Metagenome Family F036065

Basic Information
Family ID	F036065
Family Type	Metagenome
Number of Sequences	170
Average Sequence Length	42 residues
Representative Sequence	MKVDDNPFPRDQNMVDARLFKGKTKVLTSTKSKEAGTVDPKM
Number of Associated Samples	72
Number of Associated Scaffolds	170

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	3.57 %
% of genes near scaffold ends (potentially truncated)	61.18 %
% of genes from short scaffolds (< 2000 bps)	98.24 %
Associated GOLD sequencing projects	71
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.26

Most Common Taxonomy
Group	Unclassified (59.412 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.706 % of family members)
Environment Ontology (ENVO)	Unclassified (95.294 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.294 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 170 Family Scaffolds
PF03732	Retrotrans_gag	1.18

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
All Organisms	root	All Organisms	40.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
cellular organisms	root	All Organisms → cellular organisms	40.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	38.82 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	38.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	38.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	38.82 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	38.82 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	38.24 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	38.24 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	38.24 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	38.24 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	38.24 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	33.53 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	33.53 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	33.53 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	33.53 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	33.53 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	14.12 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	12.35 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	14.12 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	12.35 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	14.12 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	12.35 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	14.12 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	12.35 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	12.94 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	12.35 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	12.94 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	11.18 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	4.71 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.41 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	11.18 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	4.71 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.94 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	1.76 %
Oryza brachyantha	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	0.59 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005328\|Ga0070676_10735420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	723	Open in IMG/M
3300005459\|Ga0068867_101694837	Not Available	593	Open in IMG/M
3300009098\|Ga0105245_12210980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	604	Open in IMG/M
3300009176\|Ga0105242_10868968	Not Available	899	Open in IMG/M
3300013297\|Ga0157378_12226280	Not Available	599	Open in IMG/M
3300015267\|Ga0182122_1021581	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	701	Open in IMG/M
3300015267\|Ga0182122_1047576	Not Available	567	Open in IMG/M
3300015267\|Ga0182122_1070806	Not Available	505	Open in IMG/M
3300015268\|Ga0182154_1047163	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	572	Open in IMG/M
3300015268\|Ga0182154_1074349	Not Available	501	Open in IMG/M
3300015269\|Ga0182113_1010270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	960	Open in IMG/M
3300015269\|Ga0182113_1034799	Not Available	685	Open in IMG/M
3300015274\|Ga0182188_1019397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	681	Open in IMG/M
3300015274\|Ga0182188_1021890	Not Available	660	Open in IMG/M
3300015274\|Ga0182188_1039956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	567	Open in IMG/M
3300015274\|Ga0182188_1049371	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	536	Open in IMG/M
3300015275\|Ga0182172_1020340	Not Available	729	Open in IMG/M
3300015275\|Ga0182172_1060815	Not Available	540	Open in IMG/M
3300015276\|Ga0182170_1016858	Not Available	770	Open in IMG/M
3300015276\|Ga0182170_1032312	Not Available	647	Open in IMG/M
3300015276\|Ga0182170_1037458	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	621	Open in IMG/M
3300015276\|Ga0182170_1047283	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	582	Open in IMG/M
3300015276\|Ga0182170_1057663	Not Available	550	Open in IMG/M
3300015276\|Ga0182170_1065100	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	530	Open in IMG/M
3300015277\|Ga0182128_1028714	Not Available	672	Open in IMG/M
3300015277\|Ga0182128_1045852	Not Available	591	Open in IMG/M
3300015279\|Ga0182174_1009416	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	932	Open in IMG/M
3300015279\|Ga0182174_1011908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	874	Open in IMG/M
3300015279\|Ga0182174_1043854	Not Available	614	Open in IMG/M
3300015279\|Ga0182174_1081451	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	511	Open in IMG/M
3300015281\|Ga0182160_1029063	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	680	Open in IMG/M
3300015281\|Ga0182160_1034290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	650	Open in IMG/M
3300015281\|Ga0182160_1048487	Not Available	591	Open in IMG/M
3300015281\|Ga0182160_1070304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	530	Open in IMG/M
3300015282\|Ga0182124_1033179	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	652	Open in IMG/M
3300015283\|Ga0182156_1033968	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	664	Open in IMG/M
3300015286\|Ga0182176_1085268	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	502	Open in IMG/M
3300015287\|Ga0182171_1041277	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	629	Open in IMG/M
3300015287\|Ga0182171_1049087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	600	Open in IMG/M
3300015287\|Ga0182171_1064257	Not Available	554	Open in IMG/M
3300015289\|Ga0182138_1028812	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	696	Open in IMG/M
3300015289\|Ga0182138_1042376	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	626	Open in IMG/M
3300015289\|Ga0182138_1043508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	621	Open in IMG/M
3300015289\|Ga0182138_1050264	Not Available	596	Open in IMG/M
3300015289\|Ga0182138_1055655	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	579	Open in IMG/M
3300015289\|Ga0182138_1066788	Not Available	549	Open in IMG/M
3300015291\|Ga0182125_1032802	Not Available	685	Open in IMG/M
3300015292\|Ga0182141_1031747	Not Available	691	Open in IMG/M
3300015292\|Ga0182141_1057976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	582	Open in IMG/M
3300015292\|Ga0182141_1085949	Not Available	517	Open in IMG/M
3300015294\|Ga0182126_1063340	Not Available	570	Open in IMG/M
3300015294\|Ga0182126_1077825	Not Available	536	Open in IMG/M
3300015295\|Ga0182175_1037899	Not Available	668	Open in IMG/M
3300015295\|Ga0182175_1048422	Not Available	623	Open in IMG/M
3300015296\|Ga0182157_1030692	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	719	Open in IMG/M
3300015296\|Ga0182157_1062663	Not Available	587	Open in IMG/M
3300015296\|Ga0182157_1087710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	529	Open in IMG/M
3300015296\|Ga0182157_1092937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza brachyantha	519	Open in IMG/M
3300015298\|Ga0182106_1035358	Not Available	692	Open in IMG/M
3300015298\|Ga0182106_1062148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	588	Open in IMG/M
3300015298\|Ga0182106_1080915	Not Available	542	Open in IMG/M
3300015298\|Ga0182106_1081911	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	540	Open in IMG/M
3300015299\|Ga0182107_1023117	Not Available	784	Open in IMG/M
3300015300\|Ga0182108_1054636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	618	Open in IMG/M
3300015300\|Ga0182108_1085994	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	538	Open in IMG/M
3300015304\|Ga0182112_1060348	Not Available	597	Open in IMG/M
3300015305\|Ga0182158_1030207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	725	Open in IMG/M
3300015305\|Ga0182158_1036190	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	688	Open in IMG/M
3300015305\|Ga0182158_1084325	Not Available	537	Open in IMG/M
3300015305\|Ga0182158_1084549	Not Available	537	Open in IMG/M
3300015305\|Ga0182158_1086737	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	533	Open in IMG/M
3300015307\|Ga0182144_1015702	Not Available	885	Open in IMG/M
3300015307\|Ga0182144_1055415	Not Available	618	Open in IMG/M
3300015307\|Ga0182144_1103993	Not Available	509	Open in IMG/M
3300015308\|Ga0182142_1070354	Not Available	586	Open in IMG/M
3300015308\|Ga0182142_1108519	Not Available	512	Open in IMG/M
3300015314\|Ga0182140_1088296	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	548	Open in IMG/M
3300015321\|Ga0182127_1034205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	748	Open in IMG/M
3300015321\|Ga0182127_1083351	Not Available	573	Open in IMG/M
3300015322\|Ga0182110_1073564	Not Available	594	Open in IMG/M
3300015322\|Ga0182110_1083664	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	571	Open in IMG/M
3300015323\|Ga0182129_1038970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	697	Open in IMG/M
3300015323\|Ga0182129_1073144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	579	Open in IMG/M
3300015341\|Ga0182187_1001077	Not Available	2484	Open in IMG/M
3300015341\|Ga0182187_1040521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	876	Open in IMG/M
3300015341\|Ga0182187_1068693	Not Available	735	Open in IMG/M
3300015341\|Ga0182187_1074143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	716	Open in IMG/M
3300015341\|Ga0182187_1191470	Not Available	511	Open in IMG/M
3300015342\|Ga0182109_1100758	Not Available	678	Open in IMG/M
3300015342\|Ga0182109_1133646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	612	Open in IMG/M
3300015343\|Ga0182155_1072201	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	757	Open in IMG/M
3300015343\|Ga0182155_1156714	Not Available	576	Open in IMG/M
3300015343\|Ga0182155_1167318	Not Available	562	Open in IMG/M
3300015343\|Ga0182155_1174755	Not Available	553	Open in IMG/M
3300015343\|Ga0182155_1196503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	529	Open in IMG/M
3300015343\|Ga0182155_1200857	Not Available	524	Open in IMG/M
3300015343\|Ga0182155_1203681	Not Available	522	Open in IMG/M
3300015343\|Ga0182155_1220915	Not Available	506	Open in IMG/M
3300015344\|Ga0182189_1159090	Not Available	578	Open in IMG/M
3300015344\|Ga0182189_1191587	Not Available	539	Open in IMG/M
3300015344\|Ga0182189_1216690	Not Available	513	Open in IMG/M
3300015345\|Ga0182111_1118110	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	666	Open in IMG/M
3300015345\|Ga0182111_1155707	Not Available	600	Open in IMG/M
3300015345\|Ga0182111_1226418	Not Available	518	Open in IMG/M
3300015345\|Ga0182111_1235725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	510	Open in IMG/M
3300015346\|Ga0182139_1050704	Not Available	906	Open in IMG/M
3300015346\|Ga0182139_1208227	Not Available	536	Open in IMG/M
3300015346\|Ga0182139_1243313	Not Available	503	Open in IMG/M
3300015347\|Ga0182177_1136631	Not Available	633	Open in IMG/M
3300015347\|Ga0182177_1138966	Not Available	629	Open in IMG/M
3300015347\|Ga0182177_1186492	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	563	Open in IMG/M
3300015351\|Ga0182161_1127784	Not Available	674	Open in IMG/M
3300015351\|Ga0182161_1269422	Not Available	500	Open in IMG/M
3300015355\|Ga0182159_1302135	Not Available	537	Open in IMG/M
3300015355\|Ga0182159_1330904	Not Available	516	Open in IMG/M
3300015355\|Ga0182159_1347271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	505	Open in IMG/M
3300015355\|Ga0182159_1352620	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	501	Open in IMG/M
3300015361\|Ga0182145_1124666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	584	Open in IMG/M
3300015361\|Ga0182145_1185891	Not Available	510	Open in IMG/M
3300017404\|Ga0182203_1062878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	686	Open in IMG/M
3300017407\|Ga0182220_1044356	Not Available	646	Open in IMG/M
3300017407\|Ga0182220_1083310	Not Available	543	Open in IMG/M
3300017409\|Ga0182204_1075281	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	580	Open in IMG/M
3300017409\|Ga0182204_1079294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	572	Open in IMG/M
3300017410\|Ga0182207_1066762	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	696	Open in IMG/M
3300017410\|Ga0182207_1121939	Not Available	571	Open in IMG/M
3300017410\|Ga0182207_1129895	Not Available	559	Open in IMG/M
3300017410\|Ga0182207_1171703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	507	Open in IMG/M
3300017411\|Ga0182208_1013707	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	983	Open in IMG/M
3300017411\|Ga0182208_1027068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	807	Open in IMG/M
3300017411\|Ga0182208_1061362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	635	Open in IMG/M
3300017413\|Ga0182222_1030429	Not Available	698	Open in IMG/M
3300017413\|Ga0182222_1054133	Not Available	603	Open in IMG/M
3300017417\|Ga0182230_1089245	Not Available	563	Open in IMG/M
3300017420\|Ga0182228_1025978	Not Available	928	Open in IMG/M
3300017425\|Ga0182224_1055304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	712	Open in IMG/M
3300017425\|Ga0182224_1093608	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	605	Open in IMG/M
3300017425\|Ga0182224_1134325	Not Available	539	Open in IMG/M
3300017427\|Ga0182190_1034574	Not Available	851	Open in IMG/M
3300017427\|Ga0182190_1083890	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	634	Open in IMG/M
3300017427\|Ga0182190_1117645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	565	Open in IMG/M
3300017430\|Ga0182192_1053828	Not Available	752	Open in IMG/M
3300017430\|Ga0182192_1127566	Not Available	560	Open in IMG/M
3300017430\|Ga0182192_1147167	Not Available	532	Open in IMG/M
3300017430\|Ga0182192_1155143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	522	Open in IMG/M
3300017433\|Ga0182206_1138638	Not Available	526	Open in IMG/M
3300017436\|Ga0182209_1136847	Not Available	544	Open in IMG/M
3300017438\|Ga0182191_1083218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	655	Open in IMG/M
3300017438\|Ga0182191_1095841	Not Available	625	Open in IMG/M
3300017442\|Ga0182221_1159187	Not Available	513	Open in IMG/M
3300017443\|Ga0182193_1154486	Not Available	548	Open in IMG/M
3300017443\|Ga0182193_1175716	Not Available	523	Open in IMG/M
3300017443\|Ga0182193_1177345	Not Available	521	Open in IMG/M
3300017680\|Ga0182233_1090418	Not Available	561	Open in IMG/M
3300017680\|Ga0182233_1111833	Not Available	510	Open in IMG/M
3300017681\|Ga0182226_1046306	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	784	Open in IMG/M
3300017682\|Ga0182229_1026815	Not Available	1022	Open in IMG/M
3300017682\|Ga0182229_1094327	Not Available	528	Open in IMG/M
3300017683\|Ga0182218_1090753	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	592	Open in IMG/M
3300017684\|Ga0182225_1029097	Not Available	826	Open in IMG/M
3300017684\|Ga0182225_1109099	Not Available	549	Open in IMG/M
3300017685\|Ga0182227_1071616	Not Available	641	Open in IMG/M
3300017686\|Ga0182205_1099426	Not Available	605	Open in IMG/M
3300017690\|Ga0182223_1070870	Not Available	588	Open in IMG/M
3300021060\|Ga0182232_1076886	Not Available	543	Open in IMG/M
3300025908\|Ga0207643_10565828	Not Available	730	Open in IMG/M
3300026089\|Ga0207648_10787283	Not Available	885	Open in IMG/M
3300026089\|Ga0207648_11082980	Not Available	751	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.29%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.35%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.35%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.29%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.76%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.59%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.76%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.59%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.59%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.59%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070676_107354202	3300005328	Miscanthus Rhizosphere	MKVDDNPFPGDQNMVDVGLFKGKTKVLTSTKLREARTVDPKMQISANEYR*
Ga0068867_1016948371	3300005459	Miscanthus Rhizosphere	MPQKMKIDDNPFLEDQNMVDAGLFKGKTKVLTSTKSKEARTVD
Ga0105245_122109801	3300009098	Miscanthus Rhizosphere	MKIDDDPFPGDQNMVVARLLRGKTKVLTLTKSREAGTVDSERQISADE
Ga0105242_108689681	3300009176	Miscanthus Rhizosphere	MKVDDNPFPGDQNMVDARLLKGKTKVLTSTKSREARTVDPKMQYRPTSTG
Ga0157378_122262803	3300013297	Miscanthus Rhizosphere	MKVDNNPFPKDQNMVEAKLFKGKTKVLTSAKARETG
Ga0182122_10215811	3300015267	Miscanthus Phyllosphere	MKVDDNPFLGDQNMVDAGLLKGKTKVLTSTKSKEAG
Ga0182122_10475762	3300015267	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGLFKGKTKVLTSAKSREA*
Ga0182122_10708061	3300015267	Miscanthus Phyllosphere	NPFPRDQNMIDARLLKRKTKVLISTKAKETGTVDPKMQISADK*
Ga0182154_10471631	3300015268	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGIFKGKTKVLTSTRSREAETVDPKI*
Ga0182154_10743492	3300015268	Miscanthus Phyllosphere	MKVDDNPFRRDQNMIDARLLKGKAKVLTSIRSRETGTVDPEIQISAD
Ga0182113_10102702	3300015269	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSTKSREARTSDP*
Ga0182113_10347992	3300015269	Miscanthus Phyllosphere	MKIDDNPFPSDQNMVDARLLKEKTRVLTSTKSKKTGTVDPEM*
Ga0182188_10193971	3300015274	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLSSTRSRETRTVDPEMQISAD
Ga0182188_10218902	3300015274	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVWIFKGKTKVLTLAKSRKARTVDPKMQNIIR*
Ga0182188_10399561	3300015274	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVNAKLLKGKTKVLTSTRARETGTVDPEIQISAD*
Ga0182188_10493711	3300015274	Miscanthus Phyllosphere	MPQKMKVDDNPFPGDQNIVDPGLIKGKTKILTSTKIKESRTVDPKMQI
Ga0182172_10203402	3300015275	Miscanthus Phyllosphere	MKIDDNPFPGEQNMVDTRLFKRKTKVLTSTELKEDGT
Ga0182172_10608152	3300015275	Miscanthus Phyllosphere	MKVDDNPFLKDQNMVDAKLFKGKAKVLTLARARETGTVD
Ga0182170_10168582	3300015276	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVNAKLLKGKTKVLTSTRAKETGTVDL*
Ga0182170_10323121	3300015276	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVRLIKGKTKVLTLTKSREARTVDPKM*
Ga0182170_10374581	3300015276	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLSSTRSKETGTVDPKM*
Ga0182170_10472831	3300015276	Miscanthus Phyllosphere	MKVDGNPIPKDQNMVDAKLLKGKTKVLTLTRAKETRTVD
Ga0182170_10576632	3300015276	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDARLLKGKTKVLTSTRSRETRT
Ga0182170_10651002	3300015276	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKEKTKVLTSTRSRETRTVDPEMQISAD*
Ga0182128_10287141	3300015277	Miscanthus Phyllosphere	MKVDDNPFLGDQNMVDARLFKGKTKVLTSTKSKEARTVDPKM*
Ga0182128_10458521	3300015277	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDARLLNGKTKVLTSTRAKEARTIDPKM*
Ga0182174_10094161	3300015279	Miscanthus Phyllosphere	MKVNDNPFPGDQNMVDAGLFKGKTKVLTLTKSREARTFDPK
Ga0182174_10119082	3300015279	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGIFKGKTKVLTSAKSRKDGIVDPKMQNIG*
Ga0182174_10438543	3300015279	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLFKGKTKVLTSTKSKEAGTVDPKM*
Ga0182174_10814512	3300015279	Miscanthus Phyllosphere	MKADDNPFPGDQNMVDARLLKGKTKVLTSTKSREAGTVDPKMQI
Ga0182160_10290632	3300015281	Miscanthus Phyllosphere	MKVCDNPFPRDQNMVDARLLKEKTKVLTSTIARET*
Ga0182160_10342901	3300015281	Miscanthus Phyllosphere	PFPRDQNMVDAKLLKWKTKVLTSTRLRETETIDPEM*
Ga0182160_10484872	3300015281	Miscanthus Phyllosphere	MKVDDNPFLKDQNMVDAKLLKGKTKVLTSTRAKETR
Ga0182160_10703042	3300015281	Miscanthus Phyllosphere	MKVDDNPFSRNHNMVDAKLLKGRTKVLTSTRAKET
Ga0182124_10331792	3300015282	Miscanthus Phyllosphere	MKVDDDPFLVDQNMVDARLLKGKTKILTSTRAKEARTINPKVQISA
Ga0182156_10339681	3300015283	Miscanthus Phyllosphere	MKVDDNPFPRDQNIVDAKLLKGKTNVLTSTRARETRTVN
Ga0182176_10852681	3300015286	Miscanthus Phyllosphere	MKVDDNPFSGDQNMVDAGLLKGKTKVLRSAKSREAGTV
Ga0182171_10412771	3300015287	Miscanthus Phyllosphere	MKVDDNPFLGDQNIVNARLLKGKTKVLTSTKSRKTRTVDLEM*
Ga0182171_10490872	3300015287	Miscanthus Phyllosphere	MKVDDDPFPRDQNMVDAMLLKGKTKVLTSTRSRETRIVDLVM*
Ga0182171_10642571	3300015287	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSTRSKETRTVDPK
Ga0182138_10288122	3300015289	Miscanthus Phyllosphere	MKVDDNPFPKNQNMVDAKLFKGKTKVLTLARAIETGTVDPKM*
Ga0182138_10423762	3300015289	Miscanthus Phyllosphere	MPRKVKVDDNPFPGDQNMVDVRLIKGKTKVLTLTKSREARTVDPKM*
Ga0182138_10435082	3300015289	Miscanthus Phyllosphere	MKVDNNPFPRDQNMVDVKLLKGKTKVLTLARAKETGIVDPKMQISAD
Ga0182138_10502641	3300015289	Miscanthus Phyllosphere	TPRKMKVDDNPFPGDQNMVDVGIFKGKTKVLTLAKSRKDGTVNPRM*
Ga0182138_10556552	3300015289	Miscanthus Phyllosphere	MKVDDNSFLGDQNMVDARLVKEKTKVLTSAKSREAGTVDPKKQ
Ga0182138_10667881	3300015289	Miscanthus Phyllosphere	PQKMKVDDNPFPGDQNIVDDGLFKGKTKVLTSTKSKEARTVDPKM*
Ga0182125_10328021	3300015291	Miscanthus Phyllosphere	MKVYDNPFPRDQNMVDAKLFKGKTKVLTSTRAKEARTIDPKM*
Ga0182141_10317472	3300015292	Miscanthus Phyllosphere	MIVDDNLFLGDQNMVDARLIKGKTKILTSTKSREAGTVNSEMQI
Ga0182141_10579761	3300015292	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDAKLLKGKTKILTSTRAKETRTIDPE
Ga0182141_10859491	3300015292	Miscanthus Phyllosphere	MKVDDNPFLKDQNMIDAKLFKGKTNVLTSARARETRTVDPEM*
Ga0182126_10633403	3300015294	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDVKLLKGKTKVLTSTRAKEIGTIDPNMQISADEY
Ga0182126_10778252	3300015294	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDAKLFKGKSKVLTSTRAKETRTVDPE
Ga0182175_10378991	3300015295	Miscanthus Phyllosphere	NPFSKDQNMVDAKLLKRKTKVLTSTRAKETGTVDP*
Ga0182175_10484222	3300015295	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSCKSREAGTVDPEM*
Ga0182157_10306921	3300015296	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDARLIKGKTKVLTSTKSREARIVDPKM*
Ga0182157_10626631	3300015296	Miscanthus Phyllosphere	MKVDDNPFPGDLNMVDAGLFKGKTKVLTPTKSKEAGTVDPKM*
Ga0182157_10877102	3300015296	Miscanthus Phyllosphere	MKVDDNPFPGDLNMVDAGLFKGKTKVLTSTKSKEAGTVDPKMQIS
Ga0182157_10929373	3300015296	Miscanthus Phyllosphere	MKVDDNPFSRDQNMVDAGLFKGKTKVLTSTKSKEARTVDPKMQISANEQMS*
Ga0182106_10353582	3300015298	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDARLLKGKTKILTSTRAKEARTINPKVQISADEI*
Ga0182106_10621482	3300015298	Miscanthus Phyllosphere	MKVDDNPFPRDQNIVDAKLLKGKIKVLISTRAKETGTIDPKMQIS
Ga0182106_10809151	3300015298	Miscanthus Phyllosphere	MKADDNPFLRDQNMVDAKLLKGKTKVLTSIRAKETRTVDPNMQISA
Ga0182106_10819111	3300015298	Miscanthus Phyllosphere	MKVDDNPFLGGQNMVDARLFKGKTKVLTSTKSKEART
Ga0182107_10231172	3300015299	Miscanthus Phyllosphere	VKVDDNPFPIYQNMVDARLLKGKTKALTSTRSKETRMVDPE
Ga0182108_10546362	3300015300	Miscanthus Phyllosphere	MQVDDNPFPRYQNMVDANKGKTKVLTSTRTKEAGTIDPKMQI*
Ga0182108_10859941	3300015300	Miscanthus Phyllosphere	VDDNLFPGDQNMVDARLLKGKTKVLTSTKSREARIVDPKM*
Ga0182112_10603482	3300015304	Miscanthus Phyllosphere	MKVDDNPFPIDQNMVDARLLKRNNKVLISTRSKEIATVDPV
Ga0182158_10302073	3300015305	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSTRSRETTT
Ga0182158_10361903	3300015305	Miscanthus Phyllosphere	MKVDDNPFPKDQDMVDAKLHKGKTKVLTSTRAKETGTVDLEM*
Ga0182158_10843251	3300015305	Miscanthus Phyllosphere	MKVDDNPFPRDLNMVDVRLVKGKTKVLTSTRAKEARTIDPKMQIST
Ga0182158_10845491	3300015305	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGLFKGKTKVLTSTKSREAGTVDPKM*
Ga0182158_10867371	3300015305	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDAKLLKGKTKILTSARAKETRIVDSEIQISAN
Ga0182144_10157025	3300015307	Miscanthus Phyllosphere	MKVDDNPFPNDQNMVDAKLFKGKVKVLTSARERETRTVDPEMQISANEYRE
Ga0182144_10554151	3300015307	Miscanthus Phyllosphere	MPWKIKVDDNPFPGDQNMVYARLLKGKTKVLTSTKSKEARTVDANIG*
Ga0182144_11039932	3300015307	Miscanthus Phyllosphere	MKADDNPFLRDQNMVDAKLLKGKTKVLTSIRAKETR
Ga0182142_10703541	3300015308	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGLFKGKTKVLTSAKSKEARTVDPKM*
Ga0182142_11085192	3300015308	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDARLFKEKTKVLISTKSREPVTVDPKI*
Ga0182140_10882961	3300015314	Miscanthus Phyllosphere	MKVDDNPFVGDQNMVDAGLLKGKTKVLTSTKSREARIIDPKM*
Ga0182127_10342052	3300015321	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGIFKGKTKVLTLAKSRKHGIVDPKMQISTD*
Ga0182127_10833512	3300015321	Miscanthus Phyllosphere	KVDDNPFPIDQNMVDARLLKRNNKVLISTRSKEIATVDPVYWELEDF*
Ga0182110_10735641	3300015322	Miscanthus Phyllosphere	MKIDDNPFLGDQNMVDVGLFKGKTKVLTSTKSREAGTVDP
Ga0182110_10836641	3300015322	Miscanthus Phyllosphere	MKIDDNPFPGDQNMVDVGLFKGKTKVLTLTKLREAGTF
Ga0182129_10389701	3300015323	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDAGLFKGKTKVLTSTKSKEA
Ga0182129_10731441	3300015323	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDAKLFKGKAEVLTSDRARETRTVDPEM*
Ga0182187_10010774	3300015341	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDARLLKGKTKVLTSVRSRETRT
Ga0182187_10405214	3300015341	Miscanthus Phyllosphere	MKVDDNPFPRDQNIVDARLLKGKTKVLTSTRSRETKTVDPEMQIL
Ga0182187_10686931	3300015341	Miscanthus Phyllosphere	MKIDDNPFPGDQNMVDAVMFKGKTKVLTSTKSKEAGTVDPKMQISAD
Ga0182187_10741433	3300015341	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDAKLLKGKTKVLTSARQKKSE*
Ga0182187_11914702	3300015341	Miscanthus Phyllosphere	MKVDDNPFPEDQNMVDAGIFKGKTKVLTSTKSKDAGKVDPKI
Ga0182109_11007581	3300015342	Miscanthus Phyllosphere	MKVDDNPFPNDQNMVDAKLFKGKAKVLTLDRARETRTVDPEM*
Ga0182109_11336461	3300015342	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDAKLLKGKTKVLTSTRAKETRTVD
Ga0182155_10722011	3300015343	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDARLLKGKTKVLTSTKSRETGILDPKM*
Ga0182155_11567143	3300015343	Miscanthus Phyllosphere	DNPFPRDQNMIDAKLLKAKAKVLTSTRAKETRTVDPEM*
Ga0182155_11673182	3300015343	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDARLLKGKTKVLTSTKSREART
Ga0182155_11747552	3300015343	Miscanthus Phyllosphere	MKVDDNPFLKDQNMVDAKLFKGKAKVLTSARARET
Ga0182155_11965031	3300015343	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDAKLLKGKTNVLTSTRARETRTVNPE
Ga0182155_12008571	3300015343	Miscanthus Phyllosphere	TKVDDNPYPRDQNMVDAKLLKGKTKVLTSTRARETRTVDP*
Ga0182155_12036811	3300015343	Miscanthus Phyllosphere	GRLKFDTPRKMKVDDNPFPGDQNMVDIRLIKGKTKVLTSTKSK*
Ga0182155_12209152	3300015343	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDARLLKGKTKVLTSVRSKETR
Ga0182189_11590901	3300015344	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKLLTSTRSRETRI
Ga0182189_11915871	3300015344	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDVKLLKGKTKVLTSTRAKETRTIDLEMQISADE
Ga0182189_12166902	3300015344	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGLFKGKTKVLTSTKSKEAGTVDPKM*
Ga0182111_11181101	3300015345	Miscanthus Phyllosphere	MKVDDNPFLKDQNMVDAKLFKGKTKVLTSTRERETRTVDPEM
Ga0182111_11557072	3300015345	Miscanthus Phyllosphere	MKVDDNPFLGDQNMVDAGLLKGRTKVLTSAKSREARTVDP*
Ga0182111_12264181	3300015345	Miscanthus Phyllosphere	MKVDDNPFPKDQDMVDAKLFKGKPKVLTSARARETRTVDPEMQILAD
Ga0182111_12357251	3300015345	Miscanthus Phyllosphere	KMKVDDNPFPRDQNMVDARLLNGKTKVLTSTRAKEARTIDPKM*
Ga0182139_10507041	3300015346	Miscanthus Phyllosphere	MKVDDNPSPRDQNMVDARFLKGKTKVLTSTRAKEARTIDPKMQ
Ga0182139_12082272	3300015346	Miscanthus Phyllosphere	MKVDDNPFPGDLNMVDAGLFKGKTKVLTPTKSKEAGTVDPKMQISADEY
Ga0182139_12433131	3300015346	Miscanthus Phyllosphere	MKVNDNPFPEDLNMVNAKLFKGKTKVLTSTKSKEARTVDPKM*
Ga0182177_11366312	3300015347	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDVGLFKGKTKVLTSAKSRKDGTVDPKM
Ga0182177_11389661	3300015347	Miscanthus Phyllosphere	MKVDNNPFPGDQNMVDARLFKGNTKVLTSTKSKEA
Ga0182177_11864922	3300015347	Miscanthus Phyllosphere	MKTDDNPFPGDQNMVDVGLFKGKTKVLTLTKLREAGTVDPKMQISADEYR*
Ga0182161_11277841	3300015351	Miscanthus Phyllosphere	MKVDDNPFPRDQNMIDAKLLKGKTKVLTSTKAKETRTVDPEMQIS
Ga0182161_12694221	3300015351	Miscanthus Phyllosphere	FDTPQKMKVDDNPFLGDQNMVDVRLFKGKTKVLTSTK*
Ga0182159_12892293	3300015355	Miscanthus Phyllosphere	LKFDTPRKIKVDDNPFPRDQNMVDVKLLKGKTKVLTSTRAKETRTVDPDM*
Ga0182159_13021351	3300015355	Miscanthus Phyllosphere	MKIDDNPFPRDQNMVDVKLLKGKTKVLTSTRAKETRTVDPKM*
Ga0182159_13309041	3300015355	Miscanthus Phyllosphere	DNPFPGDQNMVDARLLKGKTMVLTSTRSRETEIIDPEM*
Ga0182159_13472711	3300015355	Miscanthus Phyllosphere	VDDNPFPKDQNMVDAKLFKGKTKVLTSVRARETGTVDPEM*
Ga0182159_13526202	3300015355	Miscanthus Phyllosphere	MKVDDNHFLGDQNMVDARLLKRKTKVLTSTKSREAGTVDP
Ga0182145_11246662	3300015361	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDAKLLKGKTKVLTSTRAKETRTV
Ga0182145_11858913	3300015361	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSTKSREART
Ga0182203_10628782	3300017404	Miscanthus Phyllosphere	MKINDNPFPKNQNMVDAKLFQGKAKVLTSARARETRTVDPKI
Ga0182220_10443562	3300017407	Miscanthus Phyllosphere	MKVDDNPFLGDQNMVDARLPKGKTKVLTSTKSREARTVDLEMQISA
Ga0182220_10833102	3300017407	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVNAKLLKGKTKVLTSTRAKETGTVDL
Ga0182204_10752812	3300017409	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDAKLFKRKTEVLTSTRASETGTVDPKM
Ga0182204_10792942	3300017409	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDVKLLIGKTKVLTSTRVKETGTVDPKM
Ga0182207_10667621	3300017410	Miscanthus Phyllosphere	MKVDDNPFPRDHNMVDARLLKGKTKVLTSTRSKETGTVNPEMQISADEF
Ga0182207_11219392	3300017410	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDAKLFKGKTKVLTSARVRETRTVDPEMQISANE
Ga0182207_11298951	3300017410	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDAKLLKGKTKVLTSTRAKETRTVDPE
Ga0182207_11717033	3300017410	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDARLLKGKTNVLTSNKSREPGTVDPKMQISADE
Ga0182208_10137073	3300017411	Miscanthus Phyllosphere	DNPFPKDQNMVDAKLFKGKTEVLISGRSKETGTVDPEM
Ga0182208_10270684	3300017411	Miscanthus Phyllosphere	MKVNDNPFPKDQNMVDAKLLKGKTKVLTSTRAKETGLVDLEIQ
Ga0182208_10613622	3300017411	Miscanthus Phyllosphere	MKVDDNLFPRDQNMVNAKLLKGKTKVLTSTRAKETR
Ga0182222_10304291	3300017413	Miscanthus Phyllosphere	PRKMKVDDNPFLGDQNMVDAGLFKEITKILTSTKSREAGTVDPKM
Ga0182222_10541332	3300017413	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGLFRGKTKVLTSAKLREARTVDLKMQISPDE
Ga0182230_10892452	3300017417	Miscanthus Phyllosphere	MKVDDNPFLGDQNMVDARLFKGKTKVLTSTKSKEAGTINPKMQISADKY
Ga0182228_10259781	3300017420	Miscanthus Phyllosphere	MPRKMKVDNNHFPGDQNMVDAGLFKGKTKVLTSTKSKEARTVDPKMQISA
Ga0182224_10553041	3300017425	Miscanthus Phyllosphere	KMKVDDNPFPKNQNMVDAKLFKGKTKVLTLARAIETGTVDPKM
Ga0182224_10936083	3300017425	Miscanthus Phyllosphere	MKVDVNPFPGDQNTVDAGLLKGKIKVLTSTKSKEAETVDP
Ga0182224_11343252	3300017425	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSIRSKETGTVDPEI
Ga0182190_10345741	3300017427	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVGLFKGKTKVLTSAKSREAGTVDPKMQIS
Ga0182190_10838903	3300017427	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDAKLFKGKAKVLTSSRARETGIVDPKM
Ga0182190_11176451	3300017427	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDVGLFKRKPKVLTSTKSRKDGTVNPKI
Ga0182192_10538283	3300017430	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSTRSRETGTVNPKMQ
Ga0182192_11275663	3300017430	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDARLFKGKTKVLTSTRAKEARTIPEHANNS
Ga0182192_11471671	3300017430	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDDKLFNGKTKVLTSTRARKTRTVDPKM
Ga0182192_11551431	3300017430	Miscanthus Phyllosphere	KMKVDDNPFQGDQNMVDARFLKGKTKVLTLTKSREAGTVDPKM
Ga0182206_11386381	3300017433	Miscanthus Phyllosphere	MKVDDNPFLGDQTMVDAGIFKGNTKVLTSTRSKEARTIDPKIQISADE
Ga0182209_11368471	3300017436	Miscanthus Phyllosphere	IKVDDNPFPKDQNMVDAKLFKGKAKVLTSARARETRTVDPEMQISADE
Ga0182191_10832182	3300017438	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVNVGLFKGKTKVLTSAKSREAGT
Ga0182191_10958412	3300017438	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDARLLKGKTKVPTSTKSREAGIVDPKMQISADEYR
Ga0182221_11259481	3300017442	Miscanthus Phyllosphere	MPQKMKVDDNPFLGDQNMVDAGLFKGKTKVLTSTK
Ga0182221_11591872	3300017442	Miscanthus Phyllosphere	MKVDDNPFLGDLNMVDVGLFKGKTKVLTPTKSKEARTVNPKMQISADEY
Ga0182193_11544862	3300017443	Miscanthus Phyllosphere	MKVDDNPFPRDQNMIDARLLKEKTKVLTSTRAKEARTIDPKMQ
Ga0182193_11757161	3300017443	Miscanthus Phyllosphere	MKVDDNPFPRDQNMIDAKLLKGKTKVLMSTGAKETGTVDPEMQISADEY
Ga0182193_11773451	3300017443	Miscanthus Phyllosphere	GRLKFDTPRKMKVDDNPFPRDHNMVDARLLKGKTKVLTSTRSRETRIVDPEM
Ga0182233_10904183	3300017680	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDAGLFKGKTKVLTSTKSRKAR
Ga0182233_11118331	3300017680	Miscanthus Phyllosphere	KMKVDDNPFLGDQNMVDAGLFKGKTKVLTSTKSKEAGTVDPEM
Ga0182226_10463062	3300017681	Miscanthus Phyllosphere	MPQKMKVDDNPFPRDQNMVDAGLFKGKTKVLTSTKSKKAGIVDPKMQISADE
Ga0182229_10268151	3300017682	Miscanthus Phyllosphere	MKVDDNPFLRDQNMVDAKLLKGKTKVLTSTRAKETRIVDPEM
Ga0182229_10943271	3300017682	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDVKLLKGKTKVLTSTRTKEAGTIDPKMQI
Ga0182218_10907532	3300017683	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTLTRSREIGIVDPEI
Ga0182225_10290971	3300017684	Miscanthus Phyllosphere	MKVDDNPFPKDQNMVDAKLFKGKAKVLASASARETKTVEPEMQISAE
Ga0182225_11090991	3300017684	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDVWIFKGKTKVLTLAKSRKARTVDPKM
Ga0182227_10716161	3300017685	Miscanthus Phyllosphere	MKVDANPFLGDQNMVDARLFKGKTKVLSSTKSKEAGIVDPKM
Ga0182205_10994262	3300017686	Miscanthus Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSIRSKETGTIVPEM
Ga0182223_10708703	3300017690	Miscanthus Phyllosphere	MKVDDNPFPGDQNMVDAGLFKGKAKVLTSTKSKEAGTVD
Ga0182232_10768861	3300021060	Phyllosphere	MKVDDNPFPRDQNMVDARLLKGKTKVLTSTRAKEAGTIDPKM
Ga0207643_105658281	3300025908	Miscanthus Rhizosphere	MKVDDNPFPKDQNMVDAKLFKGKAKVLTSASARETGTVDPEM
Ga0207648_107872833	3300026089	Miscanthus Rhizosphere	MKVDDNPFPRDQNMVDARPFKGKTKVLTSTKSKEAGTVDPKM
Ga0207648_110829802	3300026089	Miscanthus Rhizosphere	MKVDDNPFLGDQNMVDARLLKGKTKVLTSTKSREAGTVDPKKQISADE

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.26
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.26
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F036065

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign