Basic Information | |
---|---|
Family ID | F035529 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 172 |
Average Sequence Length | 42 residues |
Representative Sequence | MHPEDLMNADMLSEILLLVSGSVIFVTLLLILAAALTQTAALT |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 172 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.23 % |
% of genes near scaffold ends (potentially truncated) | 20.93 % |
% of genes from short scaffolds (< 2000 bps) | 76.74 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.070 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (15.116 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.093 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.860 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 172 Family Scaffolds |
---|---|---|
PF01471 | PG_binding_1 | 2.91 |
PF00882 | Zn_dep_PLPC | 2.33 |
PF05532 | CsbD | 1.74 |
PF00589 | Phage_integrase | 1.74 |
PF13502 | AsmA_2 | 1.74 |
PF00072 | Response_reg | 1.16 |
PF00873 | ACR_tran | 1.16 |
PF01738 | DLH | 1.16 |
PF13545 | HTH_Crp_2 | 1.16 |
PF00027 | cNMP_binding | 1.16 |
PF11218 | DUF3011 | 1.16 |
PF06262 | Zincin_1 | 1.16 |
PF00196 | GerE | 0.58 |
PF00149 | Metallophos | 0.58 |
PF01475 | FUR | 0.58 |
PF13180 | PDZ_2 | 0.58 |
PF13565 | HTH_32 | 0.58 |
PF04226 | Transgly_assoc | 0.58 |
PF02371 | Transposase_20 | 0.58 |
PF01590 | GAF | 0.58 |
PF01120 | Alpha_L_fucos | 0.58 |
PF01011 | PQQ | 0.58 |
PF12439 | GDE_N | 0.58 |
PF00239 | Resolvase | 0.58 |
PF12900 | Pyridox_ox_2 | 0.58 |
PF00691 | OmpA | 0.58 |
PF13450 | NAD_binding_8 | 0.58 |
PF00069 | Pkinase | 0.58 |
PF09594 | GT87 | 0.58 |
PF01432 | Peptidase_M3 | 0.58 |
PF04366 | Ysc84 | 0.58 |
PF04545 | Sigma70_r4 | 0.58 |
PF06439 | 3keto-disac_hyd | 0.58 |
PF07519 | Tannase | 0.58 |
COG ID | Name | Functional Category | % Frequency in 172 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.33 |
COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.74 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 1.16 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.58 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.58 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.58 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.58 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.58 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.58 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.58 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.58 |
COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.07 % |
Unclassified | root | N/A | 20.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001137|JGI12637J13337_1001636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1811 | Open in IMG/M |
3300001545|JGI12630J15595_10011957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1878 | Open in IMG/M |
3300001593|JGI12635J15846_10005730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10705 | Open in IMG/M |
3300004104|Ga0058891_1579928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300004139|Ga0058897_11149549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300005436|Ga0070713_102330577 | Not Available | 518 | Open in IMG/M |
3300005440|Ga0070705_101236661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300005445|Ga0070708_100178732 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300005445|Ga0070708_102278265 | Not Available | 500 | Open in IMG/M |
3300005457|Ga0070662_100088674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2319 | Open in IMG/M |
3300005466|Ga0070685_10999279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 627 | Open in IMG/M |
3300005467|Ga0070706_100989488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
3300005468|Ga0070707_101755941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300005518|Ga0070699_100789488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300005547|Ga0070693_100026846 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
3300005548|Ga0070665_101724968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300005602|Ga0070762_10118855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1551 | Open in IMG/M |
3300005994|Ga0066789_10359932 | Not Available | 608 | Open in IMG/M |
3300006041|Ga0075023_100018653 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
3300006041|Ga0075023_100062614 | Not Available | 1198 | Open in IMG/M |
3300006041|Ga0075023_100297165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300006041|Ga0075023_100317023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300006041|Ga0075023_100320741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300006050|Ga0075028_100003463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5922 | Open in IMG/M |
3300006050|Ga0075028_100293650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300006050|Ga0075028_100657609 | Not Available | 627 | Open in IMG/M |
3300006052|Ga0075029_100452526 | Not Available | 842 | Open in IMG/M |
3300006055|Ga0097691_1035638 | Not Available | 1892 | Open in IMG/M |
3300006057|Ga0075026_100413148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300006059|Ga0075017_100164171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1589 | Open in IMG/M |
3300006059|Ga0075017_100182719 | Not Available | 1509 | Open in IMG/M |
3300006059|Ga0075017_100651879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 808 | Open in IMG/M |
3300006086|Ga0075019_10436881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300006102|Ga0075015_100826312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 558 | Open in IMG/M |
3300006162|Ga0075030_100738206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
3300006163|Ga0070715_10015034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2879 | Open in IMG/M |
3300006163|Ga0070715_10376798 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300006173|Ga0070716_100161118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1454 | Open in IMG/M |
3300006173|Ga0070716_100770448 | Not Available | 742 | Open in IMG/M |
3300006173|Ga0070716_101296986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300006175|Ga0070712_100446523 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300006893|Ga0073928_10002967 | All Organisms → cellular organisms → Bacteria | 27687 | Open in IMG/M |
3300006893|Ga0073928_10025694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5838 | Open in IMG/M |
3300007076|Ga0075435_100578952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
3300007258|Ga0099793_10086382 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300009038|Ga0099829_10003744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8959 | Open in IMG/M |
3300009038|Ga0099829_10696787 | Not Available | 844 | Open in IMG/M |
3300009038|Ga0099829_11757930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300009088|Ga0099830_10098637 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300009092|Ga0105250_10083017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1300 | Open in IMG/M |
3300009098|Ga0105245_11170049 | Not Available | 816 | Open in IMG/M |
3300009174|Ga0105241_10400593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
3300010396|Ga0134126_10297938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1894 | Open in IMG/M |
3300010403|Ga0134123_10655170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
3300011120|Ga0150983_12719026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
3300011120|Ga0150983_13953505 | Not Available | 707 | Open in IMG/M |
3300011120|Ga0150983_14035420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300011120|Ga0150983_15526168 | Not Available | 1241 | Open in IMG/M |
3300011120|Ga0150983_16429417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
3300011120|Ga0150983_16738229 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300011269|Ga0137392_10563639 | Not Available | 946 | Open in IMG/M |
3300012096|Ga0137389_10471981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
3300012202|Ga0137363_10012034 | All Organisms → cellular organisms → Bacteria | 5560 | Open in IMG/M |
3300012363|Ga0137390_10058594 | Not Available | 3750 | Open in IMG/M |
3300012929|Ga0137404_10054145 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
3300012930|Ga0137407_10225178 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
3300012930|Ga0137407_10472044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
3300012955|Ga0164298_10945071 | Not Available | 631 | Open in IMG/M |
3300012955|Ga0164298_11582356 | Not Available | 515 | Open in IMG/M |
3300012957|Ga0164303_10439564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
3300012960|Ga0164301_10324330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
3300012984|Ga0164309_10342456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300012986|Ga0164304_10655162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300013296|Ga0157374_10065846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3404 | Open in IMG/M |
3300013308|Ga0157375_13250875 | Not Available | 542 | Open in IMG/M |
3300013832|Ga0120132_1047965 | Not Available | 821 | Open in IMG/M |
3300014501|Ga0182024_10183450 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
3300014968|Ga0157379_10303988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
3300015372|Ga0132256_100147015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2359 | Open in IMG/M |
3300019872|Ga0193754_1016029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300019877|Ga0193722_1108960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300019879|Ga0193723_1026238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1769 | Open in IMG/M |
3300019882|Ga0193713_1104889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300019887|Ga0193729_1005193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6240 | Open in IMG/M |
3300019887|Ga0193729_1145111 | Not Available | 862 | Open in IMG/M |
3300019888|Ga0193751_1096797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
3300020001|Ga0193731_1168807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300020004|Ga0193755_1052872 | Not Available | 1325 | Open in IMG/M |
3300020012|Ga0193732_1007666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1876 | Open in IMG/M |
3300020579|Ga0210407_10001427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22445 | Open in IMG/M |
3300020579|Ga0210407_10269495 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1327 | Open in IMG/M |
3300020579|Ga0210407_10889142 | Not Available | 683 | Open in IMG/M |
3300020580|Ga0210403_10239553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1488 | Open in IMG/M |
3300020580|Ga0210403_10402735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
3300020581|Ga0210399_10412608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
3300020581|Ga0210399_10613263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
3300020583|Ga0210401_10339366 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300020583|Ga0210401_10668189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300020583|Ga0210401_11006360 | Not Available | 692 | Open in IMG/M |
3300021168|Ga0210406_10000816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 40554 | Open in IMG/M |
3300021168|Ga0210406_10034779 | All Organisms → cellular organisms → Bacteria | 4521 | Open in IMG/M |
3300021168|Ga0210406_10134547 | Not Available | 2081 | Open in IMG/M |
3300021168|Ga0210406_10539077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
3300021171|Ga0210405_10649439 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300021178|Ga0210408_10132861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1966 | Open in IMG/M |
3300021178|Ga0210408_10180142 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300021180|Ga0210396_10597553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 960 | Open in IMG/M |
3300021181|Ga0210388_10814742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
3300021403|Ga0210397_11076596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300021403|Ga0210397_11294183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300021420|Ga0210394_10063174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3216 | Open in IMG/M |
3300021478|Ga0210402_11065639 | Not Available | 735 | Open in IMG/M |
3300021479|Ga0210410_10778292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
3300021479|Ga0210410_11666030 | Not Available | 531 | Open in IMG/M |
3300022557|Ga0212123_10002048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 50958 | Open in IMG/M |
3300022557|Ga0212123_10016603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 8965 | Open in IMG/M |
3300025910|Ga0207684_10067461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3041 | Open in IMG/M |
3300025912|Ga0207707_10117541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2324 | Open in IMG/M |
3300025922|Ga0207646_11388212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300025939|Ga0207665_11319041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300025986|Ga0207658_10816937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
3300026023|Ga0207677_12166884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300026281|Ga0209863_10036408 | Not Available | 1478 | Open in IMG/M |
3300026294|Ga0209839_10092133 | Not Available | 1041 | Open in IMG/M |
3300026294|Ga0209839_10256376 | Not Available | 547 | Open in IMG/M |
3300027521|Ga0209524_1037900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
3300027565|Ga0209219_1002924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3433 | Open in IMG/M |
3300027587|Ga0209220_1135881 | Not Available | 639 | Open in IMG/M |
3300027591|Ga0209733_1030768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
3300027591|Ga0209733_1108864 | Not Available | 694 | Open in IMG/M |
3300027645|Ga0209117_1004347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4889 | Open in IMG/M |
3300027645|Ga0209117_1004516 | All Organisms → cellular organisms → Bacteria | 4805 | Open in IMG/M |
3300027645|Ga0209117_1032722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1614 | Open in IMG/M |
3300027651|Ga0209217_1003815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5028 | Open in IMG/M |
3300027667|Ga0209009_1019793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1632 | Open in IMG/M |
3300027667|Ga0209009_1042233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
3300027678|Ga0209011_1008237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3531 | Open in IMG/M |
3300027727|Ga0209328_10104032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300027846|Ga0209180_10020490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3501 | Open in IMG/M |
3300027875|Ga0209283_10020341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4059 | Open in IMG/M |
3300027879|Ga0209169_10165189 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300027894|Ga0209068_10001521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 11511 | Open in IMG/M |
3300027894|Ga0209068_10026150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2868 | Open in IMG/M |
3300027894|Ga0209068_10095225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1565 | Open in IMG/M |
3300027898|Ga0209067_10454960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300027910|Ga0209583_10025682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1912 | Open in IMG/M |
3300027910|Ga0209583_10113469 | Not Available | 1062 | Open in IMG/M |
3300027910|Ga0209583_10145938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
3300027915|Ga0209069_10531616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300028047|Ga0209526_10069450 | Not Available | 2477 | Open in IMG/M |
3300028047|Ga0209526_10497078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300028379|Ga0268266_11422087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 669 | Open in IMG/M |
3300028678|Ga0302165_10043557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
3300028678|Ga0302165_10096995 | Not Available | 785 | Open in IMG/M |
3300028828|Ga0307312_10504467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300030000|Ga0311337_11972971 | Not Available | 513 | Open in IMG/M |
3300030047|Ga0302286_10029943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 3053 | Open in IMG/M |
3300030950|Ga0074034_11210782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1136289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300031521|Ga0311364_11952970 | Not Available | 576 | Open in IMG/M |
3300031720|Ga0307469_10103332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2009 | Open in IMG/M |
3300031720|Ga0307469_10231979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1469 | Open in IMG/M |
3300031753|Ga0307477_10791305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300031962|Ga0307479_10043358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4318 | Open in IMG/M |
3300031962|Ga0307479_10075536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3260 | Open in IMG/M |
3300031962|Ga0307479_10281241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1645 | Open in IMG/M |
3300031962|Ga0307479_10396218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
3300032180|Ga0307471_100024592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4505 | Open in IMG/M |
3300032180|Ga0307471_100347788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1591 | Open in IMG/M |
3300032180|Ga0307471_100656008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1212 | Open in IMG/M |
3300032180|Ga0307471_101609392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300033433|Ga0326726_10404429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 15.12% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 13.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.14% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.40% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.33% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.91% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.16% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.16% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.58% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.58% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.58% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.58% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.58% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.58% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030950 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12637J13337_10016361 | 3300001137 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIVITLSLILVAALTQTAALT* |
JGI12630J15595_100119572 | 3300001545 | Forest Soil | MHPEDLMNADMLSEILLLVGGSVIFVTLLLILVAALTQTAAL* |
JGI12635J15846_1000573013 | 3300001593 | Forest Soil | MHPEDVMNADMPSEILLLASGFVIFVTLFVVLVAALTQTAALP* |
Ga0058891_15799281 | 3300004104 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALT* |
Ga0058897_111495492 | 3300004139 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALP* |
Ga0070713_1023305771 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADRLSEILLLVAASVIFVTLLLILAAALTQTAALA* |
Ga0070705_1012366611 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMLSEILLLVCGSVIFVALLLILLAALTQTAALT* |
Ga0070708_1001787324 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMLSEILLLVIGSVIFVTLLLILAAALTRTAALT* |
Ga0070708_1022782652 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMDADMLSEILLLVTGSVIFVMLLLILAAAFTQTAALT* |
Ga0070662_1000886744 | 3300005457 | Corn Rhizosphere | TQIHPEDLMNADMLNEILLLVCGSVIFVALLLILLAALT* |
Ga0070685_109992791 | 3300005466 | Switchgrass Rhizosphere | MHREDLMNADLLSEILLLVSGSVILVTLLLILVAALAQTGAST* |
Ga0070706_1009894881 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMPSEILLLVSGSVILVMLLLILVAALTQTAALT* |
Ga0070707_1017559412 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KTQMHPEDLMNGDMPSAILLLVSGSLIFITLSLILVAALTQTAALP* |
Ga0070699_1007894882 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMPSAILLLVSGSLIVITLSLILVAALTQTAALP* |
Ga0070693_1000268462 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMLSEILLLVCGSVIFVALLLILLAALTQTVALT* |
Ga0070665_1017249681 | 3300005548 | Switchgrass Rhizosphere | PAGEETQMHPEDLMNADMLNEILLLVCGSVIFVALLLILLAALTQTAALT* |
Ga0070762_101188552 | 3300005602 | Soil | MHREDLMNADVLSEIVLLVSGSLIFVMLLLILVAALTQTAALP* |
Ga0066789_103599321 | 3300005994 | Soil | MHREDLMNPDMLSEILLVISGTVILITLLLIAAAALTQT |
Ga0075023_1000186533 | 3300006041 | Watersheds | MHPEDVMNADMLSETLLLVSGTLIFVTLLLILVVALTQTAALP* |
Ga0075023_1000626143 | 3300006041 | Watersheds | MHPEDLMNADMLSEILLLVSGTMILVTLLLILWAALTQTAAVT* |
Ga0075023_1002971652 | 3300006041 | Watersheds | MHPEDLMNPDMLSEILLLVSGTMILVTLVLILVAALTQTAALT* |
Ga0075023_1003170231 | 3300006041 | Watersheds | MHREDLMNADMLSEILLLVCGSVIFVALLLILVAALTQTAALP* |
Ga0075023_1003207411 | 3300006041 | Watersheds | DMLSEILLLVSGSVIFVTLLLILVAVLTRTAALT* |
Ga0075028_1000034633 | 3300006050 | Watersheds | MHPEDLMNADMLSEILLVVSGTMILVTLLLILWAALTQTAAVT* |
Ga0075028_1002936502 | 3300006050 | Watersheds | MHPEDLMNADMLSEILLLVNGSVILVTLLLILAAALTQTAALT* |
Ga0075028_1006576092 | 3300006050 | Watersheds | MNADMLSEVLLLVCGSVIFVALLLILVAALTQTAALP* |
Ga0075029_1004525261 | 3300006052 | Watersheds | MHPEDLMNADMLSEILLLVSGSMILVTLLLILEAALTQTAALT* |
Ga0097691_10356384 | 3300006055 | Arctic Peat Soil | MQMHPEDVMNADMLSEILLLVSGSLIFVMLLLILVAALTQTAALP* |
Ga0075026_1004131481 | 3300006057 | Watersheds | MHQEDLMNADMLSEILLLVSGSVIFVTLLLILVAVLTRTAALT* |
Ga0075017_1001641713 | 3300006059 | Watersheds | ERKTQMHPEDLMNADMLSEILLLVSGSMILVTLLLILVAALTQTAALT* |
Ga0075017_1001827192 | 3300006059 | Watersheds | MHPEDLMNADMLSEILLLVSASAILVTLLVILAAVLTQTAALT* |
Ga0075017_1006518792 | 3300006059 | Watersheds | MHPEDLMNADMLSEILLLVSGSLMLVTLLLILVAALTQTAALT* |
Ga0075019_104368812 | 3300006086 | Watersheds | MNADMPSEILLLASGSVIFVTLFLVLVAALTQTAALP* |
Ga0075015_1008263122 | 3300006102 | Watersheds | TTQMHPEDLMNPDMLSEILLLVSGTMILVTLVLILVAALTQTAALT* |
Ga0075030_1007382062 | 3300006162 | Watersheds | MNADMLSEILLLVCGSVIFVALLLILVAALTQTAALP* |
Ga0070715_100150343 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MYPEDLMNADMLSEILLLVCGSVIFVSLLLILLAALTQTAALT* |
Ga0070715_103767982 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMLSEILLLVAASVIFVTLLLILAAALTQTAAL |
Ga0070716_1001611182 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMLSEILLLVAASVIFVTLLLILAAALTQTAALR* |
Ga0070716_1007704482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADVLSEIVLLVSASLILITLLVILAAALTQTAALT* |
Ga0070716_1012969862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHREDLMNADTLSEISVLVSSTMILVALLLILWAALTQTAALT* |
Ga0070712_1004465232 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNADMLSEILLLVAASVIFVTLLLILAAALTQTAALA* |
Ga0073928_1000296717 | 3300006893 | Iron-Sulfur Acid Spring | MPMHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALT* |
Ga0073928_100256943 | 3300006893 | Iron-Sulfur Acid Spring | MQMHPEDLMNADMPSEILLLISGSLIFVTLSLILVAALTQTAALP* |
Ga0075435_1005789522 | 3300007076 | Populus Rhizosphere | MNADMLSEILLLVCGSVIFVALLLILLAALTQTAALT* |
Ga0099793_100863823 | 3300007258 | Vadose Zone Soil | MHPEDLMNADMPSEILILVTLLLILVAALTQTAALA* |
Ga0099829_100037445 | 3300009038 | Vadose Zone Soil | MHPEDLLNADMLSEILLLVSGTMILVTLLLILVAALTQTAALT* |
Ga0099829_106967871 | 3300009038 | Vadose Zone Soil | MHPEDLMDADMLSEILLLVTGSVIFVMLLLILAAALTQTAALT* |
Ga0099829_117579301 | 3300009038 | Vadose Zone Soil | MNADTLSEILLLVSGSVIFVTLLLILAAVLTQTAALT* |
Ga0099830_100986372 | 3300009088 | Vadose Zone Soil | MHPEELMSADLLSEILLLVSGSVILVTLLLILVAALTQTAALT* |
Ga0105250_100830172 | 3300009092 | Switchgrass Rhizosphere | MHPEDLMNADVLSEILLLVCGSVIFVALLLILLAALT* |
Ga0105245_111700491 | 3300009098 | Miscanthus Rhizosphere | LEKKQMHREDLMNADLLSEILLLVSGSVILVTLLLILVAALAQTGAST* |
Ga0105241_104005931 | 3300009174 | Corn Rhizosphere | MHPEDLMNADVLSEILLLVCCSVIFVALLLILLAALT* |
Ga0134126_102979382 | 3300010396 | Terrestrial Soil | MHPEDLMNADVLSEILLLVCGSVIFVALLLILLAALTQTAALI* |
Ga0134123_106551701 | 3300010403 | Terrestrial Soil | MHPEDLMNADMLNEILLLVCGSVIFVALLLILLAALT* |
Ga0150983_127190262 | 3300011120 | Forest Soil | MNADMPSEILLVVSGSLIFVTLLLILVAALTQTAALP* |
Ga0150983_139535053 | 3300011120 | Forest Soil | MLMHREDLMSADMLSEILLLVSGFVILVTLLLIGVTALTQTAALV* |
Ga0150983_140354202 | 3300011120 | Forest Soil | QMHPEELMNADLPSEILLLVSGSVILVTLLLILVAALTQTASLT* |
Ga0150983_155261681 | 3300011120 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLFLVAALTQTAALT* |
Ga0150983_164294171 | 3300011120 | Forest Soil | MHPEDLMNADMLSEILLLVSASVLLVTLLMILAAALTQTAALT* |
Ga0150983_167382292 | 3300011120 | Forest Soil | MHPEDVMNSDMPSEVLLLVSGSLIFVTLLLILLAALTQTAALP* |
Ga0137392_105636391 | 3300011269 | Vadose Zone Soil | MHPEDLLNADMLSEILLLVSGTMILVTLLLILVAALTQTA |
Ga0137389_104719811 | 3300012096 | Vadose Zone Soil | MHPEDLMNADMLSEILLLVTGSVIFVMLLLILAAALTQTAALT* |
Ga0137363_100120347 | 3300012202 | Vadose Zone Soil | MHPEELMSGDLLSEILLLVSGSVILVTLLLILVAALTQTAALT* |
Ga0137390_100585946 | 3300012363 | Vadose Zone Soil | MTGSPPKKQMHREDLMNPDMLSEILLLVSGSVIFVTLLLILAAALTQTAALR* |
Ga0137404_100541451 | 3300012929 | Vadose Zone Soil | MHPEDLMNSDMLSVILVLVSGSMVFVTLLLTLVAALTQTVH* |
Ga0137407_102251782 | 3300012930 | Vadose Zone Soil | MHPEDLMNSDMLSVILVLVSGSVVFVTLLLTLVAALTQTVH* |
Ga0137407_104720441 | 3300012930 | Vadose Zone Soil | DLMNADMPSEILLLVSGSVILVMLLLILVAALTQTAALT* |
Ga0164298_109450711 | 3300012955 | Soil | MHREDLMNADMLSETLLLVSGTMIVVTLLLILVAALTRTAALT* |
Ga0164298_115823561 | 3300012955 | Soil | ADLLSEILLLVSGSVILVTLLRILVAALAQTGAST* |
Ga0164303_104395642 | 3300012957 | Soil | MNADMLSEILLLVCGSVIFVALLLILLAALTQTVALT* |
Ga0164301_103243301 | 3300012960 | Soil | MNADMLSETLLLVSGTMIVVTLLLILVAALTRTAALT* |
Ga0164309_103424562 | 3300012984 | Soil | MHREDLMNADMLSETLLLVSGTMIVVTLLLILVAALTRIAALT* |
Ga0164304_106551622 | 3300012986 | Soil | MNADMLSETLLLVSGTMIVVTLLLILVAALTRIAALT* |
Ga0157374_100658461 | 3300013296 | Miscanthus Rhizosphere | MHREGVMNSDMLSEIILLVSGTMILVTLLLILWAAITQTAALA* |
Ga0157375_132508752 | 3300013308 | Miscanthus Rhizosphere | MHPEDLMNADVLSEILLLVCGSVIFVALLLILLAALTQTVALT* |
Ga0120132_10479651 | 3300013832 | Permafrost | MHREDLMNPDMLSEILLVISGTVILITLLLIAVAALTQTAA |
Ga0182024_101834502 | 3300014501 | Permafrost | MHPEDLMNTDMLSKILLLVSGSVILVALLVILAAGLTQTAALT* |
Ga0157379_103039881 | 3300014968 | Switchgrass Rhizosphere | MHPEDLMNADVLSEILLLVCGSVIFVALLLILLAALTQTAALT* |
Ga0132256_1001470155 | 3300015372 | Arabidopsis Rhizosphere | HPEDLMNADMLNEILLLVCGSVIFVALLLILLAALT* |
Ga0193754_10160292 | 3300019872 | Soil | MHREDLMNADMLSEILLLVCGSVIFVALLLILLAALSQTAALT |
Ga0193722_11089602 | 3300019877 | Soil | HPEDLMNADVLSAIVLLVSASLILITLLVILAAALTQTAALT |
Ga0193723_10262381 | 3300019879 | Soil | PTRGRRRRRMHPEDLMNADVLSAIVLLVSASLILITLLVILAAALTQTAALT |
Ga0193713_11048892 | 3300019882 | Soil | MHREDLLNADMLSEILLLVSGSLIFFTFLLILVAALTQTAALP |
Ga0193729_10051935 | 3300019887 | Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALT |
Ga0193729_11451112 | 3300019887 | Soil | MNADMLSEIVLLVSGTMILVTLLLILWAALTQTAALA |
Ga0193751_10967971 | 3300019888 | Soil | MHPEDVMNADIPSEILLLVSGSLIFVTLSLILVAALTQTAALP |
Ga0193731_11688072 | 3300020001 | Soil | MHREDLLNADMLGEILLLVSGSLIFFTFLLILVAALTQTAALP |
Ga0193755_10528721 | 3300020004 | Soil | MHPEDLMNADVLSAIVLLVSASLILITLLVILAAALTQTAALT |
Ga0193732_10076662 | 3300020012 | Soil | MHPEDLMNGDMLSEILLLVSASVLLVTLLVILAAALTQTAALT |
Ga0210407_1000142720 | 3300020579 | Soil | MHPEDLMNADMPSEILLLVSGSLIFIMLSLILVAALTQTAALP |
Ga0210407_102694952 | 3300020579 | Soil | MHPEDLMNADMPSKILLLVSGSLIFITLSLILVAALTQTAALRC |
Ga0210407_108891421 | 3300020579 | Soil | MHPEDLMNADMLSEILLLVSASVLLVTLLMILAAALTQTAALT |
Ga0210403_102395532 | 3300020580 | Soil | MHPEDLMNADMPSEILLLVSGSLVFITLSLILVAALTQTAALP |
Ga0210403_104027352 | 3300020580 | Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALT |
Ga0210399_104126081 | 3300020581 | Soil | MHREDLMNADMLSEILLLVCGSVIFVALLLILVAALTQTAALP |
Ga0210399_106132632 | 3300020581 | Soil | MHPEDLMNADMPSEILLLVSGSVIFITLSLILVAALTQTAALT |
Ga0210401_103393662 | 3300020583 | Soil | MHPEDLMNADMLSETLLLVGGTMILVTLLLILVAAFTQTAALT |
Ga0210401_106681892 | 3300020583 | Soil | MHPEDLTNPDMFSEILLLATGTMILVTLPLILVAALTQTAALT |
Ga0210401_110063601 | 3300020583 | Soil | MHPEDLINADMPSEILLLVSSSLILITLSLILVAAPRHRG |
Ga0210406_1000081621 | 3300021168 | Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALP |
Ga0210406_100347794 | 3300021168 | Soil | MHPADLMNADMPSKILLLVSGSLIFITLSLILVAALTQTAALRY |
Ga0210406_101345472 | 3300021168 | Soil | MHPEDLMNADMPSEILLLVSGSLVFITLSLILVAALTQTA |
Ga0210406_105390771 | 3300021168 | Soil | NADMLSEILLLVSASVLLVTLLMILAAALTQTAALT |
Ga0210405_106494392 | 3300021171 | Soil | MHPEDVMNGDMPSEVLLLVSGSLIFVTLLLILLAALTQTAALP |
Ga0210408_101328614 | 3300021178 | Soil | MHREDLMSADMLSEILLLVSGFVILVTLLLIGVTALTQTAALV |
Ga0210408_101801423 | 3300021178 | Soil | PSRWRGRLQMHPEDLMNPDMFSEILLLVSGSVIFVTLLLILVAALTQTAALR |
Ga0210396_105975531 | 3300021180 | Soil | LETKTPMHPEDLMNADMPSEILLLVSGSVIFITLSLILVAALTQTAALT |
Ga0210388_108147422 | 3300021181 | Soil | MHREDLMNADVLSEIVLLVSGSLIFVMLLLILVAALTQTAALP |
Ga0210397_110765962 | 3300021403 | Soil | PEDLMNADMLSEILLLVSASVLLVTLLMILAAALTQTAALT |
Ga0210397_112941831 | 3300021403 | Soil | EDLMNADMLSEILLLVSGSVILFTLLLILVAALTQTAALT |
Ga0210394_100631744 | 3300021420 | Soil | MHPEDLMNADMLSEILLLVSGSVILFTLLLILVAALTQTAALT |
Ga0210402_110656391 | 3300021478 | Soil | MHPEDLMNADMPSEILLLVSGSMIFIMLSLILVAALTQTAALP |
Ga0210410_107782922 | 3300021479 | Soil | MHPEDLMNVDMPSEILLLVSGSVIFITLSLILVAALTQTAALT |
Ga0210410_116660301 | 3300021479 | Soil | MHPEDLMNADVLSEIVLLVSASLILITLLVILAAALTQTAALT |
Ga0212123_1000204818 | 3300022557 | Iron-Sulfur Acid Spring | MPMHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALT |
Ga0212123_100166036 | 3300022557 | Iron-Sulfur Acid Spring | MQMHPEDLMNADMPSEILLLISGSLIFVTLSLILVAALTQTAALP |
Ga0207684_100674614 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNADMLSEILLLVIGSVIFVTLLLILAAALTRTAALT |
Ga0207707_101175412 | 3300025912 | Corn Rhizosphere | MHPEDLMNADMLSEILLLVCGSVIFVALLLILLAALTQTVALT |
Ga0207646_113882122 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHPEDLMNGDMPSAILLLVSGSLIFITLSLILVAALTQTAALP |
Ga0207665_113190411 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHREDLMNADTLSEISVLVSSTMILVALLLILWAALTQTAALT |
Ga0207658_108169371 | 3300025986 | Switchgrass Rhizosphere | MHPEDLMNADMLNEILLLVCGSVIFVALLLILLAALT |
Ga0207677_121668841 | 3300026023 | Miscanthus Rhizosphere | PEDLMNADMLNEILLLVCGSVIFVALLLILLAALT |
Ga0209863_100364084 | 3300026281 | Prmafrost Soil | MNPDMLSETLLLVSGTMIVVTLLLILVAALTRTAALP |
Ga0209839_100921332 | 3300026294 | Soil | MHREDLMNPDMLSEILLVISGTVILITLLLIAAAALTQTAALR |
Ga0209839_102563761 | 3300026294 | Soil | MHREDLMNPDMLSETLLLVSGTMIVVTLLLILVAALTRTAAL |
Ga0209524_10379002 | 3300027521 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIVITLSLILVAALTQTAALT |
Ga0209219_10029246 | 3300027565 | Forest Soil | MHPEDVMNADMPSEILLLASGFVIFVTLFVVLVAALTQTAALP |
Ga0209220_11358812 | 3300027587 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIVITLSLILVAAL |
Ga0209733_10307682 | 3300027591 | Forest Soil | MHPGDLMNADMPSEILLLVSGSLIFVTLSLILVAALIQTAALP |
Ga0209733_11088641 | 3300027591 | Forest Soil | MQMHPEDLMNADMPSEILLLISGSLIFVTLLLILVAAFTQTAALP |
Ga0209117_10043471 | 3300027645 | Forest Soil | MHPEDVMNADMPSEILLLASGSVIFVTLFLVLMAALTQTAALP |
Ga0209117_10045164 | 3300027645 | Forest Soil | MHAEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALP |
Ga0209117_10327222 | 3300027645 | Forest Soil | MNADMPSEILLLASGSVIFVTLFLILVAALTQTAALP |
Ga0209217_10038159 | 3300027651 | Forest Soil | MHPEDLMNADMLSEILLLVSGSVIFVTLLLILAAALTQTAALT |
Ga0209009_10197932 | 3300027667 | Forest Soil | MHPEDLMNADMPSEILLLVSFSLIFVTLLLILVAAFTQTAALP |
Ga0209009_10422332 | 3300027667 | Forest Soil | MHREDLMNADMLSEIVLLVSGTMILVTLLLILWAALTQTAALA |
Ga0209011_10082372 | 3300027678 | Forest Soil | MQMHPEDLMNADMPSEILLLVTGSLIFVALSLILVAALTQTAALT |
Ga0209328_101040321 | 3300027727 | Forest Soil | MHPEDLMNADMPSEILLLVSGSLIFITLSLILVAALTQTAALH |
Ga0209180_100204902 | 3300027846 | Vadose Zone Soil | MHPEDLLNADMLSEILLLVSGTMILVTLLLILVAALTQTAALT |
Ga0209283_100203412 | 3300027875 | Vadose Zone Soil | MNADTLSEILLLVSGSVIFVTLLLILAAVLTQTAALT |
Ga0209169_101651891 | 3300027879 | Soil | MHREDLMNADLMSEILLLVSGTRILVTLILIVAAALKQTAALT |
Ga0209068_100015214 | 3300027894 | Watersheds | MHPEDLMNPDMLSEILLLVSGTMILVTLVLILVAALTQTAALT |
Ga0209068_100261503 | 3300027894 | Watersheds | MHPEDLMNADMLSEILLVVSGTMILVTLLLILWAALTQTAAVT |
Ga0209068_100952253 | 3300027894 | Watersheds | MHPEDLMNADMLSEILLLVNGSVILVTLLLILAAALTQTAALT |
Ga0209067_104549602 | 3300027898 | Watersheds | MNADMPSEILLLASGSVIFVTLFLVLVAALTQTAALP |
Ga0209583_100256823 | 3300027910 | Watersheds | MHPEDVMNADMLSETLLLVSGTLIFVTLLLILVVALTQTAALP |
Ga0209583_101134691 | 3300027910 | Watersheds | MHPEDLMNADMLSEILLLVSGTMILVTLLLILWAALTQTAAVT |
Ga0209583_101459382 | 3300027910 | Watersheds | HPEDLMNADMLSDILLLVSGSLIFVTLLLILVAALTQTAALT |
Ga0209069_105316161 | 3300027915 | Watersheds | MLPEDVMNADMLSEILLLVSGSVILVTLLLILAAALTQTAALT |
Ga0209526_100694505 | 3300028047 | Forest Soil | MHRQDLMNADMLSEILLLVSGSVIFVTLLLILVAALTQTPAMT |
Ga0209526_104970782 | 3300028047 | Forest Soil | MHPEDLMNADMLSEILLLVGGSVIFVTLLLILVAALTQTAAL |
Ga0268266_114220872 | 3300028379 | Switchgrass Rhizosphere | MHREDLMNADLLSEILLLVSGSVILVTLLLILVAALAQTGAST |
Ga0302165_100435572 | 3300028678 | Fen | MHPEDLMNPDVASEIRLLVSGSVIFATLVLILVAALTQTAPLS |
Ga0302165_100969951 | 3300028678 | Fen | MHPEDLMNGDLLSEILLLISGSLMFVLLSLTLVAAFTQTAALP |
Ga0307312_105044672 | 3300028828 | Soil | MHREDLMNADMLSEILLLVSGSVILVTLLLILVAALAQTGAPT |
Ga0311337_119729711 | 3300030000 | Fen | ILPTLWSEYAMHPEDLMNGDLLSEILLLISGSLMFVLLSLTLVAAFTQTAALP |
Ga0302286_100299436 | 3300030047 | Fen | MHPEDLMNPDVASEILLLVSGSVIFVTLLLILVAALTQTAPLS |
Ga0074034_112107822 | 3300030950 | Soil | ADPLERKTPMHPEDLMNADMQSEILLLVSGSLIVITLSLILVAALTQTAALT |
(restricted) Ga0255312_11362892 | 3300031248 | Sandy Soil | EDLMNADMLSEILLLVNGSVILVTLLLILAAALTQTAALT |
Ga0311364_119529701 | 3300031521 | Fen | MNGDLLSEILLLISGSLMFILLSLTLVAALTQTAALP |
Ga0307469_101033323 | 3300031720 | Hardwood Forest Soil | MQMHPEDLMNADMPSEILLLVSGSVILVMLLLILVAALTQTAALT |
Ga0307469_102319793 | 3300031720 | Hardwood Forest Soil | MHPEELMNADMPSEILLLVSGCLIFATLLLILVAALTQTTALP |
Ga0307477_107913052 | 3300031753 | Hardwood Forest Soil | MHPEDLINADMLSEIRLLVSGSVILVTLLLILAAALTQTAALT |
Ga0307479_100433584 | 3300031962 | Hardwood Forest Soil | MHPEDLMNPDMFSEILLLVSGSVIFVTLLLILVAALTQTAALR |
Ga0307479_100755366 | 3300031962 | Hardwood Forest Soil | MNADMPSEILLVVSGSLIFVTLLLILVAALTQTAVLP |
Ga0307479_102812414 | 3300031962 | Hardwood Forest Soil | MHPEDLMNADMLSEILLLVCGSVIFVALLLILAAALTQTAALP |
Ga0307479_103962182 | 3300031962 | Hardwood Forest Soil | MHPEELMNPDLPSEILLLVSGSVILVTLLLILVAALTQTAALT |
Ga0307471_1000245924 | 3300032180 | Hardwood Forest Soil | MHPEDLMNADMPSEILLLVSGSVILVMLLLILVAALTQTAALT |
Ga0307471_1003477881 | 3300032180 | Hardwood Forest Soil | MHPEDLMNADMPSAILLLVSGSLIFITLSLILVAALTQTAALP |
Ga0307471_1006560082 | 3300032180 | Hardwood Forest Soil | MHLKELMNPDLPSQILLLSGSVILVTLLLILVAALTQTAALT |
Ga0307471_1016093922 | 3300032180 | Hardwood Forest Soil | MHPEDLMKADMPSEILLLVSGSLIFFTLLLILVAALTPTAALP |
Ga0326726_104044291 | 3300033433 | Peat Soil | MHREDLMNADMLSEMLLLVSGTVIVVTLFLILLVTLTQTAALT |
⦗Top⦘ |