Basic Information | |
---|---|
Family ID | F035863 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 171 |
Average Sequence Length | 38 residues |
Representative Sequence | PKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA |
Number of Associated Samples | 153 |
Number of Associated Scaffolds | 171 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 16.96 % |
% of genes near scaffold ends (potentially truncated) | 79.53 % |
% of genes from short scaffolds (< 2000 bps) | 85.38 % |
Associated GOLD sequencing projects | 152 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.327 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.281 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.883 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.047 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.87% Coil/Unstructured: 84.13% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 171 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 23.98 |
PF08388 | GIIM | 18.13 |
PF02371 | Transposase_20 | 2.34 |
PF08327 | AHSA1 | 1.17 |
PF01548 | DEDD_Tnp_IS110 | 0.58 |
PF12697 | Abhydrolase_6 | 0.58 |
PF13561 | adh_short_C2 | 0.58 |
PF07676 | PD40 | 0.58 |
PF01527 | HTH_Tnp_1 | 0.58 |
PF00797 | Acetyltransf_2 | 0.58 |
PF00872 | Transposase_mut | 0.58 |
PF13537 | GATase_7 | 0.58 |
PF13358 | DDE_3 | 0.58 |
PF05163 | DinB | 0.58 |
PF13683 | rve_3 | 0.58 |
PF04237 | YjbR | 0.58 |
COG ID | Name | Functional Category | % Frequency in 171 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.92 |
COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.58 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.58 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.58 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.33 % |
Unclassified | root | N/A | 35.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573001|GZR05M101A76P4 | Not Available | 508 | Open in IMG/M |
2228664021|ICCgaii200_c1004509 | Not Available | 1681 | Open in IMG/M |
3300000559|F14TC_101398867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 529 | Open in IMG/M |
3300001356|JGI12269J14319_10093676 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300001396|JGI20175J14863_1006864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus necator | 1904 | Open in IMG/M |
3300001593|JGI12635J15846_10212548 | Not Available | 1270 | Open in IMG/M |
3300001593|JGI12635J15846_10463491 | Not Available | 753 | Open in IMG/M |
3300001867|JGI12627J18819_10026379 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101259872 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300004080|Ga0062385_10373463 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300004267|Ga0066396_10057788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300005167|Ga0066672_10044669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2511 | Open in IMG/M |
3300005174|Ga0066680_10050108 | Not Available | 2450 | Open in IMG/M |
3300005177|Ga0066690_10052267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2496 | Open in IMG/M |
3300005332|Ga0066388_105326195 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005435|Ga0070714_101416388 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005437|Ga0070710_10069207 | Not Available | 2030 | Open in IMG/M |
3300005445|Ga0070708_100128045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2348 | Open in IMG/M |
3300005451|Ga0066681_10083176 | Not Available | 1808 | Open in IMG/M |
3300005553|Ga0066695_10216519 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300005554|Ga0066661_10669809 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300005561|Ga0066699_10762875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300005576|Ga0066708_10339892 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300005614|Ga0068856_101623514 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300005764|Ga0066903_100433393 | All Organisms → cellular organisms → Bacteria | 2185 | Open in IMG/M |
3300006034|Ga0066656_10085680 | All Organisms → cellular organisms → Bacteria | 1889 | Open in IMG/M |
3300006052|Ga0075029_100509177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 795 | Open in IMG/M |
3300006162|Ga0075030_101401861 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300006175|Ga0070712_101747389 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006176|Ga0070765_101158166 | Not Available | 730 | Open in IMG/M |
3300006224|Ga0079037_102560574 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006852|Ga0075433_10835519 | Not Available | 804 | Open in IMG/M |
3300006854|Ga0075425_100107146 | All Organisms → cellular organisms → Bacteria | 3183 | Open in IMG/M |
3300007770|Ga0105015_1055529 | Not Available | 1701 | Open in IMG/M |
3300009038|Ga0099829_11565648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 544 | Open in IMG/M |
3300009078|Ga0105106_10128674 | Not Available | 1863 | Open in IMG/M |
3300009078|Ga0105106_11102109 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300009089|Ga0099828_11441399 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300009143|Ga0099792_10894178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 587 | Open in IMG/M |
3300009176|Ga0105242_13138765 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300009518|Ga0116128_1010515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3324 | Open in IMG/M |
3300009519|Ga0116108_1021721 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
3300009548|Ga0116107_1014064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3321 | Open in IMG/M |
3300009792|Ga0126374_10066789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia sordidicola | 1905 | Open in IMG/M |
3300009839|Ga0116223_10109226 | Not Available | 1743 | Open in IMG/M |
3300009839|Ga0116223_10228463 | Not Available | 1129 | Open in IMG/M |
3300010047|Ga0126382_10295273 | Not Available | 1214 | Open in IMG/M |
3300010048|Ga0126373_10023885 | All Organisms → cellular organisms → Bacteria | 5206 | Open in IMG/M |
3300010048|Ga0126373_11810958 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300010048|Ga0126373_12264357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300010146|Ga0126320_1092786 | Not Available | 1107 | Open in IMG/M |
3300010304|Ga0134088_10702765 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010341|Ga0074045_10014981 | All Organisms → cellular organisms → Bacteria | 6264 | Open in IMG/M |
3300010358|Ga0126370_11425632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
3300010360|Ga0126372_11046409 | Not Available | 831 | Open in IMG/M |
3300010361|Ga0126378_12239523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300010361|Ga0126378_12701963 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010362|Ga0126377_11391331 | Not Available | 774 | Open in IMG/M |
3300010366|Ga0126379_13761189 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010376|Ga0126381_100450722 | Not Available | 1804 | Open in IMG/M |
3300010379|Ga0136449_101392583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 1084 | Open in IMG/M |
3300010379|Ga0136449_101426931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300010392|Ga0118731_103750769 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300011072|Ga0138563_1077421 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300011081|Ga0138575_1031497 | Not Available | 626 | Open in IMG/M |
3300011271|Ga0137393_10598822 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300011271|Ga0137393_11272997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 623 | Open in IMG/M |
3300011271|Ga0137393_11543094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300011411|Ga0153933_1080687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti → Sinorhizobium meliloti 1021 | 690 | Open in IMG/M |
3300012096|Ga0137389_10041725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3412 | Open in IMG/M |
3300012189|Ga0137388_10754919 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300012207|Ga0137381_11194710 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300012211|Ga0137377_10318807 | Not Available | 1490 | Open in IMG/M |
3300012212|Ga0150985_106383000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
3300012212|Ga0150985_116436759 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
3300012349|Ga0137387_10147440 | Not Available | 1673 | Open in IMG/M |
3300012351|Ga0137386_11296555 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012903|Ga0157289_10041509 | Not Available | 1128 | Open in IMG/M |
3300012910|Ga0157308_10365574 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012948|Ga0126375_10499234 | Not Available | 907 | Open in IMG/M |
3300012971|Ga0126369_13470528 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300012988|Ga0164306_10477209 | Not Available | 954 | Open in IMG/M |
3300014166|Ga0134079_10623429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300014199|Ga0181535_10281778 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300014489|Ga0182018_10346139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300014491|Ga0182014_10443062 | Not Available | 642 | Open in IMG/M |
3300014638|Ga0181536_10088319 | Not Available | 1807 | Open in IMG/M |
3300014745|Ga0157377_10199194 | Not Available | 1270 | Open in IMG/M |
3300014838|Ga0182030_10614782 | Not Available | 1044 | Open in IMG/M |
3300016270|Ga0182036_11786478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300016341|Ga0182035_10089359 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
3300016387|Ga0182040_10116938 | Not Available | 1842 | Open in IMG/M |
3300017929|Ga0187849_1023999 | All Organisms → cellular organisms → Bacteria | 3324 | Open in IMG/M |
3300017934|Ga0187803_10480957 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300017940|Ga0187853_10056073 | Not Available | 2008 | Open in IMG/M |
3300017941|Ga0187850_10193985 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300017996|Ga0187891_1149177 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300018007|Ga0187805_10025721 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
3300018008|Ga0187888_1142007 | Not Available | 988 | Open in IMG/M |
3300018013|Ga0187873_1203801 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300018024|Ga0187881_10423614 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300018026|Ga0187857_10525857 | Not Available | 529 | Open in IMG/M |
3300018026|Ga0187857_10527007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 529 | Open in IMG/M |
3300018429|Ga0190272_11356028 | Not Available | 712 | Open in IMG/M |
3300019082|Ga0187852_1201438 | Not Available | 821 | Open in IMG/M |
3300020034|Ga0193753_10219900 | Not Available | 860 | Open in IMG/M |
3300020583|Ga0210401_10038993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4510 | Open in IMG/M |
3300021171|Ga0210405_11414443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 506 | Open in IMG/M |
3300021178|Ga0210408_10583477 | Not Available | 886 | Open in IMG/M |
3300021344|Ga0193719_10018174 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
3300021403|Ga0210397_10525696 | Not Available | 898 | Open in IMG/M |
3300021404|Ga0210389_11325344 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021477|Ga0210398_10276477 | Not Available | 1369 | Open in IMG/M |
3300021560|Ga0126371_10588800 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300021560|Ga0126371_12016815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 694 | Open in IMG/M |
3300022507|Ga0222729_1072700 | Not Available | 510 | Open in IMG/M |
3300022720|Ga0242672_1070924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 630 | Open in IMG/M |
3300023259|Ga0224551_1007984 | All Organisms → cellular organisms → Bacteria | 1763 | Open in IMG/M |
3300025453|Ga0208455_1032802 | Not Available | 1179 | Open in IMG/M |
3300025500|Ga0208686_1053944 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300025916|Ga0207663_10003949 | All Organisms → cellular organisms → Bacteria | 7336 | Open in IMG/M |
3300026215|Ga0209849_1007996 | Not Available | 1710 | Open in IMG/M |
3300026313|Ga0209761_1140282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
3300026315|Ga0209686_1011510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3672 | Open in IMG/M |
3300026318|Ga0209471_1336305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 500 | Open in IMG/M |
3300026469|Ga0257169_1090425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 504 | Open in IMG/M |
3300027050|Ga0209325_1001988 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300027109|Ga0208603_1004225 | All Organisms → cellular organisms → Bacteria | 2392 | Open in IMG/M |
3300027502|Ga0209622_1009711 | Not Available | 1603 | Open in IMG/M |
3300027721|Ga0209492_1051857 | Not Available | 1447 | Open in IMG/M |
3300027738|Ga0208989_10162411 | Not Available | 748 | Open in IMG/M |
3300027825|Ga0209039_10057937 | Not Available | 1743 | Open in IMG/M |
3300027825|Ga0209039_10110930 | Not Available | 1168 | Open in IMG/M |
3300027825|Ga0209039_10133674 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300027882|Ga0209590_10331551 | Not Available | 979 | Open in IMG/M |
3300028867|Ga0302146_10421094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300029944|Ga0311352_10489764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 995 | Open in IMG/M |
3300029952|Ga0311346_10726288 | Not Available | 855 | Open in IMG/M |
3300030014|Ga0302175_10031018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
3300030019|Ga0311348_10554899 | Not Available | 857 | Open in IMG/M |
3300030862|Ga0265753_1116907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 556 | Open in IMG/M |
3300031421|Ga0308194_10115436 | Not Available | 791 | Open in IMG/M |
3300031469|Ga0170819_17705430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1317 | Open in IMG/M |
3300031474|Ga0170818_103849491 | Not Available | 739 | Open in IMG/M |
3300031543|Ga0318516_10423535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300031561|Ga0318528_10733466 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300031564|Ga0318573_10041719 | Not Available | 2202 | Open in IMG/M |
3300031573|Ga0310915_10113974 | Not Available | 1840 | Open in IMG/M |
3300031681|Ga0318572_10148639 | Not Available | 1352 | Open in IMG/M |
3300031736|Ga0318501_10090726 | Not Available | 1510 | Open in IMG/M |
3300031744|Ga0306918_10643694 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300031744|Ga0306918_10839442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300031754|Ga0307475_11494965 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300031796|Ga0318576_10150283 | Not Available | 1085 | Open in IMG/M |
3300031820|Ga0307473_10111080 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300031820|Ga0307473_10460611 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300031832|Ga0318499_10096981 | Not Available | 1138 | Open in IMG/M |
3300031846|Ga0318512_10596879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300031954|Ga0306926_12624259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 549 | Open in IMG/M |
3300031959|Ga0318530_10161135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
3300032060|Ga0318505_10028323 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
3300032076|Ga0306924_12278270 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300032076|Ga0306924_12523024 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300032090|Ga0318518_10290762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
3300032261|Ga0306920_100690976 | Not Available | 1504 | Open in IMG/M |
3300032756|Ga0315742_13261948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 524 | Open in IMG/M |
3300033433|Ga0326726_10518592 | Not Available | 1141 | Open in IMG/M |
3300033433|Ga0326726_11678867 | Not Available | 619 | Open in IMG/M |
3300033887|Ga0334790_238387 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300034090|Ga0326723_0580268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 518 | Open in IMG/M |
3300034817|Ga0373948_0092428 | Not Available | 703 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.36% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.68% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.09% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.34% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.75% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.75% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.75% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.75% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.17% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.17% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.17% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.17% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.17% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.17% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.17% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.17% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.17% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.58% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.58% |
Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.58% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.58% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.58% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.58% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.58% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.58% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.58% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.58% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.58% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.58% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.58% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.58% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007770 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011081 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD2_06349050 | 2189573001 | Grass Soil | AMNRSAKGGLGRACTMGAKAYSFTHRNKVIADGTERKSNA |
ICCgaii200_10045092 | 2228664021 | Soil | SAKGGQGRARTMGAKAFSYTHRTKVFADGTVRKIRA |
F14TC_1013988671 | 3300000559 | Soil | PKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA* |
JGI12269J14319_100936762 | 3300001356 | Peatlands Soil | MGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV* |
JGI20175J14863_10068641 | 3300001396 | Arctic Peat Soil | PKVGQGRACTMKAKAFSFTHRTKVFADGTVRKSDA* |
JGI12635J15846_102125482 | 3300001593 | Forest Soil | PKVGQGRACCMKAKAFSFTHRTKVFADGTVRKSDA* |
JGI12635J15846_104634911 | 3300001593 | Forest Soil | PKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA* |
JGI12627J18819_100263792 | 3300001867 | Forest Soil | MGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA* |
JGIcombinedJ26739_1012598721 | 3300002245 | Forest Soil | KPEMNRSAKGGQGRVCVSETKAFSFTHRTKVIADGTVRKNSA* |
Ga0062385_103734632 | 3300004080 | Bog Forest Soil | MNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA* |
Ga0066396_100577881 | 3300004267 | Tropical Forest Soil | MGKPETNRSAEGGQGRARHMGAKAFSFTIRNKVIADGTVRKNNA* |
Ga0066672_100446693 | 3300005167 | Soil | MGKPKMNRSAKGGQARVCTSETKAFSFTHRTKVFADATVRKNSA* |
Ga0066680_100501082 | 3300005174 | Soil | MGKPKMNRSAKGGQGRVCALKTKAFSFTHRTKVIADGTVRKDNA* |
Ga0066690_100522673 | 3300005177 | Soil | MGKPKMNRSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA* |
Ga0066388_1053261951 | 3300005332 | Tropical Forest Soil | MGKLKMNRSAKGGQGRVCTSKTKAFSFTHRTKVIADGTVRKNSA* |
Ga0070714_1014163881 | 3300005435 | Agricultural Soil | MGKPEMNRSAKGGQGRVCVSETKAFSFTHRTKVIADGTVRKNSA* |
Ga0070710_100692071 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRSAKGGFGRARTIRAKAFSFTHRTKVIADGTERKNSA* |
Ga0070708_1001280453 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKN |
Ga0066681_100831761 | 3300005451 | Soil | MNRSAKGGFGRARTMRAKAFSFTHRTKVIAGGTERKNSA* |
Ga0066695_102165193 | 3300005553 | Soil | PTMNRSAKGGTGRACSMKTKAFSFTRRTKVFADGTVRKNDA* |
Ga0066661_106698092 | 3300005554 | Soil | MGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNT* |
Ga0066699_107628751 | 3300005561 | Soil | VGQGRACYSGAKAFSFTHPLTKVIAGGTVRKNSA* |
Ga0066708_103398922 | 3300005576 | Soil | MGKPKMNQSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA* |
Ga0068856_1016235142 | 3300005614 | Corn Rhizosphere | GRPKVGQGRARTMGAKAFSYTHRTKVFADGTVRKIRA* |
Ga0066903_1004333932 | 3300005764 | Tropical Forest Soil | MGATSKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNSA* |
Ga0066656_100856804 | 3300006034 | Soil | KVGQGRVCTSKTKAFSFTHRTKVFAGGTVRKNNA* |
Ga0075029_1005091772 | 3300006052 | Watersheds | MNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTEQKNSA* |
Ga0075030_1014018611 | 3300006162 | Watersheds | PKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV* |
Ga0070712_1017473891 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRPKVGQGRARTMGAKAFSFTHRIKVFADGTVGKIKT* |
Ga0070765_1011581661 | 3300006176 | Soil | RPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA* |
Ga0079037_1025605743 | 3300006224 | Freshwater Wetlands | RTGRPKVGPGRARTMGAKAFSFTHRTKVFADGTVRKTNA* |
Ga0075433_108355191 | 3300006852 | Populus Rhizosphere | RPKAGQGRACIMEAKAFSFTRRTKVFADGTVRKNST* |
Ga0075425_1001071464 | 3300006854 | Populus Rhizosphere | MNRSAKGGQGRVCGLKTKAFSFTHRTKVIADGTVRKDNA* |
Ga0105015_10555292 | 3300007770 | Marine | RTGRPKVGQGRACTMEAKAFSFTHHTKVFADGTVRKTSV* |
Ga0099829_115656481 | 3300009038 | Vadose Zone Soil | RPKVGQGRVCTSETKAFSFTHRTKVIADGTVQKNNA* |
Ga0105106_101286741 | 3300009078 | Freshwater Sediment | KVGQGRACTMEAKAFSFTHRTKVFAGGMVRKNSA* |
Ga0105106_111021091 | 3300009078 | Freshwater Sediment | KVGQGRACTMEAKAFSFTHRTKVFAGGTVRKNSA* |
Ga0099828_114413991 | 3300009089 | Vadose Zone Soil | MNWSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKN |
Ga0099792_108941781 | 3300009143 | Vadose Zone Soil | MNRSAKGGIGRACTMEAKAFSFTHRTKVFADGTVRKNDA* |
Ga0105242_131387651 | 3300009176 | Miscanthus Rhizosphere | PKVGQGRACRMKAKAFSFTHRTKVFADGTVRKNDA* |
Ga0116128_10105151 | 3300009518 | Peatland | PKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA* |
Ga0116108_10217211 | 3300009519 | Peatland | RSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNT* |
Ga0116107_10140641 | 3300009548 | Peatland | KVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA* |
Ga0126374_100667893 | 3300009792 | Tropical Forest Soil | RPKVGQGRVCTSETKAFSFTQRTKVFADGTVQKNNA* |
Ga0116223_101092261 | 3300009839 | Peatlands Soil | KGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA* |
Ga0116223_102284631 | 3300009839 | Peatlands Soil | KVGQGRVCTSETKAFSFTHRTKVFAGGTVRKNNA* |
Ga0126382_102952731 | 3300010047 | Tropical Forest Soil | RPKAGQGRACTMEAKAFSFTRRTKVFADGTVRKNST* |
Ga0126373_100238856 | 3300010048 | Tropical Forest Soil | PKVGFGRARTIGAKAFSFTHRTKVIADGTERKNSA* |
Ga0126373_118109581 | 3300010048 | Tropical Forest Soil | KVGQGRARTMGAKAFSFTHRTKVFADGTVRKNSA* |
Ga0126373_122643571 | 3300010048 | Tropical Forest Soil | MGATPKMNWSAKGGVGRACTMKAKAFSFTRRTKVFADGTVRKNSA* |
Ga0126320_10927861 | 3300010146 | Soil | KVGKGRACTMKAKAFSFAHRTKVFADGTARKNNA* |
Ga0134088_107027651 | 3300010304 | Grasslands Soil | SAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA* |
Ga0074045_100149812 | 3300010341 | Bog Forest Soil | MNRSANGGQGRVCIAKTKALSFTHHTKVVADGTVRKNNA* |
Ga0126370_114256321 | 3300010358 | Tropical Forest Soil | ETNRSARGGGGRACTMEAKAFSFTRRTKVFADGTVWKSSA* |
Ga0126372_110464091 | 3300010360 | Tropical Forest Soil | TGRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNKA* |
Ga0126378_122395232 | 3300010361 | Tropical Forest Soil | PKVGQGRACTMEAKAFSFTHRTKVFADDTVGKNKA* |
Ga0126378_127019631 | 3300010361 | Tropical Forest Soil | TGRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA* |
Ga0126377_113913311 | 3300010362 | Tropical Forest Soil | PKAGQGRACTMEAKAFSFTRRTKVFADGTVRKNNA* |
Ga0126379_137611891 | 3300010366 | Tropical Forest Soil | KVGQGRACIMEAKAFSFTHRTKVFADGTVRKSDA* |
Ga0126381_1004507221 | 3300010376 | Tropical Forest Soil | KVGQGRACTMEAKAFSFTHRTKVFADGTVRKNSV* |
Ga0136449_1013925831 | 3300010379 | Peatlands Soil | GRPKVGQGRARTMGAKAFSFTHRIKVFADGTVGKIKT* |
Ga0136449_1014269312 | 3300010379 | Peatlands Soil | MNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNS |
Ga0118731_1037507691 | 3300010392 | Marine | KVGQGRACTMEAKAHSSTHRTKVFADGTVWKIHA* |
Ga0138563_10774211 | 3300011072 | Peatlands Soil | KGHPAMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA* |
Ga0138575_10314971 | 3300011081 | Peatlands Soil | KVGQGRACIMEAKAFSFTHRTKVFAGGTVRKSSA* |
Ga0137393_105988223 | 3300011271 | Vadose Zone Soil | RPQVGLGRAYTVKAKAFSFTHGTKVFADGTVRKNSA* |
Ga0137393_112729971 | 3300011271 | Vadose Zone Soil | MNRSAKGGIGRACTMEAKAFSFTHRTKVIADGTGRKNN |
Ga0137393_115430942 | 3300011271 | Vadose Zone Soil | KVGQGRVCTSETKAFSFTHRTKVIAGGTVQKNSA* |
Ga0153933_10806872 | 3300011411 | Attine Ant Fungus Gardens | MMNRSAKGGARSSPHYGAKAFSFTHRTKVFADGTVRKNSA* |
Ga0137389_100417254 | 3300012096 | Vadose Zone Soil | MTNRSAKGGQGRARTMGAKAFSSTHRTKVCADGTVRKTST* |
Ga0137388_107549191 | 3300012189 | Vadose Zone Soil | PQVGLGRAYTVKAKAFSFTHGTKVFADGTVRKNSA* |
Ga0137381_111947101 | 3300012207 | Vadose Zone Soil | MNRSAKGGQGRVCALKTKAFSFTHRTKVIADGTVRKDNA* |
Ga0137377_103188072 | 3300012211 | Vadose Zone Soil | MNRSAKGGIGRACTMEAKAFSFTHRTKVIADGTGRKNNA* |
Ga0150985_1063830002 | 3300012212 | Avena Fatua Rhizosphere | RPKVGQGRARTMGAKAFSFTHRIKVFAGGTVRKIET* |
Ga0150985_1164367591 | 3300012212 | Avena Fatua Rhizosphere | KVGQGRARTMGAKAFSSTHRIKVFADGTVRKIET* |
Ga0137387_101474401 | 3300012349 | Vadose Zone Soil | KVGQGRVCTSETKAFSFTHRTKVFAGGTVRKNSA* |
Ga0137386_112965551 | 3300012351 | Vadose Zone Soil | MNRSAKGGIGRACTMRAKAYSSTHRTKVIADGTERKNSA* |
Ga0157289_100415091 | 3300012903 | Soil | RPKVGQGRACTTKAKAFSFTHRTKVFADGTVWKNSA* |
Ga0157308_103655741 | 3300012910 | Soil | KVGQGRARTMGAKAFSFTHRIKVFAGGTVRKIKT* |
Ga0126375_104992342 | 3300012948 | Tropical Forest Soil | GRPKVGQGRACTMEAKAFSSTHRNKVCAVGTVRKI* |
Ga0126369_134705281 | 3300012971 | Tropical Forest Soil | GRPKAGQGRACTMEAKAFSFTRRTKVFADGTVRKSDA* |
Ga0164306_104772091 | 3300012988 | Soil | PKVGQGRVCEMKTKAFSFTHRTKVIAGGTVRKNST* |
Ga0134079_106234291 | 3300014166 | Grasslands Soil | PKVGQGRACTMEAKAYSFTHRTKVFADGTVGKNKA* |
Ga0181535_102817781 | 3300014199 | Bog | PKVGQGRACTMEAKAFSFTHRTKVFADGTVWKNSA* |
Ga0182018_103461391 | 3300014489 | Palsa | KVGQGRVCTSLTKAFSFTHRTKVIAGGTVRKDNV* |
Ga0182014_104430621 | 3300014491 | Bog | KVGQGRACTMEAKAFSFTHRTKVFADGTVQKNSA* |
Ga0181536_100883191 | 3300014638 | Bog | MNRSAKGGIGRACTMRAKAFSSTHRTKVIAGGTERKNSA* |
Ga0157377_101991941 | 3300014745 | Miscanthus Rhizosphere | GRPKVGQGRACRMKAKAFSFTHRTKVFADGTVRKNIA* |
Ga0182030_106147823 | 3300014838 | Bog | MNRSAKGGITMEAKAFSFTHRTKVIADGTGLKNNA* |
Ga0182036_117864781 | 3300016270 | Soil | EPVSPLVGQGRACYSGAKAFSFTHPLTKVIAGGTVRKNSA |
Ga0182035_100893593 | 3300016341 | Soil | AKGGVGRACTMKAKAFSFTRRTKVFADSTVRKNSA |
Ga0182040_101169381 | 3300016387 | Soil | PKVGQGRVCTMVTKAFSFTHRTKVFAGGTVWKNNA |
Ga0187849_10239991 | 3300017929 | Peatland | PKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA |
Ga0187803_104809571 | 3300017934 | Freshwater Sediment | PAMNRSAQGGSGRACTMEAKALSSTHRTKVIAGGTERKNGV |
Ga0187853_100560734 | 3300017940 | Peatland | MNRSAKGGIGRACTMRAKAFSSTHRTKVIAGGTERKNSA |
Ga0187850_101939852 | 3300017941 | Peatland | RPKVGQGRACNMEAKAFSFTHRTKVFADGTVQKNSA |
Ga0187891_11491772 | 3300017996 | Peatland | MMNRSAKGGISRACTMEAKAFSFTHRTKVFADGTVGKN |
Ga0187805_100257213 | 3300018007 | Freshwater Sediment | MGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV |
Ga0187888_11420071 | 3300018008 | Peatland | RPKVGQGRACTMEAKAFSFTHRTKVFADGTVGKNSA |
Ga0187873_12038011 | 3300018013 | Peatland | APKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNV |
Ga0187881_104236141 | 3300018024 | Peatland | MGATPMMNRSAKGGIGRACTMEAKAFSFTHRTKVFADGTVQKNSA |
Ga0187857_105258572 | 3300018026 | Peatland | PAMNRSAKGGIGRACTMEAKAFSFTHRTKVIAGGTGWKNNA |
Ga0187857_105270071 | 3300018026 | Peatland | RPKVGQGRACNMEAKAFSFTHRTKVFADGTVRKNSA |
Ga0190272_113560281 | 3300018429 | Soil | TGRPKVGQGRARTMGAKAFSYTHRTKVFADGTVRKIRA |
Ga0187852_12014382 | 3300019082 | Peatland | PKVGQGRACTMEAKAFSFTHRTKVFADGTVRKSDA |
Ga0193753_102199001 | 3300020034 | Soil | GRPKVGQGRACSMEAKAFSFTHRTKVFADGTVGKNKA |
Ga0210401_100389931 | 3300020583 | Soil | PKVGQGRVCEMKTKAFSFTHRTKVIAGGTVQKNST |
Ga0210405_114144431 | 3300021171 | Soil | MNRSAKGGIGRACTMEAKAFSFTHRTKVIADGTGWKNNA |
Ga0210408_105834771 | 3300021178 | Soil | RPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA |
Ga0193719_100181742 | 3300021344 | Soil | MNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0210397_105256962 | 3300021403 | Soil | PKAGQGRACTMEAKALSFTRRTKVFADGTVRKNSA |
Ga0210389_113253442 | 3300021404 | Soil | GRPKVGKVRARTMGAKAFSFTHRAKVFADGTIRKNNA |
Ga0210398_102764772 | 3300021477 | Soil | TDRPKVGQGRACTIKVKAFSFTHRTKVFADGTVRKNNA |
Ga0126371_105888001 | 3300021560 | Tropical Forest Soil | MNWSAKGGVGRACSMKAKAFSFTRRTKVFADGTVRK |
Ga0126371_120168151 | 3300021560 | Tropical Forest Soil | MMNRSANGGKGRACVYMAKALSFAHHTKVVADGTVRKNNV |
Ga0222729_10727001 | 3300022507 | Soil | PKVGQGRVCTSKTKAFSFTPHTKVIADGTVQKNSA |
Ga0242672_10709241 | 3300022720 | Soil | MNRSAKGGLGRACTMGAKAYSFTHRTKVIADGTERKSNA |
Ga0224551_10079843 | 3300023259 | Soil | RPKVGQGRARTMGAKAFSFTHRTKVYADGTVRKNKA |
Ga0208455_10328022 | 3300025453 | Peatland | AMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0208686_10539442 | 3300025500 | Peatland | MGAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNT |
Ga0207663_1000394911 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AMNQSANGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0209849_10079961 | 3300026215 | Soil | RPKVGQGRACTMKAKAFSFTHRTKVFADGTVRKNGA |
Ga0209761_11402821 | 3300026313 | Grasslands Soil | MNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNS |
Ga0209686_10115104 | 3300026315 | Soil | VSIVRWDPMGKPKMNRSAKGGQARVCTSETKAFSFTHRTKVFADGTVRKNSA |
Ga0209471_13363051 | 3300026318 | Soil | RPKVGQGRVCASKTKAFSFTHRTKVFADGTVQKNNA |
Ga0257169_10904251 | 3300026469 | Soil | RPKVGQGRVCTSKTKAFSFTHRTKVFAGGTVQKNSA |
Ga0209325_10019882 | 3300027050 | Forest Soil | GAAPKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNNA |
Ga0208603_10042251 | 3300027109 | Forest Soil | TGRPKVGQGRVCNIETKAFSFTHRTKVFAGGTVRKNSA |
Ga0209622_10097111 | 3300027502 | Forest Soil | PKVGQGRACNMEAKAFSFTHRTKVFADGTVRKNSV |
Ga0209492_10518571 | 3300027721 | Freshwater Sediment | RPKVGQGRACSMEAKAFSSTHRTKVFAGGTVWKIGA |
Ga0208989_101624111 | 3300027738 | Forest Soil | TGRPKVGQGRACTMKAKAFSFTHRNKVFADGTVRKNNA |
Ga0209039_100579372 | 3300027825 | Bog Forest Soil | AKGGQGRACTMEAKAYSFTHRTKVFADGTVGKNNA |
Ga0209039_101109302 | 3300027825 | Bog Forest Soil | MNRSAKGGLGRACTMKAKAFSFTHRTKVIADGTERKNNA |
Ga0209039_101336741 | 3300027825 | Bog Forest Soil | MMNRSAKGGIGRACTMEAKAFSFTHRTKVFAGGTVRKNSA |
Ga0209590_103315511 | 3300027882 | Vadose Zone Soil | PKVGQGRVCTSKTKAFSFTHRTKVFAGGTVQKNSA |
Ga0302146_104210941 | 3300028867 | Bog | GTGRPKVGQGRACTMKAKAFSFTHRAKVFADGTVGKNSA |
Ga0311352_104897642 | 3300029944 | Palsa | ERNRSAKGGTGQACTMKAKAFSFTHRTKVFADCTVRKSDA |
Ga0311346_107262882 | 3300029952 | Bog | PKVGQGRACTMKAKAFSFTHRAKVFADGTVGKNSA |
Ga0302175_100310182 | 3300030014 | Fen | MNRSAKGGLGRACTMKAKAFSFTHRTKVIADGTERKN |
Ga0311348_105548992 | 3300030019 | Fen | NRSAKGGLGRACTMKAKAFSFTHRTKVIADGTERKNNA |
Ga0265753_11169071 | 3300030862 | Soil | PKVGQGRVCTSETKAFSFTHRTKVFADGTVRKNSV |
Ga0308194_101154362 | 3300031421 | Soil | PQGRTGRPKVGQGRARTMGAKAFSYTHRTKVFADGTVRKIMA |
Ga0170819_177054302 | 3300031469 | Forest Soil | MNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNNA |
Ga0170818_1038494912 | 3300031474 | Forest Soil | HPAMNRSAKGGFGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0318516_104235351 | 3300031543 | Soil | PKVGQGRVCTSETKAFSFTHRTKVFADGTVRKNSA |
Ga0318528_107334661 | 3300031561 | Soil | VMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0318573_100417192 | 3300031564 | Soil | MNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0310915_101139743 | 3300031573 | Soil | PKVGQGRVCTMETKAFSFTHRTKVFAGGTVRKSSV |
Ga0318572_101486391 | 3300031681 | Soil | GRPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA |
Ga0318501_100907261 | 3300031736 | Soil | GRNQWGHPVMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0306918_106436941 | 3300031744 | Soil | PKVGQGRACTLKAKAFSFTHRTKVFADGTVRKNDA |
Ga0306918_108394421 | 3300031744 | Soil | MNRSAKGGQGRVCIAKTKAFSFTHHTKVVADGTVRKNN |
Ga0307475_114949652 | 3300031754 | Hardwood Forest Soil | VKFPGPTRPKVGQGRVCTSETKAFSFTHRTKVFADG |
Ga0318576_101502832 | 3300031796 | Soil | QWGHPVMNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKNSA |
Ga0307473_101110801 | 3300031820 | Hardwood Forest Soil | TGRPKVGQGRVCTSETKAFSFTHRTKVFADGTVQKNNA |
Ga0307473_104606112 | 3300031820 | Hardwood Forest Soil | MNRSAKGGQGRACTMEAKAFPFTHRTKVFADGTVRKNNT |
Ga0318499_100969812 | 3300031832 | Soil | RPKVGQGRARTMGAKAFSFTHRTKVFADGTVRKIRA |
Ga0318512_105968791 | 3300031846 | Soil | RPKVGQGRVCTSETKAFSFTHRTKVFADGTVRKNSA |
Ga0306926_126242591 | 3300031954 | Soil | MTRSAIGGQGRVCEMKTKAFSFTHRTKVIAGGTVRKNNDVTSGEL |
Ga0318530_101611352 | 3300031959 | Soil | MNRSAKGGLGRARTMRAKAFSFTHRTKVIADGTERKN |
Ga0318505_100283233 | 3300032060 | Soil | MNRSANGGQGRVRETGTKAFSFTHQTKVFAGSTVRKNNA |
Ga0306924_122782701 | 3300032076 | Soil | TGRPKVGQGRARTMGAKAFSFTHRIKVFADGTVGKIKT |
Ga0306924_125230241 | 3300032076 | Soil | KMNWSAKGGAGRACTMEAKAFSFSRRTKVFADGTVWKSKA |
Ga0318518_102907621 | 3300032090 | Soil | MNRSAKGGVGRACTMKAKAFSFTRRTKVFADGTVRKNS |
Ga0306920_1006909761 | 3300032261 | Soil | TGRPKVGQGRACTMEAKAFSFTHRTKVFADGTVRKNSV |
Ga0315742_132619482 | 3300032756 | Forest Soil | MNRSAKGGIGRACTMKAKAFSFTHRTKVIADGTGRK |
Ga0326726_105185921 | 3300033433 | Peat Soil | NQWGHPVMNRSAKGGFGRACTMRAKAFSSTHRTKVIAGGTERKNNA |
Ga0326726_116788671 | 3300033433 | Peat Soil | GATPEMNRSAKGGQGRACTMKAKAFSFTHRTKVFADGTVRKSGA |
Ga0334790_238387_277_384 | 3300033887 | Soil | MNRSAKGGITMEAKAFSFTHRTKVIADGTGLKNNA |
Ga0326723_0580268_392_517 | 3300034090 | Peat Soil | PKMNRSAKGGQGRACTMEAKAFSFTHRTKVFADGTVRKNSV |
Ga0373948_0092428_587_703 | 3300034817 | Rhizosphere Soil | TGRPKVGQGRACTMEAKAFSSTHRTKVFAVGTVRKIWA |
⦗Top⦘ |