NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F035945

Metagenome / Metatranscriptome Family F035945

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F035945
Family Type Metagenome / Metatranscriptome
Number of Sequences 171
Average Sequence Length 40 residues
Representative Sequence MSDFPHKSERVSGLEAWALALATALVALIAVGVVPHVHW
Number of Associated Samples 143
Number of Associated Scaffolds 171

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.93 %
% of genes near scaffold ends (potentially truncated) 23.98 %
% of genes from short scaffolds (< 2000 bps) 81.29 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.819 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(7.602 % of family members)
Environment Ontology (ENVO) Unclassified
(19.883 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.860 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 38.81%    β-sheet: 0.00%    Coil/Unstructured: 61.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 171 Family Scaffolds
PF03601Cons_hypoth698 9.36
PF00667FAD_binding_1 7.02
PF030614HBT 4.09
PF00258Flavodoxin_1 3.51
PF03460NIR_SIR_ferr 1.75
PF02738MoCoBD_1 1.75
PF01799Fer2_2 1.17
PF00596Aldolase_II 0.58
PF03861ANTAR 0.58
PF01036Bac_rhodopsin 0.58
PF132794HBT_2 0.58
PF13379NMT1_2 0.58
PF01315Ald_Xan_dh_C 0.58
PF01618MotA_ExbB 0.58

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 171 Family Scaffolds
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 9.36
COG0369Flavoprotein (flavin reductase) subunit CysJ of sulfite and N-hydroxylaminopurine reductasesNucleotide transport and metabolism [F] 7.02
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.58
COG5524BacteriorhodopsinSignal transduction mechanisms [T] 0.58

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.82 %
UnclassifiedrootN/A39.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2044078003|MGB_F548DK201D8D6XNot Available500Open in IMG/M
2228664022|INPgaii200_c0347775Not Available517Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101644274All Organisms → cellular organisms → Bacteria → Proteobacteria2909Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101644801Not Available804Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1057454Not Available596Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10104552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium697Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10145312Not Available572Open in IMG/M
3300004020|Ga0055440_10005841All Organisms → cellular organisms → Bacteria2059Open in IMG/M
3300004024|Ga0055436_10000899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4766Open in IMG/M
3300004281|Ga0066397_10027115All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300004463|Ga0063356_100337132All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300004479|Ga0062595_100499674Not Available913Open in IMG/M
3300004480|Ga0062592_102633141Not Available508Open in IMG/M
3300004633|Ga0066395_10043116All Organisms → cellular organisms → Bacteria1957Open in IMG/M
3300005162|Ga0066814_10020750Not Available911Open in IMG/M
3300005162|Ga0066814_10103106Not Available536Open in IMG/M
3300005163|Ga0066823_10092264Not Available610Open in IMG/M
3300005168|Ga0066809_10021794All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300005168|Ga0066809_10075826Not Available791Open in IMG/M
3300005183|Ga0068993_10161204Not Available761Open in IMG/M
3300005206|Ga0068995_10025353Not Available949Open in IMG/M
3300005329|Ga0070683_100241333All Organisms → cellular organisms → Bacteria1718Open in IMG/M
3300005332|Ga0066388_100691344All Organisms → cellular organisms → Bacteria1628Open in IMG/M
3300005332|Ga0066388_100787488All Organisms → cellular organisms → Bacteria1545Open in IMG/M
3300005332|Ga0066388_101450092All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300005332|Ga0066388_107705299Not Available539Open in IMG/M
3300005332|Ga0066388_108462946Not Available512Open in IMG/M
3300005335|Ga0070666_10114216All Organisms → cellular organisms → Bacteria1869Open in IMG/M
3300005363|Ga0008090_15447400All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300005364|Ga0070673_102139066Not Available532Open in IMG/M
3300005434|Ga0070709_10001129All Organisms → cellular organisms → Bacteria → Proteobacteria14726Open in IMG/M
3300005434|Ga0070709_10089944All Organisms → cellular organisms → Bacteria → Proteobacteria2022Open in IMG/M
3300005434|Ga0070709_10772093Not Available752Open in IMG/M
3300005445|Ga0070708_100216363All Organisms → cellular organisms → Bacteria1796Open in IMG/M
3300005529|Ga0070741_10008999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria19675Open in IMG/M
3300005535|Ga0070684_101181619All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005617|Ga0068859_102807095All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. B501534Open in IMG/M
3300005713|Ga0066905_100126816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1793Open in IMG/M
3300005713|Ga0066905_100850392Not Available795Open in IMG/M
3300005718|Ga0068866_10121936All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300005764|Ga0066903_100026028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6444Open in IMG/M
3300005764|Ga0066903_103000935Not Available914Open in IMG/M
3300005834|Ga0068851_10119666All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300005937|Ga0081455_10000673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales44258Open in IMG/M
3300006028|Ga0070717_10203468All Organisms → cellular organisms → Bacteria1735Open in IMG/M
3300006047|Ga0075024_100162211All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300006047|Ga0075024_100406494Not Available694Open in IMG/M
3300006048|Ga0075363_100692527Not Available615Open in IMG/M
3300006050|Ga0075028_100442840Not Available750Open in IMG/M
3300006057|Ga0075026_100104239All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300006172|Ga0075018_10195333Not Available957Open in IMG/M
3300006172|Ga0075018_10553815Not Available606Open in IMG/M
3300006175|Ga0070712_102052271Not Available501Open in IMG/M
3300006573|Ga0074055_11668634Not Available607Open in IMG/M
3300006806|Ga0079220_10287715All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300006854|Ga0075425_100289891All Organisms → cellular organisms → Bacteria1883Open in IMG/M
3300006854|Ga0075425_102047685Not Available639Open in IMG/M
3300006871|Ga0075434_101113567All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300006931|Ga0097620_100177721All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300006954|Ga0079219_10006347All Organisms → cellular organisms → Bacteria → Proteobacteria3657Open in IMG/M
3300009078|Ga0105106_10717965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium714Open in IMG/M
3300009090|Ga0099827_11608563Not Available566Open in IMG/M
3300009092|Ga0105250_10617647Not Available504Open in IMG/M
3300009094|Ga0111539_10796306All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300009162|Ga0075423_12386116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300009792|Ga0126374_10547586All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300010046|Ga0126384_10131116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1902Open in IMG/M
3300010046|Ga0126384_10271075All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300010047|Ga0126382_10048458All Organisms → cellular organisms → Bacteria → Proteobacteria2471Open in IMG/M
3300010047|Ga0126382_11195017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300010360|Ga0126372_10386096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1272Open in IMG/M
3300010361|Ga0126378_13431040All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010371|Ga0134125_10070680All Organisms → cellular organisms → Bacteria → Proteobacteria3882Open in IMG/M
3300010371|Ga0134125_10377590All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300010371|Ga0134125_11689241Not Available689Open in IMG/M
3300010376|Ga0126381_100247838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2412Open in IMG/M
3300010401|Ga0134121_10282499All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300010863|Ga0124850_1068374All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300011000|Ga0138513_100012893All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300012480|Ga0157346_1025396All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300012483|Ga0157337_1003445Not Available957Open in IMG/M
3300012491|Ga0157329_1004379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales913Open in IMG/M
3300012493|Ga0157355_1002882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1007Open in IMG/M
3300012495|Ga0157323_1032601Not Available561Open in IMG/M
3300012500|Ga0157314_1007107All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300012884|Ga0157300_1036809All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300012913|Ga0157298_10335314Not Available551Open in IMG/M
3300012931|Ga0153915_11626212Not Available756Open in IMG/M
3300012948|Ga0126375_10207475All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300012948|Ga0126375_10446844Not Available948Open in IMG/M
3300012951|Ga0164300_10015376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2530Open in IMG/M
3300012986|Ga0164304_10002016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14627214Open in IMG/M
3300014325|Ga0163163_10101332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2902Open in IMG/M
3300014968|Ga0157379_11764793Not Available607Open in IMG/M
3300014969|Ga0157376_11451193All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300015371|Ga0132258_10015812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales16172Open in IMG/M
3300015371|Ga0132258_13758952Not Available1034Open in IMG/M
3300015372|Ga0132256_100333581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621608Open in IMG/M
3300015372|Ga0132256_102336034Not Available638Open in IMG/M
3300015373|Ga0132257_101008296All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300015373|Ga0132257_102171977Not Available718Open in IMG/M
3300015374|Ga0132255_105014334Not Available561Open in IMG/M
3300017792|Ga0163161_10954885All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300017944|Ga0187786_10024108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1645Open in IMG/M
3300017944|Ga0187786_10353716All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300017947|Ga0187785_10010173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14623180Open in IMG/M
3300017947|Ga0187785_10013555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2807Open in IMG/M
3300017973|Ga0187780_10360183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1028Open in IMG/M
3300017973|Ga0187780_10711852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium724Open in IMG/M
3300018028|Ga0184608_10040158All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300018029|Ga0187787_10204352All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300018054|Ga0184621_10237023Not Available652Open in IMG/M
3300018060|Ga0187765_10910609Not Available596Open in IMG/M
3300018067|Ga0184611_1122279All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300018073|Ga0184624_10497291Not Available531Open in IMG/M
3300019356|Ga0173481_10000576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14628078Open in IMG/M
3300021560|Ga0126371_10165141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2287Open in IMG/M
3300021560|Ga0126371_12198995Not Available666Open in IMG/M
3300022901|Ga0247788_1041427Not Available845Open in IMG/M
3300024232|Ga0247664_1147203All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300024310|Ga0247681_1050334All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300025538|Ga0210132_1002256All Organisms → cellular organisms → Bacteria → Proteobacteria2393Open in IMG/M
3300025558|Ga0210139_1055848Not Available799Open in IMG/M
3300025735|Ga0207713_1150731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales751Open in IMG/M
3300025912|Ga0207707_10263536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1495Open in IMG/M
3300025915|Ga0207693_10405486All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300025918|Ga0207662_10777027Not Available674Open in IMG/M
3300025944|Ga0207661_10281124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1487Open in IMG/M
3300025981|Ga0207640_10045575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2817Open in IMG/M
3300026452|Ga0256821_1038530Not Available547Open in IMG/M
3300026900|Ga0207444_1007274Not Available763Open in IMG/M
3300026933|Ga0207578_1004420Not Available915Open in IMG/M
3300026995|Ga0208761_1035605Not Available513Open in IMG/M
3300027443|Ga0207477_102726Not Available577Open in IMG/M
3300027483|Ga0207637_1000932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1379Open in IMG/M
3300027523|Ga0208890_1005636All Organisms → cellular organisms → Bacteria1517Open in IMG/M
3300027560|Ga0207981_1006635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2051Open in IMG/M
3300027775|Ga0209177_10074318All Organisms → cellular organisms → Bacteria → Proteobacteria1023Open in IMG/M
3300028379|Ga0268266_10769515All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300028380|Ga0268265_11871362Not Available607Open in IMG/M
3300028715|Ga0307313_10044388All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300028768|Ga0307280_10021674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1854Open in IMG/M
3300028784|Ga0307282_10004309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5411Open in IMG/M
3300028793|Ga0307299_10137065Not Available919Open in IMG/M
3300028793|Ga0307299_10153677Not Available866Open in IMG/M
3300031231|Ga0170824_108222292Not Available572Open in IMG/M
3300031241|Ga0265325_10000036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales96858Open in IMG/M
3300031421|Ga0308194_10213999Not Available630Open in IMG/M
3300031538|Ga0310888_10521759Not Available713Open in IMG/M
3300031543|Ga0318516_10189196All Organisms → cellular organisms → Bacteria1187Open in IMG/M
3300031545|Ga0318541_10000443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root146213536Open in IMG/M
3300031561|Ga0318528_10266082Not Available920Open in IMG/M
3300031562|Ga0310886_10003109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14625374Open in IMG/M
3300031716|Ga0310813_10018023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4758Open in IMG/M
3300031736|Ga0318501_10697252Not Available560Open in IMG/M
3300031740|Ga0307468_101163107Not Available692Open in IMG/M
3300031820|Ga0307473_10924261Not Available632Open in IMG/M
3300031854|Ga0310904_10004031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5295Open in IMG/M
3300031880|Ga0318544_10076898All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300031892|Ga0310893_10474641Not Available558Open in IMG/M
3300031943|Ga0310885_10690548All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300032054|Ga0318570_10185723All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300032205|Ga0307472_100096712All Organisms → cellular organisms → Bacteria → Proteobacteria2018Open in IMG/M
3300032770|Ga0335085_12133241Not Available565Open in IMG/M
3300032829|Ga0335070_10759362All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300032897|Ga0335071_11223969Not Available696Open in IMG/M
3300033004|Ga0335084_10066668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14623724Open in IMG/M
3300033433|Ga0326726_10259461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.1620Open in IMG/M
3300033758|Ga0314868_019534Not Available724Open in IMG/M
3300033760|Ga0314870_014588All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300034644|Ga0370548_044252Not Available775Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.02%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.09%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.51%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.51%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.34%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.34%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.92%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.75%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.17%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.17%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.58%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.58%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.58%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.58%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.58%
Switchgrass, Maize And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Switchgrass, Maize And Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.58%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.58%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.58%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.58%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.58%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.58%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.58%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.58%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2044078003Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, ILEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012480Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610Host-AssociatedOpen in IMG/M
3300012483Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610Host-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026452Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4EnvironmentalOpen in IMG/M
3300026900Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026933Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300027443Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027483Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033758Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_AEnvironmentalOpen in IMG/M
3300033760Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_CEnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MGB_15525902044078003Switchgrass, Maize And Miscanthus RhizosphereMSDFPHEFERISGLEAWALALATALVALIAIGIVPHVHW
INPgaii200_034777512228664022SoilMSDFPHKSERVSGLEAWALALATALVALIAVGVVPHVHW
INPhiseqgaiiFebDRAFT_10164427423300000364SoilMSDFPHKSERVSGLEAWALALATALVALIAVGVVPHVHW*
INPhiseqgaiiFebDRAFT_10164480123300000364SoilMSDFPHESERISGLEAWVLALATALVALIAIGIVPHVHW*
AF_2010_repII_A01DRAFT_105745423300000580Forest SoilMPDFPHESERISGLEAWALAFAMALVALIAIGIVPHVHW*
AF_2010_repII_A1DRAFT_1010455233300000597Forest SoilMSDFPHESERISGLEAWALAFAMALVALIAIGIVPHVHW*
AF_2010_repII_A1DRAFT_1014531223300000597Forest SoilMSDVPHKSERVSGLEAWALALATALVALIAVGVIPHLHW*
Ga0055440_1000584123300004020Natural And Restored WetlandsMSDFPHESERISGLEAWALAFATALVALIAIGIVPHVHW*
Ga0055436_1000089953300004024Natural And Restored WetlandsMSDFSHESERISGLEAWALAFATALVALIAIGIVPHAHW*
Ga0066397_1002711513300004281Tropical Forest SoilMSDVPHKSERLSGLEAWALALATALVALIAVGVIPHLHW*
Ga0063356_10033713223300004463Arabidopsis Thaliana RhizosphereMSDFPHEPERVSQLEAWTLALATALVALIAVGVVPHVHW*
Ga0062595_10049967413300004479SoilMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW*
Ga0062592_10263314113300004480SoilMSDFPHESERISGLEAWALALATALVALIAIGIVPHVDW*
Ga0066395_1004311623300004633Tropical Forest SoilMSDVPHKSERISGLEAWALALATALVALIAVGVIPHLHW*
Ga0066814_1002075013300005162SoilMSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0066814_1010310613300005162SoilMSDFPHKSERVSGLEAWALALATALVALIAVGVIPHVHW*
Ga0066823_1009226423300005163SoilMGAVPMSDFPNKSERVSGLEAWALALATALVALIAVGVIPHVHW*
Ga0066809_1002179423300005168SoilMSDFPNKSERVSGLEAWALALATALVALIAVGVIPHVHW*
Ga0066809_1007582623300005168SoilMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW*
Ga0068993_1016120423300005183Natural And Restored WetlandsMSDFSHESERISGLEAWALAFATALVALIAIGIVPHVHW*
Ga0068995_1002535323300005206Natural And Restored WetlandsMSDFPHVYKRISGLEAWALAFATALVALIAIGIVPHVHW*
Ga0070683_10024133323300005329Corn RhizosphereMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW*
Ga0066388_10069134433300005332Tropical Forest SoilMRNFPHKSERLSGLEAWALALATALVALIAVGVFPHGHW*
Ga0066388_10078748833300005332Tropical Forest SoilMSDFRHKSKRVSGLEAWALALATALVALIAVGVVPHAHW*
Ga0066388_10145009223300005332Tropical Forest SoilMSDFPRKSGRISGLEVWAFALATTLVALIAVGVVPLGHW*
Ga0066388_10770529923300005332Tropical Forest SoilMSDVPRKSERLSGMEAWALALATALVALIAVGVIPHLYW*
Ga0066388_10846294623300005332Tropical Forest SoilMSDVPHKSERLSGLEAWTLALATALVALIAVGVIPHLHW*
Ga0070666_1011421623300005335Switchgrass RhizosphereMSDLPRKSERVPGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0008090_1544740013300005363Tropical Rainforest SoilMSDFPNESERISGLEAWALAFAMALVALIAIGIVPHVHW*
Ga0070673_10213906623300005364Switchgrass RhizosphereSCRWMGAVPMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW*
Ga0070709_1000112973300005434Corn, Switchgrass And Miscanthus RhizosphereMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0070709_1008994423300005434Corn, Switchgrass And Miscanthus RhizosphereMTEFPRKSNRVSRLEALAFAFATALVALIAVGVVPGLHG*
Ga0070709_1077209313300005434Corn, Switchgrass And Miscanthus RhizosphereMTDFPHEPKRVSRLEAWAFALATVLVALIAVGVVPRVHW*
Ga0070708_10021636313300005445Corn, Switchgrass And Miscanthus RhizosphereMSDFPHKRERISGLEAWAFAFAAALVVLIVVGIVPQVHW*
Ga0070741_1000899993300005529Surface SoilMSDLPHEPERVSALEAWALALATALVALIAIGIVPHVHW*
Ga0070684_10118161923300005535Corn RhizosphereMGAVPMSDLPRKSERVPGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0068859_10280709513300005617Switchgrass RhizosphereGSCRWMGAVPMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW*
Ga0066905_10012681643300005713Tropical Forest SoilMSDVPRKSERLSGLEAWALALATALVALIAVGVIPHLHW*
Ga0066905_10085039223300005713Tropical Forest SoilLLEMGAVPMRNFPHKSERLSGLEAWALALATALVALIAVGVFPHGHW*
Ga0068866_1012193613300005718Miscanthus RhizosphereMCDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0066903_10002602863300005764Tropical Forest SoilMSDVPHKSERVSGLEAWALAFATALIALIAVGVIPHVHW*
Ga0066903_10300093523300005764Tropical Forest SoilMSDVPHKSERISGLEAWALALATALVALIDVGVIPHLHW*
Ga0068851_1011966623300005834Corn RhizosphereMSDFSHEPERSRLEAWSLALATALVALIAIGIVPHMHW*
Ga0081455_1000067393300005937Tabebuia Heterophylla RhizosphereMSDFPHESERISGLEAWALAFATALVALIAIGIVPHAHW*
Ga0070717_1020346823300006028Corn, Switchgrass And Miscanthus RhizosphereMTEFPRKPNRVSRLEALAFAFATALVALIAVGVVPGLHG*
Ga0075024_10016221123300006047WatershedsMTGFPQEPERVLGLEAWAPALATALVALIAVGVVPHVHW*
Ga0075024_10040649423300006047WatershedsMSDFLNKSERVSGLEAWALALATALVALIAVGVIPHVHW*
Ga0075363_10069252713300006048Populus EndosphereSRGSVTGAGPMSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0075028_10044284023300006050WatershedsMTDFPHEPERISGLEAWALALATALVALIAVGVVPHVHW*
Ga0075026_10010423923300006057WatershedsMSDFPNKSERVSGLETWALALATALVALIAVGVIPHVHW*
Ga0075018_1019533323300006172WatershedsMSDFPNKSERVSGVEAWALALATALVALIAVGVIPHVHW*
Ga0075018_1055381513300006172WatershedsHEPERISGLEAWALALATALVALIAVGVVPHVHW*
Ga0070712_10205227113300006175Corn, Switchgrass And Miscanthus RhizosphereMSDFPHKSKRVSGLEAWALALATALVALIAVGVVPHVHW*
Ga0074055_1166863423300006573SoilSRGSVTGASPMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW*
Ga0079220_1028771523300006806Agricultural SoilMSDFPHEPERVSPLEAWTLALAAALVALIAVGVIPHVHW*
Ga0075425_10028989113300006854Populus RhizosphereMSDLPRKSERVSGLEVWAFALATTLVALIAIGVVPHGHW*
Ga0075425_10204768523300006854Populus RhizosphereGSCRWMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0075434_10111356713300006871Populus RhizosphereMSDFPHESERISGLEAWALALATALVALIAIGIVPH
Ga0097620_10017772133300006931Switchgrass RhizosphereMSDFPHEFERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0079219_1000634763300006954Agricultural SoilMSDLPRKSGRVSGLEVWAFALATTLVVLIAIGVVRHGHW*
Ga0105106_1071796513300009078Freshwater SedimentMGADPMTDFPRGPERVSAIESWALAIATALVALIAVGVLPRVGW*
Ga0099827_1160856323300009090Vadose Zone SoilMEPIPMSDFPHKPERISGLEAWAFAFATALAALIVVGVVPQVHW*
Ga0105250_1061764723300009092Switchgrass RhizosphereMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHVHW*
Ga0111539_1079630623300009094Populus RhizosphereMGAVPMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW*
Ga0075423_1238611633300009162Populus RhizosphereYIMVLVAGMGAPPMSDFPHKSKRVSGLEAWALALATALVALIAVGVVPHVHW*
Ga0126374_1054758623300009792Tropical Forest SoilMASVSGNGSRLMSDVPHKSERLSGLEAWALALATALVALIAVGVIPHLHW*
Ga0126384_1013111633300010046Tropical Forest SoilMSNFPRKPERISGLEAWTFAFATALVALIVLGILPQVHW*
Ga0126384_1027107533300010046Tropical Forest SoilMSDFPNESERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0126382_1004845823300010047Tropical Forest SoilMSDVPHKLERLSGLEAWALALATALVALIAVGVIPHLHW*
Ga0126382_1119501713300010047Tropical Forest SoilMSDVPRKRSSGLGVLAFALATTLVALIAVGVVPHGHW*
Ga0126372_1038609613300010360Tropical Forest SoilMSDFPNESERISGLEAWALAFAMALVALIAIGIVPHAHW*
Ga0126378_1343104013300010361Tropical Forest SoilMASVSGNGSRLMSDVPHKSERLSGLEAWALALATALVALIAV
Ga0134125_1007068023300010371Terrestrial SoilMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0134125_1037759013300010371Terrestrial SoilMSDFSHEPERISRLEAWAFALATALVALIAIGIVPHVHW*
Ga0134125_1168924123300010371Terrestrial SoilMSDFPHEPERVSALEAWALAFATALVALIAVGVIPHVHW*
Ga0126381_10024783823300010376Tropical Forest SoilMSDVPHKSERVSGLEAWALALATALVALIDVGVIPHLHW*
Ga0134121_1028249923300010401Terrestrial SoilVTGAGPMSDFPHEFERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0124850_106837413300010863Tropical Forest SoilMSDVPRKSERLSGLEAWALALATALVALIAVGVIPH
Ga0138513_10001289323300011000SoilMSDSPDKRKRVSRLEAWAFAFATALVALITIGVVPTVHW*
Ga0157346_102539623300012480Arabidopsis RhizosphereMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVP
Ga0157337_100344523300012483Arabidopsis RhizosphereMGAVPMSDLPRKSGRVSGLEVWAFALATTLVALIAVGIVPHGHW*
Ga0157329_100437923300012491Arabidopsis RhizosphereMSDLPRKSERVSGLEVWAFALATTLVVLIAIGVVPHGHW*
Ga0157355_100288223300012493Unplanted SoilMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAIGVVPHGHW*
Ga0157323_103260123300012495Arabidopsis RhizosphereMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGIVPHGHW*
Ga0157314_100710723300012500Arabidopsis RhizosphereMGAVPMSDLPRKSERVSGLEVWAFALATTLVALTAVGVVPHGHW*
Ga0157300_103680913300012884SoilMSDFSHEPERISRLEAWSLALATALVALIAIGIVP
Ga0157298_1033531423300012913SoilMSDFPHESERISRLEAWALALATALVALIAIGIVPHVHW*
Ga0153915_1162621213300012931Freshwater WetlandsMTDFPHEPERVSGLEAWALALATALVALIAVGVVPHVHW*
Ga0126375_1020747523300012948Tropical Forest SoilMSDFSHESERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0126375_1044684423300012948Tropical Forest SoilMSDVPHKSERLSGLEGWALALATALVALIAVGVIPHLHW*
Ga0164300_1001537613300012951SoilPMSDLPRKSERVSGLEVWAFALATTPVALIAVGVVPHGHW*
Ga0164304_1000201643300012986SoilMSDFSHEPERISRLEAWSLALATALVAVIAIGIVPHMHW*
Ga0163163_1010133223300014325Switchgrass RhizosphereMGAVPISDLQRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW*
Ga0157379_1176479313300014968Switchgrass RhizosphereGAGPMSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW*
Ga0157376_1145119323300014969Miscanthus RhizosphereMGAVPMSDLPRKSERVSGLEIWAFALATTLVSLIAVGVVPHGHW*
Ga0132258_1001581253300015371Arabidopsis RhizosphereMSDFPHEPERVSALETWALALATALVALIAIGIVPHVHW*
Ga0132258_1375895223300015371Arabidopsis RhizosphereMSDFSHEPERISRLEAWVLALATALVALIAIGIVPHMHW*
Ga0132256_10033358113300015372Arabidopsis RhizosphereMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGIVPHG
Ga0132256_10233603423300015372Arabidopsis RhizosphereMSDFSHEPERISGLEAWALALATALVALIAIGVVPHVHW*
Ga0132257_10100829623300015373Arabidopsis RhizosphereMSDFPRKSDRVSGLEVWAFALATTLVALIAVGIVPHGHW*
Ga0132257_10217197723300015373Arabidopsis RhizosphereSCRWMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAIGVVPHGHW*
Ga0132255_10501433423300015374Arabidopsis RhizosphereMSDFPHESERISGLEAWALALATALVALIAIGIVPHMHW*
Ga0163161_1095488523300017792Switchgrass RhizosphereMGAVPISDLQRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW
Ga0187786_1002410823300017944Tropical PeatlandMSDVPHKAERVSGLEAWALAFATALIALIAVGVIPHVHW
Ga0187786_1035371613300017944Tropical PeatlandMTDFPHEPERVSGLEAWTLAFATALVALIAIGVVPHVHW
Ga0187785_1001017323300017947Tropical PeatlandMSDFPRKSGRISGLEVWAFALATTLVALIAVGVVPLGHW
Ga0187785_1001355553300017947Tropical PeatlandMTNRPHEPKRISRLEAWAFTLAATLVALIAIGVVPRVHG
Ga0187780_1036018323300017973Tropical PeatlandMTDFPHEPERMSGLEAWALAFATALVALIAIGVVPHVHW
Ga0187780_1071185223300017973Tropical PeatlandMTDFPHEPKRISRLEAWAFALATTLVALIAIGVVPRVHG
Ga0184608_1004015823300018028Groundwater SedimentMSDFPHKPERVSGLEAWALAFATALVALIVVGVVPQVHW
Ga0187787_1020435213300018029Tropical PeatlandMTKSPHEPKRVSRLEAWAFALATALVALIAIGLMPGVHG
Ga0184621_1023702323300018054Groundwater SedimentMSDVPHKPERVSGLEAWALALATALVALIAVGVIPHVHW
Ga0187765_1091060913300018060Tropical PeatlandMTDFPHEPERISGLEAWALAFATALVALIAIGVVPHVHW
Ga0184611_112227923300018067Groundwater SedimentMSDSPDKRKRVSRLEAWAFAFATALVALITIGVVPTVHW
Ga0184624_1049729123300018073Groundwater SedimentMSDVPHKSERVSGLEAWALALATALVALIAVGVIPHVHW
Ga0173481_1000057653300019356SoilMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW
Ga0126371_1016514123300021560Tropical Forest SoilMSDVPHKSERVSGLEAWALALATALVALIAVGVIPHLHW
Ga0126371_1219899523300021560Tropical Forest SoilMSDFRHKSKQVSGLEAWALALATALVALIAVGVVPHAHW
Ga0247788_104142713300022901SoilPMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW
Ga0247664_114720313300024232SoilMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW
Ga0247681_105033413300024310SoilMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHG
Ga0210132_100225613300025538Natural And Restored WetlandsMSDFPHESERISGLEAWALAFATALVALIAIGIVPHAHW
Ga0210139_105584823300025558Natural And Restored WetlandsMSDFSHESERISGLEAWALAFATALVALIAIGIVPHVHW
Ga0207713_115073123300025735Switchgrass RhizosphereMSDLPRKSERVPGLEVWAFALATTLVALIAVGVVPHGHW
Ga0207707_1026353623300025912Corn RhizosphereMSDFPHESERISGLEAWALALATALVALIAIGIVPHVHW
Ga0207693_1040548613300025915Corn, Switchgrass And Miscanthus RhizospherePMTDFPHEPKRVSRLEAWAFALATVLVALIAVGVVPRVHW
Ga0207662_1077702723300025918Switchgrass RhizospherePMSDLPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW
Ga0207661_1028112423300025944Corn RhizosphereMSDLPRKSERVSGLEIWAFALATTLVALIAVGVVPHGHW
Ga0207640_1004557533300025981Corn RhizosphereMSDFSHEPERFRGWKPWSLALATALVALIAIGIVPHMHW
Ga0256821_103853023300026452SedimentMSDFPHESERISGLEAWALAFATALVALIAIGIVPHVHW
Ga0207444_100727413300026900SoilFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW
Ga0207578_100442013300026933SoilSVTGAGPMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMHW
Ga0208761_103560513300026995SoilGMGAVPMSDFPNKSERVSGLEAWALALATALVALIAVGVIPHVHW
Ga0207477_10272623300027443SoilMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHMH
Ga0207637_100093223300027483SoilMSDFSHEPERISRLEAWSLALATALVAVIAIGIVPHMHW
Ga0208890_100563623300027523SoilGSVTGASPMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW
Ga0207981_100663523300027560SoilMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW
Ga0209177_1007431823300027775Agricultural SoilMSDFPHEPERVSPLEAWTLALAAALVALIAVGVIPHVHW
Ga0268266_1076951523300028379Switchgrass RhizosphereMSDFSHEPERISRLEAWSLALATALVALIAIGIVPHM
Ga0268265_1187136213300028380Switchgrass RhizosphereMSDFPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW
Ga0307313_1004438823300028715SoilIVAGNGSRLMSDVPHKPERVSGLEAWALALATALVALIAVGVIPHVHW
Ga0307280_1002167413300028768SoilMSDVPHKSERVSGLEAWALALATALIALIAVGVVPHVHW
Ga0307282_1000430913300028784SoilTYLLLEIGAVPMSDVPHKSERVSGLEAWALALATALIALTAVGVVPHVHW
Ga0307299_1013706513300028793SoilNGSRLMSDVPHKPERVSGLEAWALALATALVALIAVGVIPHVHW
Ga0307299_1015367713300028793SoilMSDVPHKSERVSGLEAWALALATALIALAAVGVVPHVHW
Ga0170824_10822229223300031231Forest SoilMTEFPNKPKRVSRLEAWAFALATTLVALIAIGVLPGVRG
Ga0265325_10000036193300031241RhizosphereMTDFPHKPKGVSRLEAWAFALATALVVLIAIGVVPGVHG
Ga0308194_1021399923300031421SoilVPMSDVPHKSERVSGLEAWALALATALIALTAVGVVPHVHW
Ga0310888_1052175923300031538SoilRGSVTGASPMSDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW
Ga0318516_1018919623300031543SoilMSDVPHDSERVSGLEAWALALATALVALIAVGVIPHLHW
Ga0318541_1000044313300031545SoilMNDVPHKSERVSGLEAWALALATALVALIAVGVIPHLHW
Ga0318528_1026608223300031561SoilMSDVPHDSERVSGLEAWALASATALVALIAVGVIPHLHW
Ga0310886_1000310943300031562SoilMGAVPISDLQRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW
Ga0310813_1001802333300031716SoilMSDFPHEPERVSQLEAWTLALATALVALIAVGVVPHVHW
Ga0318501_1069725223300031736SoilMSDVPHDSERVSGLEAWALALATALVALIAVGVIPHLDW
Ga0307468_10116310723300031740Hardwood Forest SoilMSDFPHESERISGLEAWSLALATALVALIAIGIVPHVHW
Ga0307473_1092426113300031820Hardwood Forest SoilMSDFPHESERISGLEAWSLALATALVALIAIGIVPHMHW
Ga0310904_1000403113300031854SoilPRKSERVSGLEVWAFALATTLVALIAVGVVPHGHW
Ga0318544_1007689823300031880SoilPHDSERVSGLEAWALALATALVALIAVGVIPHLHW
Ga0310893_1047464123300031892SoilDFSHEPERISRLEAWALALATALVALIAIGIVPHVHW
Ga0310885_1069054813300031943SoilMGAVPMSDLPRKSERVSGLEVWAFALATTLVALIAV
Ga0318570_1018572313300032054SoilMSDVPHDSERVSGLEAWALALATALVALIAVGVIPHL
Ga0307472_10009671223300032205Hardwood Forest SoilGMGAAPMCDFPHKSKRVSGLEAWAVALATALVALIAVGVVPHVHW
Ga0335085_1213324123300032770SoilMTDFPHEPERVSALEAWARALATALVALIAVGVVPHVHW
Ga0335070_1075936223300032829SoilMTDFPHEPERVSGLEAWALAFVTALVALIAIGVVPHVHW
Ga0335071_1122396923300032897SoilMTDFPHEPERVSALEAWALALATALVALIAVGVVPHVHW
Ga0335084_1006666843300033004SoilMSDFSHEPERISGLEAWALALATALVALIAIGVLPRVHW
Ga0326726_1025946123300033433Peat SoilMTDFPHEPERVSGLEAWALALATALVALIAVGVVPHVHW
Ga0314868_019534_32_1513300033758PeatlandMTDFPHEPERVSGLEAWAQAFVTALVALIAIGVVPHVHW
Ga0314870_014588_104_2233300033760PeatlandMTDFPHEPKRISRLEAWAFALATTLVALIAIGLVPRVHG
Ga0370548_044252_645_7643300034644SoilMSDVPHKSERVSGLEAWALALATALIALTAVGVVPHVHW

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.