Metagenome Family F036039

Basic Information
Family ID	F036039
Family Type	Metagenome
Number of Sequences	170
Average Sequence Length	42 residues
Representative Sequence	MLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE
Number of Associated Samples	64
Number of Associated Scaffolds	170

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.40 %
% of genes near scaffold ends (potentially truncated)	66.47 %
% of genes from short scaffolds (< 2000 bps)	97.06 %
Associated GOLD sequencing projects	64
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.25

Most Common Taxonomy
Group	Unclassified (85.882 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.647 % of family members)
Environment Ontology (ENVO)	Unclassified (97.647 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (97.647 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 170 Family Scaffolds
PF13456	RVT_3	1.76
PF01487	DHquinase_I	0.59
PF00076	RRM_1	0.59
PF14291	DUF4371	0.59
PF03514	GRAS	0.59
PF13041	PPR_2	0.59
PF00067	p450	0.59

COG ID	Name	Functional Category	% Frequency in 170 Family Scaffolds
COG0710	3-dehydroquinate dehydratase	Amino acid transport and metabolism [E]	0.59
COG2124	Cytochrome P450	Defense mechanisms [V]	0.59

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
All Organisms	root	All Organisms	14.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
cellular organisms	root	All Organisms → cellular organisms	14.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	14.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	13.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	10.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	6.47 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.18 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.71 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	1.18 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.59 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.59 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.76 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.18 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	1.18 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.59 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.59 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.76 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	1.18 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.18 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.59 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.59 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.18 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.59 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.59 %
Dichantheliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae	0.59 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.59 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	0.59 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.59 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.59 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.18 %
Dichanthelium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium	0.59 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.59 %
Triticum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum	0.59 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	0.59 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.59 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.59 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.59 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.18 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.59 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.59 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.59 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.59 %
Triticum urartu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu	0.59 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.59 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.59 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	85.88 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1.18 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.59 %
Dichanthelium oligosanthes	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	0.59 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.59 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.59 %
Triticum urartu	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu	0.59 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	0.59 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.59 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.59 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005364\|Ga0070673_102407580	Not Available	501	Open in IMG/M
3300013296\|Ga0157374_11391208	Not Available	724	Open in IMG/M
3300013297\|Ga0157378_11445835	Not Available	731	Open in IMG/M
3300015267\|Ga0182122_1044075	Not Available	579	Open in IMG/M
3300015269\|Ga0182113_1025633	Not Available	746	Open in IMG/M
3300015269\|Ga0182113_1070237	Not Available	557	Open in IMG/M
3300015269\|Ga0182113_1088475	Not Available	518	Open in IMG/M
3300015274\|Ga0182188_1010577	Not Available	792	Open in IMG/M
3300015275\|Ga0182172_1017924	Not Available	753	Open in IMG/M
3300015277\|Ga0182128_1079792	Not Available	502	Open in IMG/M
3300015279\|Ga0182174_1060325	Not Available	560	Open in IMG/M
3300015281\|Ga0182160_1037572	Not Available	634	Open in IMG/M
3300015282\|Ga0182124_1018791	Not Available	759	Open in IMG/M
3300015283\|Ga0182156_1043258	Not Available	620	Open in IMG/M
3300015283\|Ga0182156_1045323	Not Available	612	Open in IMG/M
3300015283\|Ga0182156_1070082	Not Available	539	Open in IMG/M
3300015283\|Ga0182156_1070951	Not Available	537	Open in IMG/M
3300015286\|Ga0182176_1042265	Not Available	629	Open in IMG/M
3300015286\|Ga0182176_1052481	Not Available	588	Open in IMG/M
3300015286\|Ga0182176_1065506	Not Available	548	Open in IMG/M
3300015287\|Ga0182171_1002179	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1401	Open in IMG/M
3300015287\|Ga0182171_1086917	Not Available	504	Open in IMG/M
3300015288\|Ga0182173_1010282	Not Available	905	Open in IMG/M
3300015288\|Ga0182173_1057550	Not Available	568	Open in IMG/M
3300015288\|Ga0182173_1065840	Not Available	546	Open in IMG/M
3300015289\|Ga0182138_1030117	Not Available	687	Open in IMG/M
3300015291\|Ga0182125_1003513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1257	Open in IMG/M
3300015291\|Ga0182125_1049017	Not Available	612	Open in IMG/M
3300015291\|Ga0182125_1083889	Not Available	522	Open in IMG/M
3300015292\|Ga0182141_1020376	Not Available	779	Open in IMG/M
3300015292\|Ga0182141_1087408	Not Available	514	Open in IMG/M
3300015294\|Ga0182126_1030843	Not Available	701	Open in IMG/M
3300015294\|Ga0182126_1064031	Not Available	568	Open in IMG/M
3300015296\|Ga0182157_1050831	Not Available	623	Open in IMG/M
3300015298\|Ga0182106_1033811	All Organisms → cellular organisms → Eukaryota	701	Open in IMG/M
3300015299\|Ga0182107_1042248	Not Available	661	Open in IMG/M
3300015299\|Ga0182107_1078681	Not Available	550	Open in IMG/M
3300015300\|Ga0182108_1073875	Not Available	564	Open in IMG/M
3300015300\|Ga0182108_1082086	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	546	Open in IMG/M
3300015303\|Ga0182123_1073721	Not Available	549	Open in IMG/M
3300015304\|Ga0182112_1016603	Not Available	860	Open in IMG/M
3300015307\|Ga0182144_1088111	Not Available	537	Open in IMG/M
3300015308\|Ga0182142_1077148	Not Available	570	Open in IMG/M
3300015308\|Ga0182142_1088978	Not Available	545	Open in IMG/M
3300015314\|Ga0182140_1058524	Not Available	622	Open in IMG/M
3300015321\|Ga0182127_1044566	Not Available	692	Open in IMG/M
3300015321\|Ga0182127_1046594	Not Available	683	Open in IMG/M
3300015322\|Ga0182110_1052787	Not Available	657	Open in IMG/M
3300015322\|Ga0182110_1070660	Not Available	601	Open in IMG/M
3300015322\|Ga0182110_1074571	Not Available	592	Open in IMG/M
3300015323\|Ga0182129_1000297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu	2702	Open in IMG/M
3300015323\|Ga0182129_1045700	Not Available	666	Open in IMG/M
3300015323\|Ga0182129_1092631	Not Available	539	Open in IMG/M
3300015323\|Ga0182129_1101626	Not Available	524	Open in IMG/M
3300015341\|Ga0182187_1058667	Not Available	775	Open in IMG/M
3300015342\|Ga0182109_1085898	Not Available	718	Open in IMG/M
3300015342\|Ga0182109_1206296	Not Available	518	Open in IMG/M
3300015343\|Ga0182155_1005062	Not Available	1691	Open in IMG/M
3300015343\|Ga0182155_1103540	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	668	Open in IMG/M
3300015343\|Ga0182155_1133363	Not Available	611	Open in IMG/M
3300015344\|Ga0182189_1140606	Not Available	606	Open in IMG/M
3300015345\|Ga0182111_1024141	Not Available	1165	Open in IMG/M
3300015345\|Ga0182111_1174873	Not Available	573	Open in IMG/M
3300015345\|Ga0182111_1197919	Not Available	546	Open in IMG/M
3300015346\|Ga0182139_1002853	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	2118	Open in IMG/M
3300015346\|Ga0182139_1080064	Not Available	770	Open in IMG/M
3300015346\|Ga0182139_1105508	Not Available	695	Open in IMG/M
3300015346\|Ga0182139_1130571	Not Available	642	Open in IMG/M
3300015346\|Ga0182139_1143556	Not Available	619	Open in IMG/M
3300015346\|Ga0182139_1187055	Not Available	559	Open in IMG/M
3300015346\|Ga0182139_1193115	Not Available	552	Open in IMG/M
3300015346\|Ga0182139_1233476	Not Available	512	Open in IMG/M
3300015347\|Ga0182177_1074408	Not Available	792	Open in IMG/M
3300015347\|Ga0182177_1155273	Not Available	604	Open in IMG/M
3300015347\|Ga0182177_1171167	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581	Open in IMG/M
3300015347\|Ga0182177_1203582	Not Available	544	Open in IMG/M
3300015347\|Ga0182177_1206822	Not Available	540	Open in IMG/M
3300015351\|Ga0182161_1033832	Not Available	1101	Open in IMG/M
3300015351\|Ga0182161_1048631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	969	Open in IMG/M
3300015351\|Ga0182161_1117855	Not Available	696	Open in IMG/M
3300015351\|Ga0182161_1132982	Not Available	664	Open in IMG/M
3300015351\|Ga0182161_1174318	Not Available	597	Open in IMG/M
3300015351\|Ga0182161_1186938	Not Available	581	Open in IMG/M
3300015351\|Ga0182161_1238679	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	526	Open in IMG/M
3300015351\|Ga0182161_1243232	Not Available	522	Open in IMG/M
3300015355\|Ga0182159_1010378	Not Available	1907	Open in IMG/M
3300015355\|Ga0182159_1015392	Not Available	1685	Open in IMG/M
3300015355\|Ga0182159_1037675	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1247	Open in IMG/M
3300015355\|Ga0182159_1067876	Not Available	1001	Open in IMG/M
3300015355\|Ga0182159_1086976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	908	Open in IMG/M
3300015355\|Ga0182159_1088433	Not Available	902	Open in IMG/M
3300015355\|Ga0182159_1113529	Not Available	815	Open in IMG/M
3300015355\|Ga0182159_1131641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	766	Open in IMG/M
3300015355\|Ga0182159_1160475	Not Available	706	Open in IMG/M
3300015355\|Ga0182159_1173013	Not Available	684	Open in IMG/M
3300015355\|Ga0182159_1187484	Not Available	661	Open in IMG/M
3300015355\|Ga0182159_1191388	Not Available	655	Open in IMG/M
3300015355\|Ga0182159_1202131	Not Available	640	Open in IMG/M
3300015355\|Ga0182159_1223782	Not Available	612	Open in IMG/M
3300015355\|Ga0182159_1265620	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	568	Open in IMG/M
3300015355\|Ga0182159_1293097	Not Available	544	Open in IMG/M
3300015355\|Ga0182159_1299249	Not Available	539	Open in IMG/M
3300015355\|Ga0182159_1342803	Not Available	508	Open in IMG/M
3300015361\|Ga0182145_1040765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	841	Open in IMG/M
3300015361\|Ga0182145_1140881	Not Available	561	Open in IMG/M
3300015361\|Ga0182145_1145330	Not Available	555	Open in IMG/M
3300015361\|Ga0182145_1158560	Not Available	538	Open in IMG/M
3300017404\|Ga0182203_1039887	Not Available	788	Open in IMG/M
3300017404\|Ga0182203_1081121	Not Available	632	Open in IMG/M
3300017404\|Ga0182203_1127379	Not Available	547	Open in IMG/M
3300017407\|Ga0182220_1037739	Not Available	674	Open in IMG/M
3300017407\|Ga0182220_1055447	Not Available	608	Open in IMG/M
3300017410\|Ga0182207_1052158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	752	Open in IMG/M
3300017410\|Ga0182207_1111116	Not Available	589	Open in IMG/M
3300017410\|Ga0182207_1112500	Not Available	587	Open in IMG/M
3300017410\|Ga0182207_1143011	Not Available	541	Open in IMG/M
3300017411\|Ga0182208_1078469	Not Available	589	Open in IMG/M
3300017413\|Ga0182222_1003472	Not Available	1212	Open in IMG/M
3300017413\|Ga0182222_1075352	Not Available	553	Open in IMG/M
3300017413\|Ga0182222_1087164	Not Available	532	Open in IMG/M
3300017415\|Ga0182202_1053806	Not Available	681	Open in IMG/M
3300017415\|Ga0182202_1068974	Not Available	631	Open in IMG/M
3300017420\|Ga0182228_1103862	Not Available	545	Open in IMG/M
3300017424\|Ga0182219_1038832	Not Available	749	Open in IMG/M
3300017424\|Ga0182219_1090713	Not Available	577	Open in IMG/M
3300017425\|Ga0182224_1023783	Not Available	914	Open in IMG/M
3300017425\|Ga0182224_1066758	Not Available	671	Open in IMG/M
3300017425\|Ga0182224_1069423	Not Available	664	Open in IMG/M
3300017425\|Ga0182224_1092454	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	607	Open in IMG/M
3300017425\|Ga0182224_1142929	Not Available	527	Open in IMG/M
3300017427\|Ga0182190_1010912	Not Available	1226	Open in IMG/M
3300017427\|Ga0182190_1084882	Not Available	632	Open in IMG/M
3300017427\|Ga0182190_1091579	Not Available	616	Open in IMG/M
3300017430\|Ga0182192_1064840	Not Available	707	Open in IMG/M
3300017430\|Ga0182192_1099103	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes	611	Open in IMG/M
3300017433\|Ga0182206_1052382	Not Available	715	Open in IMG/M
3300017433\|Ga0182206_1083326	Not Available	619	Open in IMG/M
3300017436\|Ga0182209_1032588	Not Available	850	Open in IMG/M
3300017436\|Ga0182209_1101592	Not Available	599	Open in IMG/M
3300017436\|Ga0182209_1175833	Not Available	500	Open in IMG/M
3300017438\|Ga0182191_1028376	Not Available	922	Open in IMG/M
3300017438\|Ga0182191_1047486	Not Available	786	Open in IMG/M
3300017438\|Ga0182191_1058681	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	734	Open in IMG/M
3300017438\|Ga0182191_1068479	Not Available	698	Open in IMG/M
3300017438\|Ga0182191_1104255	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	608	Open in IMG/M
3300017442\|Ga0182221_1040247	Not Available	782	Open in IMG/M
3300017442\|Ga0182221_1141067	Not Available	534	Open in IMG/M
3300017443\|Ga0182193_1113062	Not Available	610	Open in IMG/M
3300017443\|Ga0182193_1117274	Not Available	603	Open in IMG/M
3300017680\|Ga0182233_1104872	Not Available	525	Open in IMG/M
3300017682\|Ga0182229_1061616	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	639	Open in IMG/M
3300017682\|Ga0182229_1097628	Not Available	520	Open in IMG/M
3300017682\|Ga0182229_1099708	Not Available	515	Open in IMG/M
3300017683\|Ga0182218_1037478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	772	Open in IMG/M
3300017683\|Ga0182218_1070492	Not Available	640	Open in IMG/M
3300017683\|Ga0182218_1104305	Not Available	568	Open in IMG/M
3300017684\|Ga0182225_1041323	Not Available	741	Open in IMG/M
3300017684\|Ga0182225_1058571	Not Available	665	Open in IMG/M
3300017684\|Ga0182225_1098034	Not Available	568	Open in IMG/M
3300017686\|Ga0182205_1008735	Not Available	1297	Open in IMG/M
3300017686\|Ga0182205_1048405	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	764	Open in IMG/M
3300017686\|Ga0182205_1106390	Not Available	592	Open in IMG/M
3300017690\|Ga0182223_1020973	Not Available	815	Open in IMG/M
3300017690\|Ga0182223_1032106	Not Available	729	Open in IMG/M
3300017690\|Ga0182223_1065047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	603	Open in IMG/M
3300017690\|Ga0182223_1106151	Not Available	526	Open in IMG/M
3300025940\|Ga0207691_11636356	Not Available	523	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	97.65%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.35%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	97.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.18%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.18%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	97.65%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.18%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.18%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	97.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.18%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.59%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070673_1024075801	3300005364	Switchgrass Rhizosphere	MLKKINDIFRLKGIFDFSHLQFDGVSAQTDGSGMEGTKKLEQWR*
Ga0157374_113912081	3300013296	Miscanthus Rhizosphere	RCSKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLK*
Ga0157378_114458351	3300013297	Miscanthus Rhizosphere	MLKKINDIFKRKGIFDFSHLQFDGVRAQTDGSGMEDTKKLE*
Ga0182122_10440751	3300015267	Miscanthus Phyllosphere	MLKKINDVFRFKGIFDFLLLQFDTVRAQTDGSGMEGIKKLEQWR*
Ga0182113_10256332	3300015269	Miscanthus Phyllosphere	KSLRCSKKINNIFKLKGIFVFSHLQFDDVRAQTDGSGMEDTKKLE*
Ga0182113_10702371	3300015269	Miscanthus Phyllosphere	MLKKINDIFILKGIFVFSHLPFDGVRAQTDGSGMKGTKKLEQ*
Ga0182113_10884751	3300015269	Miscanthus Phyllosphere	NDIFRLKGIFDFSHLQFDGVKAQTDGSGIEGTKKLEQWR*
Ga0182188_10105771	3300015274	Miscanthus Phyllosphere	KINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLK*
Ga0182172_10179241	3300015275	Miscanthus Phyllosphere	MLKKINDIFIFKGIFDFLRLQFGGVRAQTDGSGMEGTKKLKQ*
Ga0182128_10797921	3300015277	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSHLQFDGVKAQTDDSDIEGTKKLKQYRP
Ga0182174_10603251	3300015279	Miscanthus Phyllosphere	KKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE*
Ga0182160_10375721	3300015281	Miscanthus Phyllosphere	NDIFKHNGIFDFLHLQFDTVGIQSDGSSMEGKKKK*
Ga0182124_10187912	3300015282	Miscanthus Phyllosphere	VKMLKKINDIFRLKGIFDFSHLQFDDVRAQTDGSGMKGTKKLEQ*
Ga0182156_10432582	3300015283	Miscanthus Phyllosphere	MLKKINDIFTLKGIFVFSHLQFDDVRAQTNGSGMEDMKKLEQ*
Ga0182156_10453231	3300015283	Miscanthus Phyllosphere	VFSFEVVKMLKKNNNIFELKGIFVFSHLRFDGVKTCTDESGMEDLKKLE*
Ga0182156_10700822	3300015283	Miscanthus Phyllosphere	EFFSFEVVKMLKKINNIFRLKDIFDFSHLQFDGVRAQTDGSDMKDKKKLEQ*
Ga0182156_10709511	3300015283	Miscanthus Phyllosphere	LKKINDIFRLKGIFVFSHLQFDGVRAQTDSSGMEGTKKLEQWP*
Ga0182176_10422651	3300015286	Miscanthus Phyllosphere	SLTCSKKLTTFKLRDIFDFSHLQFDGVRAQTDGSGMEDTKKLEQWR*
Ga0182176_10524811	3300015286	Miscanthus Phyllosphere	MLKKINDIFTLKDIFVFSHLQFDGVRAQTDRSVMEGIKKLEQ*
Ga0182176_10655061	3300015286	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSRVQFDDVRAQTDGSGID
Ga0182171_10021791	3300015287	Miscanthus Phyllosphere	MNDIFRHMGIFDFSHLQFDGVKVQTDDSGMEGTKKLEQWR*
Ga0182171_10869171	3300015287	Miscanthus Phyllosphere	KKINNIFELKGIFVFSHLQFDGVNVQTDGSGIEDTKKLK*
Ga0182173_10102822	3300015288	Miscanthus Phyllosphere	MLKKINDIFKLKGIFDFLRLQFDGVRAQTDDSGMEGTKKLEQWR*
Ga0182173_10575502	3300015288	Miscanthus Phyllosphere	NNIFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLK*
Ga0182173_10658401	3300015288	Miscanthus Phyllosphere	VFSFEVVKMFKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMKDTKKLE*
Ga0182138_10301171	3300015289	Miscanthus Phyllosphere	MLKKINDIFILKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE*
Ga0182125_10035131	3300015291	Miscanthus Phyllosphere	KKINNIFRLKGIFVFSHLQFDGVRAQTNGSGMDNTKK*
Ga0182125_10490171	3300015291	Miscanthus Phyllosphere	MLKKINDIFRLKGIFVFSHLQFDGVRAQTDESGMEDTKKLK*
Ga0182125_10838891	3300015291	Miscanthus Phyllosphere	VVKMLKKINDIFRHKGIFDFLHLQYDIVRTQSEGSGMEGKNKLKQWR*
Ga0182141_10203761	3300015292	Miscanthus Phyllosphere	KKINDIFRLKGIFDFSHLKFDVVRAQTDGSGMEGTKKFEQWR*
Ga0182141_10874081	3300015292	Miscanthus Phyllosphere	KKINNIFELKGILVFSHLQFDGVRVQTGGSGMEDTKKLK*
Ga0182126_10308432	3300015294	Miscanthus Phyllosphere	VFSIEVVKMLKKINDIFKHKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQ*
Ga0182126_10640311	3300015294	Miscanthus Phyllosphere	IFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE*
Ga0182157_10508311	3300015296	Miscanthus Phyllosphere	NIFELEGIFVFSHLQFDGVRAQTDDSGMEDTKKLVQ*
Ga0182106_10338111	3300015298	Miscanthus Phyllosphere	LKKINDIFRLKGIFIFSHLQFDGVRAQTDGSGVEGTKKLEQWR*
Ga0182107_10422481	3300015299	Miscanthus Phyllosphere	IFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLE*
Ga0182107_10786811	3300015299	Miscanthus Phyllosphere	VVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE*
Ga0182108_10738752	3300015300	Miscanthus Phyllosphere	MLKNDIFRLKGIFDFSHMQFDGVKAQTDGIGIEGTKKLEQ*
Ga0182108_10820862	3300015300	Miscanthus Phyllosphere	MLKKINNIFELKGIFVFSHLQFDGFKAQTDGSGMDDTKKLE*
Ga0182123_10737213	3300015303	Miscanthus Phyllosphere	FEVVKMLKKINNIFRLKGIFVFSHLQFDSVRAQTDRSGMKDTKKLE*
Ga0182112_10166031	3300015304	Miscanthus Phyllosphere	GIFRLKGIFDFSHLQFDGVRAQTDSSGMDGTKKLEQWH*
Ga0182144_10881111	3300015307	Miscanthus Phyllosphere	EVVKMLKKINNIFRLKGIFVFSHLQFDSVRAQIDESGMEDMKKLE*
Ga0182142_10771481	3300015308	Miscanthus Phyllosphere	MLKKINDIFRLKGIFIFSHLQFDGVRAQTDGSGMEGTKKLEQWR*
Ga0182142_10889781	3300015308	Miscanthus Phyllosphere	NIFELKGIFVFSHLQFDGVRGTDGSGMEDPKKLE
Ga0182140_10585241	3300015314	Miscanthus Phyllosphere	NIFRLKGIFVFSHLQFDGVRGQTDGSGMKDTKKLE*
Ga0182127_10445661	3300015321	Miscanthus Phyllosphere	MLKKINDIFKLKGIFDFSHLQFDGVRAQTDGSGIEGTKKLEQ*
Ga0182127_10465941	3300015321	Miscanthus Phyllosphere	FEVVKMLKKINNIFRHKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQ*
Ga0182110_10527871	3300015322	Miscanthus Phyllosphere	IFRLKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQWH*
Ga0182110_10706601	3300015322	Miscanthus Phyllosphere	EVVKILKKINGIFLKGIFDFSHLQFDTVRAQSDDSGMEGKKKLKQ
Ga0182110_10745711	3300015322	Miscanthus Phyllosphere	MLKKINNIFELKGIFVFSHLQFDGVRVQTDGSGMEDTKKLE*
Ga0182129_10002971	3300015323	Miscanthus Phyllosphere	MLKKINGIFRLRGIFDFSHLQFDGVRAQTDGSGIEGIKKSDQWR*
Ga0182129_10457001	3300015323	Miscanthus Phyllosphere	IFRLKGNFDFSHLQFDTVRVQFYGSGIEDKKKKLKQWR*
Ga0182129_10926312	3300015323	Miscanthus Phyllosphere	VFSFEVVKMLQNINDIFRLKDIFVFSHLQFDDVRAQTDGSGMEGKKKLEQ*
Ga0182129_11016261	3300015323	Miscanthus Phyllosphere	KMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDMKKLEHTEDCDLL*
Ga0182187_10586671	3300015341	Miscanthus Phyllosphere	EFFHLKSLRYLKKINNIFELKGIFVFSHLQFDGVRATDGSGMEDPKKLE
Ga0182109_10858981	3300015342	Miscanthus Phyllosphere	NIFKLKGIFVFSHLQFDGVRAQTDGSGMDDTKKLK*
Ga0182109_12062961	3300015342	Miscanthus Phyllosphere	IFRLKGIFVFSHLQFDGVRAQIDGSGMEGIKKLEQWR*
Ga0182155_10050621	3300015343	Miscanthus Phyllosphere	FKVVKILKKINDISRHKGIFDFSHLQFDGVEAQTDGNGIEGTKKLEPWR*
Ga0182155_11035401	3300015343	Miscanthus Phyllosphere	KINDIFRLKGIFDFSQLQFDVVRAQTDDNGMEGTQKLEQWR*
Ga0182155_11333631	3300015343	Miscanthus Phyllosphere	MLKKIKDIFRLKGIFDFSHLQFDGVRVKTDGSDIKSTKKLEQW*
Ga0182189_11406062	3300015344	Miscanthus Phyllosphere	FFHLKLLRCSKKINNIFRLKGIFVFSHLQFDSVRAQIDESGMEDMKKLE*
Ga0182111_10241413	3300015345	Miscanthus Phyllosphere	SKKINNIFELKGIFVFLHLQFDGVRATDGSGIEDPKKLE
Ga0182111_11748731	3300015345	Miscanthus Phyllosphere	MLKKINNIFRLKGIFVFSHLQFDGIRAQTDGSGMEDMKKLE*
Ga0182111_11979191	3300015345	Miscanthus Phyllosphere	SKKINNIFRLNGIFVFSHLQFDGVRGQTDGSGMEATKKLE*
Ga0182111_12457791	3300015345	Miscanthus Phyllosphere	FFHLKSLRCSKKINNIFKLKGIFVFSHLQFDGVKVQIDGSGMEDTKKLE*
Ga0182139_10028531	3300015346	Miscanthus Phyllosphere	MLKKKINDIFKLKGIFDFLHLQFNGVRAQTDGSGMEGTKKLKQ*
Ga0182139_10800641	3300015346	Miscanthus Phyllosphere	LKSLRYLKNNDIFRLKDIFDFSHLQFDGVRAQTDESGMESVKKLEQ
Ga0182139_11055081	3300015346	Miscanthus Phyllosphere	MLKKINGIFKPKGIFYFSHLQFDNVRAQSNGSDMEGKKN*
Ga0182139_11305712	3300015346	Miscanthus Phyllosphere	IFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE*
Ga0182139_11435561	3300015346	Miscanthus Phyllosphere	MLKKIDDIFRLKAIFDFSHLQFDTVRAQSDGSGIEGKKKLEQR
Ga0182139_11870552	3300015346	Miscanthus Phyllosphere	DIFRLKGIFDFSHLQFDGVRAQTDDSGMEGIKKLEQWR*
Ga0182139_11931151	3300015346	Miscanthus Phyllosphere	VKILKKINDIFKFKGIFVFSHLQFDGVRAQTDGSGMEGIKKLEQWR*
Ga0182139_12334761	3300015346	Miscanthus Phyllosphere	MLKKINDIFTLKGIFDFSQLQFDGVRAQTDGSGMEDTKKLEQWH*
Ga0182177_10744081	3300015347	Miscanthus Phyllosphere	NNIFEFKGIFVFSHLQFNGVRAQTDGSGIDDTKKLK*
Ga0182177_11552731	3300015347	Miscanthus Phyllosphere	MLKKINNIFRLMGIFVFSHLQFNGVRAQTDGSGMEDTKKLE*
Ga0182177_11711672	3300015347	Miscanthus Phyllosphere	MLKKINDIFKPKGIFDFSHPQFDTVIVQSDSSGMEGKKKLEQ*
Ga0182177_12035821	3300015347	Miscanthus Phyllosphere	VFSFEVVKMLKKINDIFRLKGIFDFSHLQFDDVRAQTDGSGMEGTKKLEQWR*
Ga0182177_12068221	3300015347	Miscanthus Phyllosphere	SKKLMTFKLRDIFDFSHLQFDGVRAQTDGSGMEDTKKLEQWR*
Ga0182161_10338321	3300015351	Miscanthus Phyllosphere	MLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE*
Ga0182161_10486311	3300015351	Miscanthus Phyllosphere	KINDIFRHKGIFDFSHLQFDGVRVQTNGSGIEGTKKLE*
Ga0182161_11178551	3300015351	Miscanthus Phyllosphere	MLKKINDIFTFKGIFDFSHMQFNGVRAQTDGSGMEGTKKLEQWR*
Ga0182161_11329821	3300015351	Miscanthus Phyllosphere	LKGIFDFSHLQFDGVIAQTDGSGMEGIKKLEQWR*
Ga0182161_11743181	3300015351	Miscanthus Phyllosphere	NNIFRLKGIFVFSHLQFDGVSVQTDRSGMEDTKKLK*
Ga0182161_11869381	3300015351	Miscanthus Phyllosphere	VFVFEVVKMLKKINNIFRLKSIFVFSHLQFDGVRAQTNGSGIEGTKKL*
Ga0182161_12386791	3300015351	Miscanthus Phyllosphere	EFFSFEVVKMLKKINDIFRFKGIFVFSHLQFDGVRAQTDGSGMEDAKTLEQ*
Ga0182161_12432321	3300015351	Miscanthus Phyllosphere	CSKKINNIFKLKGIFVFSHLQFNGVRAQTDGSGMDDTKKLEQWR*
Ga0182159_10103781	3300015355	Miscanthus Phyllosphere	KKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDMKKLE*
Ga0182159_10153921	3300015355	Miscanthus Phyllosphere	MNDIFRLKGIFDFSHLQLDGVRAQTDGSGMEGTKKLEQWR*
Ga0182159_10376752	3300015355	Miscanthus Phyllosphere	MLKKIINIFELKGIFVFLHLQFDGVRVTDGSGMEDPKKLE
Ga0182159_10678761	3300015355	Miscanthus Phyllosphere	MLKKINGIFRLKGIFDFSHLQFDGVRAQTNGSGMEGTKKLKQ*
Ga0182159_10869761	3300015355	Miscanthus Phyllosphere	VVKMLKKINITFRLKSIFVFSHLQFDGVRAQTDGSDMDDTKKLK*
Ga0182159_10884332	3300015355	Miscanthus Phyllosphere	MLKKINNIFELKGIFVISHLQFDGVRVQTDGSGMNDTKKLE*
Ga0182159_11135291	3300015355	Miscanthus Phyllosphere	KMLKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE*
Ga0182159_11316412	3300015355	Miscanthus Phyllosphere	MLKKINDIFTLKGIFVFSNLQFDGVRVQTDGSAMESMKKLEQWR*
Ga0182159_11604752	3300015355	Miscanthus Phyllosphere	EVVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDMKKLE*
Ga0182159_11730131	3300015355	Miscanthus Phyllosphere	VFLFEVVKMLKKINDIFRLKGIFDFSHLQFDGVGGQTDGSSM*
Ga0182159_11874841	3300015355	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSHLHFDGVRAQTDDSGMEGTKKLEQ*
Ga0182159_11913881	3300015355	Miscanthus Phyllosphere	MLKKINNIFRVKDIFDFSYLQFDGVRVQTDGNGMEGTKKLKQWR*
Ga0182159_12021311	3300015355	Miscanthus Phyllosphere	NIFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLE*
Ga0182159_12237821	3300015355	Miscanthus Phyllosphere	KINDIFRLKGIFDFSHLQFDDVRGQTDGSGMEGMKKLKQWR*
Ga0182159_12656201	3300015355	Miscanthus Phyllosphere	KKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLK*
Ga0182159_12926441	3300015355	Miscanthus Phyllosphere	IFRLKGIFVFSHLQFDSVKVQTDGSGMEDMKKLE*
Ga0182159_12930971	3300015355	Miscanthus Phyllosphere	INNIFELNGIFVFSPLQFNGVRAKTDRSGIDDTKKLK*
Ga0182159_12992491	3300015355	Miscanthus Phyllosphere	KINNIFRLKGIFVFLHLQFDGVRAQTDGSGMGDTKKLE*
Ga0182159_13428031	3300015355	Miscanthus Phyllosphere	IFRNKGIFNFSHLQFDGVRAQTDGSGMEGTKKLEQWR*
Ga0182145_10407652	3300015361	Miscanthus Phyllosphere	VFSFKVVKMLKKINDIFRLNCIFDFSHLQFDTVRVQSDGSGMEGKKKS*
Ga0182145_11408811	3300015361	Miscanthus Phyllosphere	EVVKMLKKINDIFRLKGIFDFSHLQFDGVRAQTDGSGMEGTKKLKQWR*
Ga0182145_11453301	3300015361	Miscanthus Phyllosphere	KKINDIFRLKGIFDFLHLQFDIVRTQSEGSGMEGKNKLKQWR*
Ga0182145_11585602	3300015361	Miscanthus Phyllosphere	MLKKINDIFTHKGIFDFSHLQFDGVRVQTDRSGMEGTKKLEQ*
Ga0182203_10398871	3300017404	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSHLQFDRVRGQTDGSGMDDTKKLEQ
Ga0182203_10811211	3300017404	Miscanthus Phyllosphere	NNIFRLNGIFVFSHLQFDGVRGQTDGSGMEATKKLE
Ga0182203_11273792	3300017404	Miscanthus Phyllosphere	MLKKINDIFRHKGIFDFSHLKFDGVRAQTNGSGMEGTKKLKQ
Ga0182220_10377391	3300017407	Miscanthus Phyllosphere	KINNIFELKGIFVFSHLQFNCVRAQTDGSGMDDTKKLE
Ga0182220_10554471	3300017407	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSQLQFDGVRAQTDGSGMEDTKKLEQWH
Ga0182207_10521582	3300017410	Miscanthus Phyllosphere	VLSFSFEVVKMLKKINNIFRLKGIFIFLYLQFDGVRAQTDESGMEDTKKLE
Ga0182207_11111161	3300017410	Miscanthus Phyllosphere	MNDIFRLKGIFDFSHLQLDGVRAQTDGSGMEGTKKLEQWR
Ga0182207_11125001	3300017410	Miscanthus Phyllosphere	MLKKINDIFKLKGIFDFSHMQFDGVRVQTDGSGMESTKKLEQWR
Ga0182207_11430111	3300017410	Miscanthus Phyllosphere	MLKKINDIFTLNGIFDFSHLQFGGVRAQTDGSGMEGTKKLKQ
Ga0182208_10784691	3300017411	Miscanthus Phyllosphere	MLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE
Ga0182222_10034724	3300017413	Miscanthus Phyllosphere	SKKINNIFELKGIFVFSHLQFDGVRAQADGSGMNDTKKLE
Ga0182222_10753521	3300017413	Miscanthus Phyllosphere	INNIFRLKVIFYFSHLQFDGVRAQTDGSGMEGTKKLEQWR
Ga0182222_10871641	3300017413	Miscanthus Phyllosphere	LKKINNIFEFKGIFVFSHLQFNGVRAXTDGSGMEDPKKLE
Ga0182202_10538061	3300017415	Miscanthus Phyllosphere	NIFELKGIFVFSHLRFDGVKAXTDGSGMEDPKKLE
Ga0182202_10689741	3300017415	Miscanthus Phyllosphere	INNIFELKGSFVFSHLQFDGVRAQTDGSGMEDTKKLE
Ga0182228_11038621	3300017420	Miscanthus Phyllosphere	NDIFRHKGIFDFSHLQFDGVRAQTDGSGMEGTKKLEQWH
Ga0182219_10388321	3300017424	Miscanthus Phyllosphere	MLKKINNIFELKGIFVFSHLQFDGIRAQTDGSGMDDTKKLE
Ga0182219_10907131	3300017424	Miscanthus Phyllosphere	INNIFEFKGIFVFSHLRFDDVKAXTDGSGMKDPKKLK
Ga0182224_10237831	3300017425	Miscanthus Phyllosphere	VFSFKVVKMLKKINDIFRLKRIFNFSHLQFDGVRAQTDGSGMEGTKKLEQ
Ga0182224_10667581	3300017425	Miscanthus Phyllosphere	MLKKINDIFKHKGIFDFSHLLFDGVKVQTNGSGIESKKKLEQ
Ga0182224_10694231	3300017425	Miscanthus Phyllosphere	VFSFEVVKMFKKINNIFRLKGIFVFSHLQFDAVRAQTDGSGIEDTKKLE
Ga0182224_10924542	3300017425	Miscanthus Phyllosphere	KKINDIFTHKGIFDFSHLQFDGVRVQTDRSGMEGTKKLEQ
Ga0182224_11429291	3300017425	Miscanthus Phyllosphere	MLKKINNIFELKGIFVFSHLQFDGVRAQTDGSGIEDTKKLEQ
Ga0182190_10109121	3300017427	Miscanthus Phyllosphere	MLKKINGIFRLRGIFDFSHLQFDGVRAQTDDGGMEGTKKLEQWR
Ga0182190_10848822	3300017427	Miscanthus Phyllosphere	NDIFRLKGIFDFLHLQFDGVRAQTNGSGMDGKKKLEQ
Ga0182190_10915791	3300017427	Miscanthus Phyllosphere	KKINDTFTLKGIFDFSHLQFDGVRAKTDGSGMDDTKKLKQ
Ga0182192_10648401	3300017430	Miscanthus Phyllosphere	KSLRCSKKINNIFELKGIFVFSLLQFNGVRAQTDGSGMNDTKKLE
Ga0182192_10991031	3300017430	Miscanthus Phyllosphere	VFSFEVVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEATKKLE
Ga0182206_10523821	3300017433	Miscanthus Phyllosphere	MLKKINDIFRYKGIFDFSHLEFDGVRAQTDGSGMEGTKKLEQWR
Ga0182206_10833262	3300017433	Miscanthus Phyllosphere	MLKKINNIFRLKGIFDFSHLQFDGVRAKTDGSGMEGTKKLKQ
Ga0182209_10325881	3300017436	Miscanthus Phyllosphere	EFFHLKSLRCSKKINKIFELKGIFVFSHLQFDGVRASGMEDPKKLE
Ga0182209_11015921	3300017436	Miscanthus Phyllosphere	EVVKTLKKINDIFRHKGIFGFSHLQFDGVRAQTDGSGMEDTKKLVRWR
Ga0182209_11758332	3300017436	Miscanthus Phyllosphere	LKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE
Ga0182191_10075042	3300017438	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSHLQFDTVRVQSDASGIEGKKNLAQWRXSPPNFFSDS
Ga0182191_10283762	3300017438	Miscanthus Phyllosphere	MLKKINDIFRLKGIFDFSHLQFDGVRAQTDGIGMEGTKKLEQ
Ga0182191_10474861	3300017438	Miscanthus Phyllosphere	MLKKINDIFRLKSIFDFLPLQFDGVRAQTDDSGMEDTKKLEQWR
Ga0182191_10586812	3300017438	Miscanthus Phyllosphere	MKMLKKINDIFTLKGIFDFSHLQFDGVRAQTDDIGMEGT
Ga0182191_10684791	3300017438	Miscanthus Phyllosphere	LKKINNIFELKGIFVFSHLQFDGVSVQTDGSGMENTKKLK
Ga0182191_11042552	3300017438	Miscanthus Phyllosphere	FEVVKMLKKINNIFELKGIFVFLHLQFDGVRAQIDGSGMEDTKKLE
Ga0182221_10402471	3300017442	Miscanthus Phyllosphere	RCSKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE
Ga0182221_11410671	3300017442	Miscanthus Phyllosphere	LKKINDIFRLKDIFDYSHLQFDGVRAQTDGSGIEGTKRLEQ
Ga0182193_11130621	3300017443	Miscanthus Phyllosphere	RCSKKINNIFELKGIFVFSHLQFDGVRAQTDGSGMDDTKKLK
Ga0182193_11172741	3300017443	Miscanthus Phyllosphere	MIKKINNIFELKGIFVFSHLQFDGVNVQTDGSGMEDTKKLK
Ga0182233_11048721	3300017680	Miscanthus Phyllosphere	MLKKINNIFRHNGIFDFSHLEFDGVRAQTDGSGIEGKKKVGAMTLL
Ga0182229_10616161	3300017682	Miscanthus Phyllosphere	NDIFRLKGIFVFLHMQFDGIRAQTDGSGMEGTKKLE
Ga0182229_10976281	3300017682	Miscanthus Phyllosphere	MLKKINDIFRHKGIFDFSHLQFDGVRVQTNGSGIEGTKKLE
Ga0182229_10997081	3300017682	Miscanthus Phyllosphere	LRCSKKINNIFKLKGIFVFSHLRFNGVRAQTDGSGMDDTKKLK
Ga0182218_10374782	3300017683	Miscanthus Phyllosphere	MLKKINDIFRLRGIFDFSHLQFDDVRAQTDGSGMEGKKKLEQ
Ga0182218_10704922	3300017683	Miscanthus Phyllosphere	VFSFEVVKMLKKINDIFRLKGIFVFLHLQFDAITAQTDGSGMEGTKKLKQWR
Ga0182218_11043051	3300017683	Miscanthus Phyllosphere	MLKKINDIFRPKGIFDFLHLQFDTVRAQSDSSGMEGKKKLE
Ga0182225_10413232	3300017684	Miscanthus Phyllosphere	FLFEVVKMLKKINNIFRLKGIFVFSHLQFDGVRAQTDGSGMEATKKLE
Ga0182225_10585711	3300017684	Miscanthus Phyllosphere	MLKKINDIFRLKDNLDFSHLQSDGVRAQTDGSGIEDIKKLEQ
Ga0182225_10980341	3300017684	Miscanthus Phyllosphere	PFEVVKTLKKINDIFRLKGIFDFSHLQFDTVRAQSDGSGMEGKKKLEQWR
Ga0182205_10087352	3300017686	Miscanthus Phyllosphere	MLKKINNIFELKGIFVFSHLQFNGVRAKTDGSGIDDTKKLE
Ga0182205_10484051	3300017686	Miscanthus Phyllosphere	KSLRCSKKINDIFTFKGIFVFSPLQFNGFRGQTDGSGMESTKK
Ga0182205_11063901	3300017686	Miscanthus Phyllosphere	KKINDIFRFKYIFDFSHLQFDTVRAQTDGNGMEDIKKLKQWR
Ga0182223_10209731	3300017690	Miscanthus Phyllosphere	MLKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDDTKKLE
Ga0182223_10321061	3300017690	Miscanthus Phyllosphere	FFLFKVVKMLKKINNIFRLKGIFVFSHLRFDSVRAQTDGSAMDDTKKLE
Ga0182223_10650472	3300017690	Miscanthus Phyllosphere	KSLKCSKKINNIFRLKSIFDFSHLQFDGVRVQTDGSGMEGTKKLKQWR
Ga0182223_11061511	3300017690	Miscanthus Phyllosphere	NIFILKGIFVFSHLQFDGVRAQTDGSGMEDTKKLE
Ga0207691_116363561	3300025940	Miscanthus Rhizosphere	MLKKINNIFELKGIFVFSHLQFNGVRAQTDGSGMDD

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.25
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.25
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F036039

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign