3300012200|Ga0137382_10305128Not Available1111Open in IMG/M
3300012200|Ga0137382_10974862Not Available609Open in IMG/M
3300012201|Ga0137365_10770938Not Available702Open in IMG/M
3300012201|Ga0137365_10888646Not Available650Open in IMG/M
3300012206|Ga0137380_10235623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1653Open in IMG/M
3300012207|Ga0137381_10901835Not Available764Open in IMG/M
3300012208|Ga0137376_11019340Not Available709Open in IMG/M
3300012208|Ga0137376_11106626Not Available677Open in IMG/M
3300012209|Ga0137379_11772972Not Available512Open in IMG/M
3300012211|Ga0137377_10231095Not Available1776Open in IMG/M
3300012351|Ga0137386_11236030Not Available521Open in IMG/M
3300012356|Ga0137371_10457937Not Available987Open in IMG/M
3300012359|Ga0137385_11143951Not Available639Open in IMG/M
3300012359|Ga0137385_11251489Not Available604Open in IMG/M
3300012951|Ga0164300_10010836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2859Open in IMG/M
3300012951|Ga0164300_10011700Not Available2789Open in IMG/M
3300012955|Ga0164298_10835803Not Available663Open in IMG/M
3300012955|Ga0164298_11055279Not Available605Open in IMG/M
3300012957|Ga0164303_10001827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5958Open in IMG/M
3300012957|Ga0164303_10454568Not Available807Open in IMG/M
3300012957|Ga0164303_10521656Not Available765Open in IMG/M
3300012957|Ga0164303_11146247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300012957|Ga0164303_11479565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Virgisporangium → Virgisporangium ochraceum512Open in IMG/M
3300012958|Ga0164299_10660708Not Available725Open in IMG/M
3300012960|Ga0164301_10090743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1723Open in IMG/M
3300012960|Ga0164301_10234801All Organisms → cellular organisms → Bacteria1193Open in IMG/M
3300012960|Ga0164301_10873869Not Available695Open in IMG/M
3300012960|Ga0164301_10997130Not Available658Open in IMG/M
3300012961|Ga0164302_10014098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3259Open in IMG/M
3300012961|Ga0164302_10014098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3259Open in IMG/M
3300012961|Ga0164302_10446354Not Available897Open in IMG/M
3300012961|Ga0164302_10718476Not Available743Open in IMG/M
3300012975|Ga0134110_10431132Not Available590Open in IMG/M
3300012984|Ga0164309_10289655Not Available1175Open in IMG/M
3300012984|Ga0164309_10642406Not Available834Open in IMG/M
3300012984|Ga0164309_10914129Not Available716Open in IMG/M
3300012985|Ga0164308_10646439Not Available905Open in IMG/M
3300012985|Ga0164308_10862964Not Available794Open in IMG/M
3300012986|Ga0164304_11752152Not Available519Open in IMG/M
3300012987|Ga0164307_10259008Not Available1218Open in IMG/M
3300012988|Ga0164306_10116684Not Available1770Open in IMG/M
3300012988|Ga0164306_10454887Not Available975Open in IMG/M
3300012988|Ga0164306_11922132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300012989|Ga0164305_10291749Not Available1201Open in IMG/M
3300013296|Ga0157374_10306509Not Available1572Open in IMG/M
3300013297|Ga0157378_11191791Not Available801Open in IMG/M
3300013763|Ga0120179_1007093All Organisms → cellular organisms → Bacteria3044Open in IMG/M
3300014968|Ga0157379_12293199Not Available537Open in IMG/M
3300014969|Ga0157376_11234261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300014969|Ga0157376_12419255Not Available565Open in IMG/M
3300015374|Ga0132255_101131880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1177Open in IMG/M
3300015374|Ga0132255_101326422Not Available1086Open in IMG/M
3300018433|Ga0066667_11162644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium670Open in IMG/M
3300018433|Ga0066667_12035303Not Available529Open in IMG/M
3300018468|Ga0066662_10540037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1074Open in IMG/M
3300019361|Ga0173482_10176896Not Available855Open in IMG/M
3300019361|Ga0173482_10584003All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300020075|Ga0206349_1391427Not Available1078Open in IMG/M
3300020080|Ga0206350_10835087Not Available639Open in IMG/M
3300021560|Ga0126371_11723814Not Available750Open in IMG/M
3300022467|Ga0224712_10331393Not Available717Open in IMG/M
3300023077|Ga0247802_1069053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300024055|Ga0247794_10075204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium968Open in IMG/M
3300025900|Ga0207710_10668663Not Available544Open in IMG/M
3300025915|Ga0207693_10448160Not Available1008Open in IMG/M
3300025917|Ga0207660_11119296Not Available641Open in IMG/M
3300025922|Ga0207646_10001396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia29960Open in IMG/M
3300025927|Ga0207687_10074152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2438Open in IMG/M
3300025928|Ga0207700_10064139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella mangrovi2797Open in IMG/M
3300025929|Ga0207664_10052412Not Available3226Open in IMG/M
3300025929|Ga0207664_10722426Not Available896Open in IMG/M
3300025929|Ga0207664_11087480Not Available715Open in IMG/M
3300025939|Ga0207665_10372857All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300025941|Ga0207711_11609815Not Available593Open in IMG/M
3300026008|Ga0208529_1016744Not Available678Open in IMG/M
3300026095|Ga0207676_10199738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1766Open in IMG/M
3300026142|Ga0207698_11735941Not Available639Open in IMG/M
3300026325|Ga0209152_10328013Not Available579Open in IMG/M
3300027821|Ga0209811_10139814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium892Open in IMG/M
3300027894|Ga0209068_10285340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae924Open in IMG/M
3300028881|Ga0307277_10186631Not Available906Open in IMG/M
3300031910|Ga0306923_12437779Not Available518Open in IMG/M
3300032892|Ga0335081_12615342Not Available518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.07%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.49%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.33%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil2.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.74%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.74%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.16%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.16%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.16%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.16%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.16%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.16%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.16%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.58%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
2189573003Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011994Permafrost microbial communities from Nunavut, Canada - A7_65cm_12MEnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026008Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0108.000045802166559005SimulatedEVLYGNGRRFRVLDVVPFEEEDESPFVGLLQVEAA
E1_021681302170459002Grass SoilMLIKPGEEIIAGSNQRFRVLDVVPFEEDAESPFVGLLQVEAA
E4A_083513002170459003Grass SoilMIHAGEEIHLGAGQRFRVIDVVPFKEEDESPFVGLLQVEAAY
FA3_000694102170459023Grass SoilMIQPGEEILLGAGRTFRVLDVVPFEEDESSFVGLLQVEAVSV
N55_020692802189573000Grass SoilMIQPGEEIIAGNAQHFRVLDLVPFAEEDESPFVGLLQVEVA
FD2_041687402189573001Grass SoilMMIKPAEEIIAGINQRFRVLDVVPFEEEDESPFVGMLQVEVA
FE1_077724202189573002Grass SoilMMIKPEEILLGAGRRFRVLTVVPFEEEDESPFVGLLRVDTA
FE2_077565402189573003Grass SoilVQLVELPVAMMIKPGEEIQFGGGRRFRVLDVLTFEEEDESPLVGLLQVEAA
JGI10216J12902_10067109713300000956SoilMDPPPDEEIIAGNNQRFCVLHVGPFDEEDESPFVGLLQVEAA*
JGI10216J12902_11460292013300000956SoilMRARQPTQVMIHPGQEILFDNGRRFPVLAVVPFEEEDESPFVGLLQ
A3PFW1_1053317513300001535PermafrostATYAVMIKPGEEILFGAGRRFRVLVVVPFGEEDDSPFVGLLQVEAA*
A3PFW1_1061508413300001535PermafrostMITPREEILVGNGRRFRVLALVPVDDEESRFVGLLQVEAA*
A1565W1_1003626213300001536PermafrostTYAIMIQPGEEILFGKADASAVLDVVPFEEEESPFVGLLQVEAV*
A1565W1_1008381343300001536PermafrostVIVKPGEEILVGNGRRFRVLDVVAFEEEDESPFVGLLKVEAA*
C688J35102_11890378513300002568SoilQMIHLGDEIHLGAGQRFRVLDVVPFEEEDSPFVGLLQVEPA*
C688J35102_12094922423300002568SoilMIHLGHEIHVGAGQRFRVLAVVPFEEEDESPFVGLLQVEAARDS*
Ga0062593_10057827933300004114SoilMRARQPTQVMIHPGQEILVGNGRRFRVLDVVPFEDEDESPFVGLLKVEAA*
Ga0062589_10020620323300004156SoilMMIQPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVARPAPE*
Ga0062589_10092938613300004156SoilGEATYAMMIQPGGEIHGSGGQRLRVLDVPMFDEEDESPFVGLLQVEAT*
Ga0062590_10049288913300004157SoilDLGEATYAMMIQPGGEIHGSGGQRLRVLDVPMFDEEDESPFVGLLQVEAT*
Ga0062590_10066675933300004157SoilRPREEILVGNGRRFRVVDVVPFEEEDESPLVGMLKVEVA*
Ga0062590_10190970613300004157SoilMIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAV*
Ga0062595_10008995133300004479SoilVIHIGDEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQIEAA*
Ga0062595_10057134713300004479SoilMIHPDEEIVAGDDQHFRVLDVVPFEEEDESPFVGLLQVEAA*
Ga0062595_10133563513300004479SoilVTYAALIRPGEEILVGNGRRFHVLDVVPFDEEDESTFVRLLQVEAALAGL*
Ga0062592_10137007713300004480SoilMMIHPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVERPAPE*
Ga0062592_10243133013300004480SoilMIQPGEEIHLGAGQRFRVLDLVPFEEKDESPFVGLLRVEAA*
Ga0062591_10003265543300004643SoilMMIQPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVERPAPE*
Ga0066688_1094084513300005178SoilMIKPGEEILVGSGRRFRVLDVVPFEEEDELPSIGLLQVEAA*
Ga0066671_1029371423300005184SoilMIHPGDEVYVRAAERFRVLDVVPFEEEDESPFVGLLQVEAA*
Ga0066388_10311395413300005332Tropical Forest SoilEATYALMIKPGEEIIGEGTDWFRVIDVVPFDEEDESPFVGC*
Ga0066388_10523186123300005332Tropical Forest SoilEATYALMIKPGEEIIGEGTDWFRVIDVVPFDEEDESPFVGVLTVEAA*
Ga0070682_10031627823300005337Corn RhizosphereVIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFVGLLQVEAA*
Ga0070682_10187970113300005337Corn RhizosphereMIRPGEEIHLGAGQRFRVVDVVPFEEEDESPFVGLLQVAAA*
Ga0070709_1000995553300005434Corn, Switchgrass And Miscanthus RhizosphereMGPRGRRIIAGNNQRFRVLHVVPFDEEDKSPFVGLPQVEAA*
Ga0070709_1003565363300005434Corn, Switchgrass And Miscanthus RhizosphereMMIKPGEEIPSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA*
Ga0070709_1030712523300005434Corn, Switchgrass And Miscanthus RhizosphereMIYPGEEIIAGDNEHFRVLELVPIEEEDESPFVGLLQVEAA*
Ga0070709_1033032213300005434Corn, Switchgrass And Miscanthus RhizosphereRPGEEIHLGAGQRFRVVDVVPFEEEDESPFVGLLQVAAA*
Ga0070709_1067207823300005434Corn, Switchgrass And Miscanthus RhizosphereMMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLLQVEAAYVRSAARET*
Ga0070714_10072424813300005435Agricultural SoilVTYAVLVKPGEEILVVNGRRFRVLDVVPFDGEDESPFVGLIKVEAA*
Ga0070714_10168578523300005435Agricultural SoilEDAPLVRIREELFFGGGRRFRIVDVVIFEEEDGSPFVGLLKVEAA*
Ga0070711_10002257263300005439Corn, Switchgrass And Miscanthus RhizosphereMMIKPGEESTSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA*
Ga0070711_10009348043300005439Corn, Switchgrass And Miscanthus RhizosphereMMIKPGEEIHLGTGQRFRVLDVVPFEDESPFVGLSQVEPA*
Ga0070741_1135035423300005529Surface SoilEASYIQQIKPGEEILYGNGRRFRVLDIAPFDEEDESRFVAMLKVEAT*
Ga0070684_10124146113300005535Corn RhizosphereMDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEA
Ga0066695_1030742713300005553SoilMIGPGDEIYLGAGQRFRVLDVVPFNEEDESPFVGLLRVEAA*
Ga0068856_10269051713300005614Corn RhizosphereNAMMIKPGEEIHGNGGQGLRVVAVVPFEEEDESPFVGLLQVDAA*
Ga0066903_10055719733300005764Tropical Forest SoilMMIKQGEENIAGSAEHFHVVSVVPFEEEDESPFVRC*
Ga0066903_10072510113300005764Tropical Forest SoilEATYAQMIKPGEEIIGDGNQHFLVVDVVPFAEEDESEFVGMLKVETA*
Ga0066903_10087630843300005764Tropical Forest SoilMMIKPGEEIPLDAGQRFRVVAVVPFEEEDESPFVGMLKVEAA*
Ga0066903_10098168123300005764Tropical Forest SoilMLIKPGEEILFGGVRCFRVLDVVPFEENDELGFVGMLTVEAA*
Ga0066903_10126226123300005764Tropical Forest SoilMIKPGEEIHLAAGQRFGVLAVVPFDEEEAPPFVG*
Ga0066903_10319130823300005764Tropical Forest SoilMQIKPDEEIHLGGGQTFRVLDVVSFEEADELGFVGMLKVEAA*
Ga0066652_10033983043300006046SoilMIHPDEEIIARDNQHFPVIDVVPFGDDESPSVGMLKVENA*
Ga0075017_10004121743300006059WatershedsMMIKPGEEILLGAGQRFRVLDLVPFDGDESPFVGLLKIESI*
Ga0075017_10052494413300006059WatershedsAMMIKPGEEIHLGSGQRFCVVDVVLFGEGDELPFVGLLQVEAA*
Ga0075017_10123760023300006059WatershedsMVKPGEEILVGNGRRFRVLDVVPFEEEDSRILRLLKVEAA*
Ga0075015_10062430423300006102WatershedsMMIKPGEEILLGAGQRFRVLDLVPFDGDESPFVGLLKIESV*
Ga0070715_1013833013300006163Corn, Switchgrass And Miscanthus RhizosphereMIKPGEGIHLGAGERFRVLDVVAFGEEDGSPFVGLLQVEAV*
Ga0070716_10009867253300006173Corn, Switchgrass And Miscanthus RhizosphereMMIKPGEETTSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA*
Ga0070712_10052897623300006175Corn, Switchgrass And Miscanthus RhizosphereMIHPGEEIIAGGNQHFRVVDVVMFADEDDSPFVGLLQLEAA*
Ga0070712_10083451523300006175Corn, Switchgrass And Miscanthus RhizosphereLGEATYLSQIRLGEEILFGNGRRLRVVDVVAFDEHEESAYVGMLKVEAA*
Ga0070712_10144584213300006175Corn, Switchgrass And Miscanthus RhizosphereKPGEEIIAGDNRRFRVVDVVPFGEEEESPFVAMRKVDAA*
Ga0066660_1141320813300006800SoilMMIHPGEEIIAGHNQRFRVLAVVPFVKDESPFVGLLQVQAA*
Ga0075434_10006275253300006871Populus RhizosphereMIHLGDEIHLVAGQRFRGVDVVEFDEEDEWPLIGLLQVEATSS*
Ga0066710_10328135523300009012Grasslands SoilMIRPGEEILVGNGRLCRVLDLVSIDEEDSPFVGLLQVEAI
Ga0105245_1220340213300009098Miscanthus RhizosphereIKPGEEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQIEAA*
Ga0066709_10026357743300009137Grasslands SoilMIHPGDEIHLGAGQRFRVLDVVPFEEEDESPFIGLLQVEAAA*
Ga0105241_1198568013300009174Corn RhizosphereMIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEARLPRVRQ*
Ga0105248_1252466113300009177Switchgrass RhizosphereEEIQGNGGQRLRVLAVGPFDEEDESPFVGLLPAEAV*
Ga0105249_1284219813300009553Switchgrass RhizosphereGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAV*
Ga0127503_1070305623300010154SoilMIKPGEEIIAGKNEHFRVVAVIPFGEEDESPFVGLLRVEAA*
Ga0127503_1099432423300010154SoilMEEVAGRAILVGNGRHFRVLAVIPFAEEDESRFVGLLQVEAA*
Ga0134067_1021134823300010321Grasslands SoilMIKPGEEIIAGANERFQVVDVPFEEEDKSPFVGLLQVEAAWRDWSILLLF
Ga0126372_1027829023300010360Tropical Forest SoilMIQPGDEVHVGNGRRFRVLDVVLSEEEDESPFVGLLKVETA*
Ga0126377_1276783713300010362Tropical Forest SoilLRLHAGEEIIADKNQHFRVVAVVPFEGTDELGFVGMLRVESAQT*
Ga0126379_1351672613300010366Tropical Forest SoilMQIKPGEEIIGEGTQWFRVVDVVPFDEEDESPFVGVLTVEAR*
Ga0134128_1102813613300010373Terrestrial SoilKRPTRSVIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFAGLLQVEAA*
Ga0134128_1171306123300010373Terrestrial SoilMMIKPGEEIHLGAGQRFRVVDVVPFEEEDESPFVGL
Ga0134128_1287098123300010373Terrestrial SoilMGPRGRRIIAGNNQRFRVLHVVPFDEEDKSPFVGLLQVGAT*
Ga0105239_1268256213300010375Corn RhizosphereMIEAIHLAADQGFRVIDVIPLDVEDESPFVGLLQVEAA*
Ga0126383_1159975223300010398Tropical Forest SoilMMIQPGEEIIADKNQHFRVVDAVLFDEEDESQFVGLLKVEAA*
Ga0134121_1037148723300010401Terrestrial SoilVIKPGEEIHLVAGQRFRVIDVVPFEEQDASPFVGLLQVEAA*
Ga0120157_105282223300011994PermafrostMITPREEILVGNGRRFRVLALVPVDDEESRFVGLLQV*
Ga0120156_110264123300011996PermafrostVKPGEEILVGNGRRFRVLDVVAFEEEDESPFVGLLRVEAA*
Ga0137383_1054696213300012199Vadose Zone SoilAMMIKTGEEIIAGTNERFRVLDVVPFEEEDESPFVGLLKVEAA*
Ga0137383_1136397723300012199Vadose Zone SoilRVSAPGHEILAGGGRRFRVIDVVPFDEEDESPFVGLLQVEAA*
Ga0137382_1030512813300012200Vadose Zone SoilPGEEIIFVNGRRFRILAVSPFEEEDESPFVGLLQVEAA*
Ga0137382_1097486233300012200Vadose Zone SoilRFLNPILVVGNGRRFRVLAVVPFEDEDESQFVELLQVEAA*
Ga0137365_1077093813300012201Vadose Zone SoilLVKPGEEILVGNGRRFRVLDVVPFDEEDESAFVGLLKVEAA*
Ga0137365_1088864623300012201Vadose Zone SoilMMIKPGEETHGSGGQRLRVLDVVPFDEEDESPFVGPLQIEAA*
Ga0137380_1023562323300012206Vadose Zone SoilMKIHPGEEVLLGASRRFRVLDFVPFEEEGESSLVGLLQVEAM*
Ga0137381_1090183513300012207Vadose Zone SoilEILGGDGRRFRVIDVGPFDEEDESPFVGLLQVEAA*
Ga0137376_1101934013300012208Vadose Zone SoilMMIRPGEEILFGNGRRFRVLAVVPFVEDESPFVGLLQVQAA*
Ga0137376_1110662613300012208Vadose Zone SoilVIHPGEKIHLGAGQRFRVLDVVPFEEEDESLLVGLLKVEAA*
Ga0137379_1177297223300012209Vadose Zone SoilMIHPGEEIIAKGNEHFQVVDVVPFEEEDSPFVGLLQVEAA*
Ga0137377_1023109523300012211Vadose Zone SoilGEATYAVMIRPGEEILVGNGRRFRVLDLVSIDEEDSPFVGLLQVEAT*
Ga0137386_1123603013300012351Vadose Zone SoilMIHPGDEIHLGAGRRFRVLDVVPFEEEGESPFVGLLQ
Ga0137371_1045793723300012356Vadose Zone SoilMMIKPGEETHGSGGQRLRVLDVVPFDDEDESPFVRLLQVVEV*
Ga0137385_1114395123300012359Vadose Zone SoilMIKPVEEIVAGDDRRFRVLDVVPFEEEDESAFVELLRVEVA*
Ga0137385_1125148923300012359Vadose Zone SoilLSPGEEIFVGNGRRLRVLAVVPFSEKDESPFVGLLQVEAV*
Ga0164300_1001083613300012951SoilSTSGAGQRFRVIDVVAFEEEDESQFVGLLRVEAA*
Ga0164300_1001170073300012951SoilVIKPGEEIHLGAGQRFRVIDVVPLEEQDASPFVGLLQVEAA*
Ga0164298_1083580313300012955SoilGEATYAQMIHVGDEIHVGAGQRFRVLDIVTFDEEDESPFVGMLKVEVA*
Ga0164298_1105527913300012955SoilMTIRAGEEIHGSGGQPLRAVDVVPCEEEHESPFVGLLQVETT*
Ga0164303_10001827103300012957SoilMGPRGRRIIAGNNQRFRVLHVAPFDEEDKSPFVGLLQVEAA*
Ga0164303_1045456813300012957SoilMIKPGEEILLGGGQHFRVLYVVAFHEEDESPFVGMLKVEAA*
Ga0164303_1052165623300012957SoilIKPGEEILFGNGRRFRVLDVVPFEEEDESPFVGLLRVEAA*
Ga0164303_1114624713300012957SoilEATYAQMINPGDEVHVGAGQRFRVIDVVAFEEEDESPFVGLLQVEAA*
Ga0164303_1147956513300012957SoilMIHLGDEIHLNAGQRFRVVDVVEFEEEDESPFVGLL
Ga0164299_1066070823300012958SoilMMIKPGEEIHLGAGQRFRILGVVPFDEADESPFVGLLQVEAAYVR*
Ga0164301_1009074313300012960SoilVIKPGEEIHLGAGQRFRVIDAVPFEEQDASPFVGLLQVEAA*
Ga0164301_1023480133300012960SoilMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLL
Ga0164301_1087386923300012960SoilMGPPGRRIIAGNNQRFRVLHVAPFDEEDKSPFVGLLQVEAA*
Ga0164301_1099713023300012960SoilMTIRAGEEIHGSGGQRLRVVDVVPFEEEDESPFVGLLQVETT*
Ga0164302_1001409813300012961SoilMGPPGRRIIAGNNQRFRVLHVVPFDEEDKSPFVGLPQVEAA*
Ga0164302_1001409853300012961SoilVIKPGEEIHLVAGQRFRVIDVVPFEEQDASPFGGLLQVEAA*
Ga0164302_1044635423300012961SoilMIHTGDEIHLSAGQRFRVLDVVTFDEEDESPFVGLLQVEAA*
Ga0164302_1071847613300012961SoilKVGEEILVGNGRRFRVLDVVPFEEEDESPFVGMLKVEVA*
Ga0134110_1043113213300012975Grasslands SoilMMIKPGEEIIAGANERFQVVDVPFEEEDKSPFVGLLQ
Ga0164309_1028965523300012984SoilMGPPGRRIIAGNNLRFRVLHVVPFDEEDKSPFVGLLQVEAA*
Ga0164309_1064240623300012984SoilMMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLLQVEAAYVR*
Ga0164309_1091412913300012984SoilMIKPGEEILLGGGQHFRVLDVVAFDEEDESPFVGMLKVEAA*
Ga0164308_1064643933300012985SoilMGPPGRRIIAGNNQRFRVLHVAPFDEEDKSPFVGLLRVEAADA
Ga0164308_1086296413300012985SoilTYAMMIKPGEEIHLGAGQRFRILDVVPFDEADESPFVGLLQVEAAYVR*
Ga0164304_1175215213300012986SoilLGEATYAMMIKPGEEILYGNGRRFRVLDVVPFEEDDQSPFVGLLQVEAA*
Ga0164307_1025900823300012987SoilMIKPGEEILLGGGQHFRVLYVVAFDEEDESPFVGMLKVEAA*
Ga0164306_1011668443300012988SoilVIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFVGL
Ga0164306_1045488713300012988SoilTYAQMIHVGDEIHVGAGQRFRVLDIVPFDEEDESPFVGMLKVEVA*
Ga0164306_1192213223300012988SoilLGEATYAMMIKPDEEIHLGAGKRFRVLDVVAFEEEDESPFVGLLQVEAA*
Ga0164305_1029174913300012989SoilVTYAVLVKPGEEILVVNGRRFRVLDVVPFDGEDESPFVGLLKVEAA*
Ga0157374_1030650913300013296Miscanthus RhizosphereMIHPGEKILLGAGRRCRVLDVVPFDEEDESPFVDRL
Ga0157378_1119179113300013297Miscanthus RhizosphereMIDRGEEIIAGKNEHFRVVDVVPFEEADESPFVGLLQVEAV*
Ga0120179_100709333300013763PermafrostLVKPGETIITGAGRKLRVLAVVPIEEDSPFVGLLQAEAA*
Ga0157379_1229319913300014968Switchgrass RhizosphereDLGEATYAMMIKPGEEIHLGTGQRFRVLDVVPFEDESPFVGLSQVEPA*
Ga0157376_1123426123300014969Miscanthus RhizosphereMIHLGDEIHLGAGQRFRVIDVVAFEEEDESPFVGLLRVEAA*
Ga0157376_1241925523300014969Miscanthus RhizosphereEEILLGAGRRFRVLDVVTFEEEDESQLVGLLQVEAA*
Ga0132255_10113188023300015374Arabidopsis RhizosphereMDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAA*
Ga0132255_10132642223300015374Arabidopsis RhizosphereVIERGEEIHLAAGERLRVLAVSPFDEEDESPFGELLQVEAA*
Ga0066667_1116264413300018433Grasslands SoilMIHPGDEVYVRAAERFRVLDVVPFEEEDESPFVGLLQVEAA
Ga0066667_1203530313300018433Grasslands SoilMMIHPGEEIIAGHNQRFRVLAVVPFVEDESPFVGLLQVQAA
Ga0066662_1054003723300018468Grasslands SoilMMIKPGEEIIAGTNELFRVLGVVPFEEEDESPSSGCSRS
Ga0173482_1017689623300019361SoilMIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAV
Ga0173482_1058400323300019361SoilQPGEEILLGPGQRFRVVDLVPFGEEDESPFVGLLQVARPAPE
Ga0206349_139142723300020075Corn, Switchgrass And Miscanthus RhizosphereMDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAV
Ga0206350_1083508723300020080Corn, Switchgrass And Miscanthus RhizosphereMDPPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAA
Ga0126371_1089543123300021560Tropical Forest SoilMIHADEEIIANGNKRFRVVDVVPLEEADELGFVGMLRVEAA
Ga0126371_1172381433300021560Tropical Forest SoilKPGEEIHVSGGQRMRVLDVVPFEEEDESPFVGLPQVEVV
Ga0224712_1033139323300022467Corn, Switchgrass And Miscanthus RhizosphereMDQPPDEEIIAGNNQRFRVLHVVPFDEEDESPFVGLLQVEAA
Ga0247802_106905313300023077SoilTYAQMIHLGDEIHLGAGQRFRVLDVVPFDEEDESPFVGLLQVEAT
Ga0247794_1007520413300024055SoilVRPREEILVGNGRRFRVVDVVPFEEEDESPLVGMLKVEVA
Ga0207710_1066866313300025900Switchgrass RhizosphereKPGEEIIAGSNQHYRVVDLVEFDEEEDALFVGLLQVEAA
Ga0207693_1044816023300025915Corn, Switchgrass And Miscanthus RhizosphereMIHPGEEIIAGGNQHFRVVDVVMFADEDDSPFVGLLQLEAA
Ga0207663_1018517723300025916Corn, Switchgrass And Miscanthus RhizosphereMIYPGEEIIAGDNEHFRVLELVPIEEEDKSPFVGLLQVEAA
Ga0207660_1111929623300025917Corn RhizosphereMIHPDEEIIAGRNERYRVLDVGPVEEEHESFVGLLQVEAA
Ga0207646_10001396233300025922Corn, Switchgrass And Miscanthus RhizosphereLNPSLIGNGRRFRVLDVVPFEEESPFVRLLVVEAA
Ga0207687_1007415223300025927Miscanthus RhizosphereMIDRGEEIIAGKNEHFRVVDVVQFDEEDESPFVGLLQVEAV
Ga0207700_1006413963300025928Corn, Switchgrass And Miscanthus RhizosphereVTWKPGDEIFVGPGKRLKVLDVVPVEEEDSPYRGLLKVEAA
Ga0207664_1005241253300025929Agricultural SoilMINPGEEIIGGQNEHFRVFDEEDESPFVGLLRVEEA
Ga0207664_1072242623300025929Agricultural SoilVLVKPGEEILVVNGRRFRVLDVVPFDGEDESPFVGLIKVEAA
Ga0207664_1108748013300025929Agricultural SoilSRAGGEEIIAGNNQHFRVVDVVPFDEEDELPVVGQLQVEAA
Ga0207665_1037285713300025939Corn, Switchgrass And Miscanthus RhizosphereMMIKPGEEIHLGAGQRFHILDVVPFDEADESPFVGLLQ
Ga0207711_1160981513300025941Switchgrass RhizosphereEEIQGNGGQRLRVLAVGPFDEEDESPFVGLLPAEAV
Ga0208529_101674423300026008Rice Paddy SoilVAWKRKEIFLDNGRRLRVLDVVPFEEEDESPFVGLLKVEAT
Ga0207676_1019973813300026095Switchgrass RhizosphereMIHLGDEIHLGAGQRFRVIDVVAFEEEDESPFVGLLQVEAV
Ga0207698_1173594123300026142Corn RhizosphereMIDRGEEIIAGKNEHFRVVDVVPFEEEDESPFVGLLQVEAE
Ga0209152_1032801323300026325SoilAMMIKPGEEIIAGSNQRFRVVDIVPFAEEDESPFVGLLQVEAA
Ga0209811_1013981423300027821Surface SoilMMIKPGEEIHLGAGQRFRVIDVVPFEEQDASPFVGLLQVKAA
Ga0209068_1028534023300027894WatershedsRREPGEEILLGAGQRFRVLDLVPFDGDESPFVGLLKIESI
Ga0307277_1018663123300028881SoilVRPGEEILVGNGRRFRVLDVIPFEEEDESPFVGLLQVEAA
Ga0306923_1243777913300031910SoilAGEEIIAGRAERFRVLDVVPFEEEDESPFVGLLRIEAA
Ga0335081_1261534213300032892SoilKPGEEVLYGNGRRFRVIDVAPFAEEDESVFVAMLKVEAL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.