NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035910

Metagenome / Metatranscriptome Family F035910

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035910
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 46 residues
Representative Sequence MRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS
Number of Associated Samples 147
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 12.28 %
% of genes near scaffold ends (potentially truncated) 43.27 %
% of genes from short scaffolds (< 2000 bps) 83.63 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.287 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(16.959 % of family members)
Environment Ontology (ENVO) Unclassified
(29.240 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.538 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 73.81%    β-sheet: 0.00%    Coil/Unstructured: 26.19%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF07883Cupin_2 18.71
PF01872RibD_C 8.77
PF10944DUF2630 4.68
PF00210Ferritin 4.09
PF14333DUF4389 2.92
PF03358FMN_red 2.92
PF01926MMR_HSR1 1.75
PF08734GYD 1.75
PF13231PMT_2 1.75
PF00903Glyoxalase 1.17
PF10058zinc_ribbon_10 1.17
PF04079SMC_ScpB 1.17
PF02518HATPase_c 1.17
PF00950ABC-3 1.17
PF01434Peptidase_M41 0.58
PF01794Ferric_reduct 0.58
PF04993TfoX_N 0.58
PF00275EPSP_synthase 0.58
PF10617DUF2474 0.58
PF104171-cysPrx_C 0.58
PF069833-dmu-9_3-mt 0.58
PF00486Trans_reg_C 0.58
PF02628COX15-CtaA 0.58
PF02224Cytidylate_kin 0.58
PF01565FAD_binding_4 0.58
PF01479S4 0.58
PF01386Ribosomal_L25p 0.58
PF14714KH_dom-like 0.58
PF01210NAD_Gly3P_dh_N 0.58
PF11832DUF3352 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 8.77
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 8.77
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 1.75
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 1.17
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 1.17
COG1386Chromosome segregation and condensation protein ScpBTranscription [K] 1.17
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 1.17
COG0283Cytidylate kinaseNucleotide transport and metabolism [F] 0.58
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.58
COG1612Heme A synthaseCoenzyme transport and metabolism [H] 0.58
COG1825Ribosomal protein L25 (general stress protein Ctc)Translation, ribosomal structure and biogenesis [J] 0.58
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.58
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.58
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.58


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.46 %
UnclassifiedrootN/A17.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig13894Not Available709Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig1192042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2766Open in IMG/M
2170459017|G14TP7Y01CNJB9All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
2228664021|ICCgaii200_c0891531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
2228664022|INPgaii200_c1047635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1344Open in IMG/M
3300000550|F24TB_10259821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
3300000953|JGI11615J12901_10020958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300000956|JGI10216J12902_100787913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300001305|C688J14111_10087508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300001431|F14TB_100475649Not Available826Open in IMG/M
3300001686|C688J18823_10435669Not Available845Open in IMG/M
3300002503|C687J35164_10205446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300002568|C688J35102_118415918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300002568|C688J35102_119959533Not Available827Open in IMG/M
3300002911|JGI25390J43892_10003282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3521Open in IMG/M
3300003990|Ga0055455_10072574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300004156|Ga0062589_101276258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300005167|Ga0066672_10446109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium845Open in IMG/M
3300005171|Ga0066677_10432060Not Available753Open in IMG/M
3300005175|Ga0066673_10003723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5877Open in IMG/M
3300005176|Ga0066679_10704465All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300005179|Ga0066684_10790314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300005181|Ga0066678_10230334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300005187|Ga0066675_11085225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300005187|Ga0066675_11360576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300005294|Ga0065705_10427703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria850Open in IMG/M
3300005330|Ga0070690_100212293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1352Open in IMG/M
3300005338|Ga0068868_100089766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2474Open in IMG/M
3300005338|Ga0068868_101353115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300005347|Ga0070668_100090421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2412Open in IMG/M
3300005356|Ga0070674_101346832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300005434|Ga0070709_10533898Not Available895Open in IMG/M
3300005434|Ga0070709_11047546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300005434|Ga0070709_11152971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005435|Ga0070714_102468750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300005436|Ga0070713_101561116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300005440|Ga0070705_100997333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300005444|Ga0070694_101527553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300005451|Ga0066681_10972025Not Available507Open in IMG/M
3300005454|Ga0066687_10178120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1145Open in IMG/M
3300005454|Ga0066687_10462751All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005467|Ga0070706_100825512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300005468|Ga0070707_100117098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. YIM 1300012586Open in IMG/M
3300005471|Ga0070698_100697117Not Available957Open in IMG/M
3300005529|Ga0070741_10725764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300005536|Ga0070697_101087530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria712Open in IMG/M
3300005539|Ga0068853_101240136All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales720Open in IMG/M
3300005540|Ga0066697_10561031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300005559|Ga0066700_10294550Not Available1142Open in IMG/M
3300005560|Ga0066670_10203519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1189Open in IMG/M
3300005561|Ga0066699_10357103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1044Open in IMG/M
3300005566|Ga0066693_10209009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Trueperales → Trueperaceae → unclassified Trueperaceae → Trueperaceae bacterium761Open in IMG/M
3300005568|Ga0066703_10461419All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005574|Ga0066694_10211278Not Available921Open in IMG/M
3300005575|Ga0066702_10436469All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300005615|Ga0070702_101896281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300006049|Ga0075417_10627706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300006173|Ga0070716_100818379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria722Open in IMG/M
3300006573|Ga0074055_11786425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300006796|Ga0066665_10137305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1842Open in IMG/M
3300006800|Ga0066660_11379317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300006804|Ga0079221_10170390All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300006806|Ga0079220_10019314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2840Open in IMG/M
3300006903|Ga0075426_10029740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3913Open in IMG/M
3300006954|Ga0079219_10630954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300007255|Ga0099791_10238541Not Available861Open in IMG/M
3300009012|Ga0066710_101038621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300009012|Ga0066710_103704337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300009090|Ga0099827_11513701Not Available584Open in IMG/M
3300009092|Ga0105250_10239222All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria774Open in IMG/M
3300009098|Ga0105245_11737350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300009147|Ga0114129_11802408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria744Open in IMG/M
3300009553|Ga0105249_12273131All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300010045|Ga0126311_11279510Not Available609Open in IMG/M
3300010303|Ga0134082_10321263Not Available651Open in IMG/M
3300010323|Ga0134086_10398318Not Available553Open in IMG/M
3300010337|Ga0134062_10111016Not Available1186Open in IMG/M
3300010364|Ga0134066_10391586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300010371|Ga0134125_10530145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1303Open in IMG/M
3300012198|Ga0137364_10253295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1301Open in IMG/M
3300012198|Ga0137364_10559933Not Available861Open in IMG/M
3300012198|Ga0137364_10678144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300012198|Ga0137364_10818577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300012198|Ga0137364_11092329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300012201|Ga0137365_10002497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria14591Open in IMG/M
3300012205|Ga0137362_11761558All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012206|Ga0137380_11326771All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012208|Ga0137376_10772979Not Available827Open in IMG/M
3300012208|Ga0137376_11076018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300012210|Ga0137378_10038052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4295Open in IMG/M
3300012212|Ga0150985_110080609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → unclassified Microcoleus → Microcoleus sp. SIO2G31008Open in IMG/M
3300012285|Ga0137370_10480399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300012350|Ga0137372_10051391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3639Open in IMG/M
3300012354|Ga0137366_10153971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1729Open in IMG/M
3300012356|Ga0137371_10063869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2851Open in IMG/M
3300012469|Ga0150984_105840075Not Available513Open in IMG/M
3300012911|Ga0157301_10070464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300012955|Ga0164298_10218243Not Available1128Open in IMG/M
3300012989|Ga0164305_10408960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300012989|Ga0164305_11039163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300013306|Ga0163162_12986914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300014166|Ga0134079_10098312Not Available1113Open in IMG/M
3300014326|Ga0157380_12776104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria556Open in IMG/M
3300014488|Ga0182001_10072425Not Available995Open in IMG/M
3300015077|Ga0173483_10288578All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300015357|Ga0134072_10263044Not Available627Open in IMG/M
3300017792|Ga0163161_10745896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300017939|Ga0187775_10001331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5875Open in IMG/M
3300017944|Ga0187786_10562798Not Available529Open in IMG/M
3300017965|Ga0190266_10007504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2609Open in IMG/M
3300018027|Ga0184605_10004401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4990Open in IMG/M
3300018027|Ga0184605_10362355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300018028|Ga0184608_10008389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3447Open in IMG/M
3300018028|Ga0184608_10331811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300018061|Ga0184619_10021685All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300018061|Ga0184619_10139529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300018089|Ga0187774_10564568All Organisms → cellular organisms → Bacteria → Terrabacteria group730Open in IMG/M
3300018431|Ga0066655_10224867Not Available1179Open in IMG/M
3300018431|Ga0066655_10815906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300018433|Ga0066667_10000804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11124Open in IMG/M
3300018465|Ga0190269_10291026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria946Open in IMG/M
3300018482|Ga0066669_10868379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300019362|Ga0173479_10824825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300019877|Ga0193722_1110789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300019885|Ga0193747_1012758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2040Open in IMG/M
3300019887|Ga0193729_1029203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2338Open in IMG/M
3300019888|Ga0193751_1064391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1521Open in IMG/M
3300019888|Ga0193751_1145130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300020140|Ga0179590_1188958All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300020170|Ga0179594_10157292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300022756|Ga0222622_10272777All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300025159|Ga0209619_10144507Not Available1379Open in IMG/M
3300025552|Ga0210142_1014341Not Available1458Open in IMG/M
3300025898|Ga0207692_10062358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1935Open in IMG/M
3300025901|Ga0207688_11035537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300025930|Ga0207701_10843087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300025934|Ga0207686_10058661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2428Open in IMG/M
3300025939|Ga0207665_10036915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3251Open in IMG/M
3300025939|Ga0207665_10813867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300026306|Ga0209468_1140116Not Available660Open in IMG/M
3300026310|Ga0209239_1075629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1463Open in IMG/M
3300026312|Ga0209153_1085241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1169Open in IMG/M
3300026542|Ga0209805_1030912All Organisms → cellular organisms → Bacteria2745Open in IMG/M
3300026542|Ga0209805_1191633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria891Open in IMG/M
3300026547|Ga0209156_10379219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300026973|Ga0207479_101889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300028707|Ga0307291_1032383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1226Open in IMG/M
3300028710|Ga0307322_10125954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300028718|Ga0307307_10022854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1739Open in IMG/M
3300028718|Ga0307307_10054182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1179Open in IMG/M
3300028720|Ga0307317_10081385All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300028755|Ga0307316_10280946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300028782|Ga0307306_10148305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300028799|Ga0307284_10008716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2960Open in IMG/M
3300028799|Ga0307284_10133562All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300028824|Ga0307310_10691251All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300028875|Ga0307289_10019032All Organisms → cellular organisms → Bacteria2646Open in IMG/M
3300028881|Ga0307277_10002584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6993Open in IMG/M
3300028884|Ga0307308_10055149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1872Open in IMG/M
3300030511|Ga0268241_10001241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4507Open in IMG/M
3300031716|Ga0310813_10067943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2682Open in IMG/M
3300031716|Ga0310813_12370793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300031820|Ga0307473_10668844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300031938|Ga0308175_101441714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria769Open in IMG/M
3300031996|Ga0308176_12625565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria536Open in IMG/M
3300032179|Ga0310889_10652178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300032205|Ga0307472_100705941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300032770|Ga0335085_10439718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1503Open in IMG/M
3300032770|Ga0335085_10655535Not Available1173Open in IMG/M
3300032828|Ga0335080_10696279Not Available1059Open in IMG/M
3300033550|Ga0247829_10326534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1250Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.37%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.77%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.51%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.34%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.75%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.17%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.58%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.58%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.58%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.58%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.58%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.58%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.58%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.58%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002503Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300003990Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026973Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-C (SPAdes)EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_019562202124908016MRLDPNTHAFVMATAFLTSIFFAVAAMQVIALAIHLFVPGAG
KansclcFeb2_017333302124908045SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPG
4ZMR_010996502170459017Switchgrass, Maize And Mischanthus LitterMRLDPNTHAFVMATAFLTSICFAIAATSVMGLAIHLFVPGAG
ICCgaii200_089153122228664021SoilMRLDPNTHAYVMATAXFTSICFAIAAMSVIGLAIHXFAPGAS
INPgaii200_104763532228664022SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLVPGAS
F24TB_1025982133300000550SoilMDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPG*
JGI11615J12901_1002095813300000953SoilMDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIH
JGI10216J12902_10078791323300000956SoilMQLDPNTHAFVMATAFLTSICFSVAAMSVIALAIHLFVPGAG*
C688J14111_1008750823300001305SoilVHARRGHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG*
F14TB_10047564933300001431SoilMRLDPNTHALVMATAFMTSICFAVAAMGVIGLTIHLFVPGAG*
C688J18823_1043566913300001686SoilCRHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLLVPGAG*
C687J35164_1020544623300002503SoilVSLDPNTHAFVLATAFFTSIMFAIAALLPVGLALHFLFFGS*
C688J35102_11841591813300002568SoilMRLDPNTQAFVMATAFLTSICFAIAAMSVIALAIHVFVPGAS*
C688J35102_11995953313300002568SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAS*
JGI25390J43892_1000328233300002911Grasslands SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0055455_1007257423300003990Natural And Restored WetlandsLSDRARRLDPRLAVKLDPNTYWFVAATAFLTSICFAIAVMALLKVAIHLFVPGAA*
Ga0062589_10127625813300004156SoilMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS*
Ga0066672_1044610913300005167SoilMRLDPNTHAFVLATAFFTSITFAIAAMSVIALVLHLTLPG*
Ga0066677_1043206013300005171SoilDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG*
Ga0066673_1000372393300005175SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG*
Ga0066679_1070446523300005176SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0066684_1079031423300005179SoilMRLDPNTHAFVMATAFLTSLCFAIAAMQVIALAIHLFVPGAG*
Ga0066678_1023033423300005181SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG*
Ga0066675_1108522523300005187SoilMRLDPNTHAFVMATAFLTSICFALAAMQVIALAIHLFVPGAG*
Ga0066675_1136057613300005187SoilHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0065705_1042770333300005294Switchgrass RhizosphereMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFAPGAS*
Ga0070690_10021229333300005330Switchgrass RhizosphereLPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS*
Ga0068868_10008976643300005338Miscanthus RhizosphereMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0068868_10135311523300005338Miscanthus RhizosphereMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS*
Ga0070668_10009042133300005347Switchgrass RhizosphereMSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0070674_10134683223300005356Miscanthus RhizosphereISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0070709_1053389813300005434Corn, Switchgrass And Miscanthus RhizosphereSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS*
Ga0070709_1104754623300005434Corn, Switchgrass And Miscanthus RhizosphereMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAG*
Ga0070709_1115297113300005434Corn, Switchgrass And Miscanthus RhizosphereLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS*
Ga0070714_10246875023300005435Agricultural SoilHSESSISAAMSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0070713_10156111613300005436Corn, Switchgrass And Miscanthus RhizosphereSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS*
Ga0070705_10099733323300005440Corn, Switchgrass And Miscanthus RhizosphereMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAS*
Ga0070694_10152755313300005444Corn, Switchgrass And Miscanthus RhizosphereSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0066681_1097202523300005451SoilVAFLDHSESSISAAMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG*
Ga0066687_1017812033300005454SoilMRLDPNTRAFVMATAFLTSLCFAIAAMQVIALAIHLFVPGAG*
Ga0066687_1046275133300005454SoilFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG*
Ga0070706_10082551213300005467Corn, Switchgrass And Miscanthus RhizosphereSAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0070707_10011709833300005468Corn, Switchgrass And Miscanthus RhizosphereLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS*
Ga0070698_10069711723300005471Corn, Switchgrass And Miscanthus RhizosphereGFLDHSESSISAAMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAS*
Ga0070741_1072576423300005529Surface SoilMRLDPNTHAFVMATAFLTSICFSIAAMSVIALAIHLFVPGAG*
Ga0070697_10108753013300005536Corn, Switchgrass And Miscanthus RhizosphereMQLEGSRKRFAVLRQGIDRPRFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0068853_10124013613300005539Corn RhizosphereESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0066697_1056103113300005540SoilLAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0066700_1029455033300005559SoilDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0066670_1020351923300005560SoilMRLDPNTHAYVLATAFFTSITFAIAGMAVIALVLHLTLPS*
Ga0066699_1035710333300005561SoilRSPAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0066693_1020900923300005566SoilMRLDPNTHAYVMATALLTSICFAIAAMSVIALAIHLFVPGAG*
Ga0066703_1046141923300005568SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG*
Ga0066694_1021127813300005574SoilMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG*
Ga0066702_1043646933300005575SoilAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0070702_10189628113300005615Corn, Switchgrass And Miscanthus RhizosphereMSLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0075417_1062770623300006049Populus RhizosphereMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPCAS*
Ga0070716_10081837933300006173Corn, Switchgrass And Miscanthus RhizosphereGIDRSPFLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS
Ga0074055_1178642513300006573SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0066665_1013730523300006796SoilVDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG*
Ga0066660_1137931713300006800SoilVTHTESRPTAALRLMRLDPNTHAYVMATAFFTSITFAIAAMSVIALVLHLTLPS*
Ga0079221_1017039023300006804Agricultural SoilMRLDPNTHAFVMATAFLTSICFAIAAMSVIALAIHVFIPGAG*
Ga0079220_1001931473300006806Agricultural SoilAFVMATAFLTSICFAIAAMSVIALAIHVFIPGAG*
Ga0075426_1002974013300006903Populus RhizosphereLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAAMSVIALAIHVFIPGAG*
Ga0079219_1063095413300006954Agricultural SoilMRLDLNTHAFVMATAFLTWICFAIAAISVIALAIH
Ga0099791_1023854113300007255Vadose Zone SoilVAGHSRPTLSPGVDRSDFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0066710_10103862143300009012Grasslands SoilPSVDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS
Ga0066710_10370433733300009012Grasslands SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGA
Ga0099827_1151370113300009090Vadose Zone SoilMRLDPNTHAYVMATAFFTSICFATAAMSVIGLAIHLFVPGAG*
Ga0105250_1023922233300009092Switchgrass RhizosphereAAGIDRLPFLVHSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0105245_1173735013300009098Miscanthus RhizosphereMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHL
Ga0114129_1180240813300009147Populus RhizosphereDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS*
Ga0105249_1227313113300009553Switchgrass RhizosphereTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS*
Ga0126311_1127951013300010045Serpentine SoilMRLDPNTHAYVMATAFLTSICFAIAAMQVIALAIHLFVPGAG*
Ga0134082_1032126313300010303Grasslands SoilMRLDPNTHAFLMATALLTSITFVIAAMAVLGLAIHLFVPGAA*
Ga0134086_1039831813300010323Grasslands SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLLVPGAG*
Ga0134062_1011101623300010337Grasslands SoilMRLDPNTHAYVMATALLTSICFAIAAMSVVGLAIHLFVPGAG*
Ga0134066_1039158613300010364Grasslands SoilMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAGFLYI
Ga0134125_1053014533300010371Terrestrial SoilMSLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAG*
Ga0137364_1025329513300012198Vadose Zone SoilAKTDSRELRQGIDRQCFLDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0137364_1055993313300012198Vadose Zone SoilLPFVDHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG*
Ga0137364_1067814433300012198Vadose Zone SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVLGLAIHLFVPGAS*
Ga0137364_1081857713300012198Vadose Zone SoilQGIDRLPFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0137364_1109232923300012198Vadose Zone SoilLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0137365_10002497143300012201Vadose Zone SoilMSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0137362_1176155813300012205Vadose Zone SoilAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0137380_1132677113300012206Vadose Zone SoilAGGSRPRLSPGVDRSGFLDHSESSISAAMSLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0137376_1077297913300012208Vadose Zone SoilLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS*
Ga0137376_1107601813300012208Vadose Zone SoilMRLDPNTHAYVLATAFLTSICFAIAAMGVIALAIHLFVPGAS*
Ga0137378_1003805253300012210Vadose Zone SoilMRLDPNTHAYVMATAFFTSICFAIAAMSMIGLAIHLFVPGAS*
Ga0150985_11008060933300012212Avena Fatua RhizosphereRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG*
Ga0137370_1048039913300012285Vadose Zone SoilMRLDPNTHAYVMATAFLTSIGFTIAAMSVVGLAIHLFVPGAG*
Ga0137372_1005139113300012350Vadose Zone SoilDPALAVRLDPNTYAFVAATAFLTSIAFAVAVMGLIAIAIHLFVPGAG*
Ga0137366_1015397143300012354Vadose Zone SoilMSLDPNTHAYVMATAFFTSICFAISAMSVIGLAIHLLAPGAS*
Ga0137371_1006386953300012356Vadose Zone SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAT*
Ga0150984_10584007523300012469Avena Fatua RhizosphereRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAS*
Ga0157301_1007046413300012911SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFVPGAS*
Ga0164298_1021824333300012955SoilLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAG*
Ga0164305_1040896033300012989SoilMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHL
Ga0164305_1103916323300012989SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIRLLAPGGS*
Ga0163162_1298691413300013306Switchgrass RhizosphereAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS*
Ga0134079_1009831213300014166Grasslands SoilMRLDPNTHALVMATAFMTFICFAVAAMSVIGLTIHLFVPGAG*
Ga0157380_1277610413300014326Switchgrass RhizospherePNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS*
Ga0182001_1007242523300014488SoilMKLDPNTHAYVLATAFMTSIAFAIAAMQVIALLIHLFVPGAA*
Ga0173483_1028857823300015077SoilMRLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAS*
Ga0134072_1026304423300015357Grasslands SoilMRLDPNTRAFVMATAFLTSICFAIAAMSVIALAIHLFVPGAG*
Ga0163161_1074589623300017792Switchgrass RhizosphereAAGIDRLPFLVHSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS
Ga0187775_1000133153300017939Tropical PeatlandMKLDPNTHVFIAATAFLTSVAFAVAIMALIRVAIHLLVPGAG
Ga0187786_1056279823300017944Tropical PeatlandMKLDPNTHVFVAATAFLTSVAFAVAVMALIRVAIHLLVPGAG
Ga0190266_1000750433300017965SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS
Ga0184605_1000440143300018027Groundwater SedimentMRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAS
Ga0184605_1036235523300018027Groundwater SedimentMRLDPNTHAYVLATAFFTSITFAIAGMAVIALVLHLTLPS
Ga0184608_1000838933300018028Groundwater SedimentMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAG
Ga0184608_1033181113300018028Groundwater SedimentMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHRFVPGAS
Ga0184619_1002168513300018061Groundwater SedimentMRLDPNTHAYVMATAFFTSITFAIAAMSVIALVLHLTLPS
Ga0184619_1013952933300018061Groundwater SedimentMRLDPNTHAYVMATAFMTSVCFAIAAMSVIGLAIHLFVPGAG
Ga0187774_1056456813300018089Tropical PeatlandMKLDPNTHVFIAATAFLTSIAFAVAIMALIRLAVHLL
Ga0066655_1022486723300018431Grasslands SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVVGLAIHLFVPGAG
Ga0066655_1081590623300018431Grasslands SoilMRLDPSTRAFVMATAFLTSLCFAIAAMQVIALAIHLFVPGAG
Ga0066667_10000804163300018433Grasslands SoilLAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS
Ga0190269_1029102613300018465SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVP
Ga0066669_1086837923300018482Grasslands SoilVAFLDHSESSISAAMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG
Ga0173479_1082482523300019362SoilMRLDPNTHAFVMATAFLTSICFAIAATSVVGLAIHLFVPGAS
Ga0193722_111078913300019877SoilFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS
Ga0193747_101275833300019885SoilVRLDPSTYWFVAATAFLTSIAFAVAVMGLIQIAIHLFVPGAG
Ga0193729_102920323300019887SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHFLASGAS
Ga0193751_106439133300019888SoilISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS
Ga0193751_114513013300019888SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLASGAS
Ga0179590_118895823300020140Vadose Zone SoilAVPTFAPGVDRSDFLDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS
Ga0179594_1015729223300020170Vadose Zone SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLLAPGAS
Ga0222622_1027277713300022756Groundwater SedimentHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG
Ga0209619_1014450733300025159SoilVSLDPNTHAFVLATAFFTSIMFAIAALLPVGLALHFLFFGS
Ga0210142_101434113300025552Natural And Restored WetlandsVKLDPNTYWFVAATAFLTSICFAIACMALLKVAIHLFVPGAA
Ga0207692_1006235833300025898Corn, Switchgrass And Miscanthus RhizosphereMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLLVPGAG
Ga0207688_1103553723300025901Corn, Switchgrass And Miscanthus RhizosphereMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS
Ga0207701_1084308713300025930Corn, Switchgrass And Miscanthus RhizosphereAGIDRLSFLVHSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGA
Ga0207686_1005866143300025934Miscanthus RhizosphereSESSISAAMRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS
Ga0207665_1003691553300025939Corn, Switchgrass And Miscanthus RhizosphereAARIDRLSFLVHSASSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS
Ga0207665_1081386713300025939Corn, Switchgrass And Miscanthus RhizosphereIDRLPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS
Ga0209468_114011613300026306SoilMRLDPNTHALVMATAFMTSICFAVAAMSVIGLTIHLFVPGAG
Ga0209239_107562943300026310Grasslands SoilAFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIALAIHLFVPGAS
Ga0209153_108524113300026312SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAS
Ga0209805_103091243300026542SoilVRLDPSTYAFVAATAFLTSIAFAVAVMGLIQIAIHLFVPGAA
Ga0209805_119163333300026542SoilMRLDPNTHAFVLATAFFTSITFAIAAMSVIALVLHLTLPS
Ga0209156_1037921923300026547SoilMRLDPNTHAFVMATAFLTSICFALAAMQVIALAIHLFVPGAG
Ga0207479_10188923300026973SoilMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFVPGAS
Ga0307291_103238323300028707SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG
Ga0307322_1012595413300028710SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLF
Ga0307307_1002285433300028718SoilMRLDPNTHAYVLATAFLTSICFAIAAMSVIALAIHLFVPGAS
Ga0307307_1005418233300028718SoilDPNTHAYVMATAFFTSICFAIAGMSVIGLAIHLFVPGAS
Ga0307317_1008138533300028720SoilPGPLHSESSISAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG
Ga0307316_1028094613300028755SoilRKKRFAAGIDRLSFLVHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS
Ga0307306_1014830523300028782SoilSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHLFVPGAS
Ga0307284_1000871643300028799SoilMRLDPNTHAYVMATAFFTSICFAIAGMSVIGLAIHLFVPGAS
Ga0307284_1013356213300028799SoilHAYVLATAFLTSICFAIAAMSVIALAIHLFVPGAS
Ga0307310_1069125113300028824SoilAAMRLDPNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG
Ga0307289_1001903213300028875SoilNTHAYVMATAFLTSICFAIAAMSVIGLAIHLFVPGAG
Ga0307277_1000258473300028881SoilMRLDPNTQAFVMATAFLTSICFAIAAMSVIALGIYLFVPGAS
Ga0307308_1005514933300028884SoilMARRPFSAHAVYRASAALRLMRLDPNTHAYVLATAFFTSITFAIAGMAVIALVLHLTLPS
Ga0268241_1000124123300030511SoilMGEDSHTLRVHSEYSISAAMRLDPNTHALVMATAFVTSICFAVAAMSVIGLTIHLFVPGA
Ga0310813_1006794373300031716SoilFLVHSQSSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGLAIHVFVPGAS
Ga0310813_1237079313300031716SoilMDHSESSISAAMRLDPNTHAYVMATAFFTSICFAIAAMSVIGL
Ga0307473_1066884433300031820Hardwood Forest SoilRLPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS
Ga0308175_10144171433300031938SoilMRLDPNTHAYVMATALLTSICFAIAAMSVIALAIH
Ga0308176_1262556523300031996SoilMRLDPNTHAYVMATAFLTSICFAIAAMSVIALAIHLFVPGAG
Ga0310889_1065217813300032179SoilLPSLDHSESSISAAMRLDPNTHAFVMATAFLTSICFAIAATSVIGLAIHLFVPGAS
Ga0307472_10070594123300032205Hardwood Forest SoilMSLDPNTHAYVMATAFLTSIFFAIAAMSVLGLAVHLFVPGAS
Ga0335085_1043971823300032770SoilMKLDPNTHVFIAATAFLTSIAFAVAIMALIRLAVHLLVPGAG
Ga0335085_1065553533300032770SoilMKLDPNTHVFIAATAFLTSIAFAVAIMALIRVAVHLLVPGAG
Ga0335080_1069627933300032828SoilMKLDPNTHAFIAATAFLTSIAFAVAVMALIRMAIHLLVPGAG
Ga0247829_1032653433300033550SoilRLDPNTHAYVMATAFFTSLCFAIAAMSVIGLAIHLFVPGAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.