NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036254

Metagenome / Metatranscriptome Family F036254

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036254
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 106 residues
Representative Sequence MALDQNEKKLIEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Number of Associated Samples 118
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 15.88 %
% of genes near scaffold ends (potentially truncated) 35.88 %
% of genes from short scaffolds (< 2000 bps) 84.12 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(37.059 % of family members)
Environment Ontology (ENVO) Unclassified
(52.353 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.97%    β-sheet: 1.52%    Coil/Unstructured: 51.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF00011HSP20 21.18
PF04120Iron_permease 4.12
PF12680SnoaL_2 4.12
PF07731Cu-oxidase_2 4.12
PF00582Usp 2.94
PF13620CarboxypepD_reg 1.76
PF13091PLDc_2 1.18
PF00149Metallophos 1.18
PF08445FR47 1.18
PF13860FlgD_ig 1.18
PF00144Beta-lactamase 1.18
PF01408GFO_IDH_MocA 1.18
PF14534DUF4440 1.18
PF07883Cupin_2 1.18
PF08818DUF1801 0.59
PF05726Pirin_C 0.59
PF13715CarbopepD_reg_2 0.59
PF03909BSD 0.59
PF02690Na_Pi_cotrans 0.59
PF01872RibD_C 0.59
PF08241Methyltransf_11 0.59
PF00291PALP 0.59
PF10502Peptidase_S26 0.59
PF07732Cu-oxidase_3 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 21.18
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 4.71
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.18
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.18
COG2367Beta-lactamase class ADefense mechanisms [V] 1.18
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.59
COG1283Na+/phosphate symporterInorganic ion transport and metabolism [P] 0.59
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.59
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.59
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.59
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.59
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.59

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_6918633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium847Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101846178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2864Open in IMG/M
3300000559|F14TC_101183050All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1127Open in IMG/M
3300000789|JGI1027J11758_13001135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1141Open in IMG/M
3300004114|Ga0062593_100164195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1709Open in IMG/M
3300004463|Ga0063356_101050023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1168Open in IMG/M
3300004463|Ga0063356_104848043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium578Open in IMG/M
3300004480|Ga0062592_100422037All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300004643|Ga0062591_100092901All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300005175|Ga0066673_10355506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes855Open in IMG/M
3300005290|Ga0065712_10031825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1234Open in IMG/M
3300005293|Ga0065715_10858674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300005294|Ga0065705_10199838All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300005294|Ga0065705_10538070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium704Open in IMG/M
3300005294|Ga0065705_10986253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300005295|Ga0065707_10219357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300005337|Ga0070682_100109067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1842Open in IMG/M
3300005353|Ga0070669_101279417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium635Open in IMG/M
3300005354|Ga0070675_101857718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium556Open in IMG/M
3300005355|Ga0070671_100966807All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium745Open in IMG/M
3300005356|Ga0070674_100949415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium752Open in IMG/M
3300005438|Ga0070701_10658575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300005441|Ga0070700_100008073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5723Open in IMG/M
3300005578|Ga0068854_101241166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium669Open in IMG/M
3300005844|Ga0068862_102078926All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium579Open in IMG/M
3300005844|Ga0068862_102657574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300006031|Ga0066651_10300043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes858Open in IMG/M
3300006046|Ga0066652_100000883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes14879Open in IMG/M
3300006046|Ga0066652_100478852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1151Open in IMG/M
3300006358|Ga0068871_100548788All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1046Open in IMG/M
3300006844|Ga0075428_100015489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella8453Open in IMG/M
3300006844|Ga0075428_100122766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2827Open in IMG/M
3300006844|Ga0075428_100558390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1224Open in IMG/M
3300006845|Ga0075421_100007168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes13635Open in IMG/M
3300006846|Ga0075430_100004947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11210Open in IMG/M
3300006876|Ga0079217_10102971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1288Open in IMG/M
3300006894|Ga0079215_10199442All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1011Open in IMG/M
3300006969|Ga0075419_10001380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae15665Open in IMG/M
3300006969|Ga0075419_10010943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5613Open in IMG/M
3300006969|Ga0075419_11048361All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300009094|Ga0111539_10118556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3102Open in IMG/M
3300009094|Ga0111539_10297210All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1879Open in IMG/M
3300009094|Ga0111539_11603525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300009100|Ga0075418_10019389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae7508Open in IMG/M
3300009100|Ga0075418_11259858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium801Open in IMG/M
3300009147|Ga0114129_10832291All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1175Open in IMG/M
3300009147|Ga0114129_11585152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium802Open in IMG/M
3300009156|Ga0111538_10016921All Organisms → cellular organisms → Bacteria9572Open in IMG/M
3300009156|Ga0111538_11452197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium865Open in IMG/M
3300009156|Ga0111538_12027069All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium723Open in IMG/M
3300009176|Ga0105242_11092404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300009610|Ga0105340_1078803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1305Open in IMG/M
3300010036|Ga0126305_10022924All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3317Open in IMG/M
3300010037|Ga0126304_10967639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium580Open in IMG/M
3300010399|Ga0134127_11974143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium661Open in IMG/M
3300010399|Ga0134127_12968328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium553Open in IMG/M
3300011400|Ga0137312_1047346All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium702Open in IMG/M
3300012469|Ga0150984_114422631All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1038Open in IMG/M
3300012883|Ga0157281_1007341All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1139Open in IMG/M
3300012884|Ga0157300_1039977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium703Open in IMG/M
3300012885|Ga0157287_1002262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1672Open in IMG/M
3300012885|Ga0157287_1006649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → Rufibacter radiotolerans1219Open in IMG/M
3300012891|Ga0157305_10042174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium942Open in IMG/M
3300012891|Ga0157305_10120719All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium671Open in IMG/M
3300012892|Ga0157294_10026574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1177Open in IMG/M
3300012892|Ga0157294_10029488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → Rufibacter radiotolerans1135Open in IMG/M
3300012892|Ga0157294_10122559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium693Open in IMG/M
3300012893|Ga0157284_10013794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1471Open in IMG/M
3300012893|Ga0157284_10194611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M
3300012893|Ga0157284_10198592All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300012895|Ga0157309_10058963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes972Open in IMG/M
3300012895|Ga0157309_10070406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium911Open in IMG/M
3300012897|Ga0157285_10241458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300012898|Ga0157293_10008898All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1564Open in IMG/M
3300012898|Ga0157293_10086851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium779Open in IMG/M
3300012898|Ga0157293_10298571All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300012899|Ga0157299_10008641All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1670Open in IMG/M
3300012899|Ga0157299_10202771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium599Open in IMG/M
3300012900|Ga0157292_10035933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1272Open in IMG/M
3300012900|Ga0157292_10104568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium849Open in IMG/M
3300012902|Ga0157291_10013649All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1494Open in IMG/M
3300012902|Ga0157291_10017923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1371Open in IMG/M
3300012903|Ga0157289_10054572All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1024Open in IMG/M
3300012904|Ga0157282_10032493All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1171Open in IMG/M
3300012905|Ga0157296_10219112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300012906|Ga0157295_10035562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1106Open in IMG/M
3300012907|Ga0157283_10028105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1132Open in IMG/M
3300012909|Ga0157290_10003295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2615Open in IMG/M
3300012909|Ga0157290_10116653All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300012909|Ga0157290_10130955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium780Open in IMG/M
3300012910|Ga0157308_10060901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1013Open in IMG/M
3300012910|Ga0157308_10190755All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium685Open in IMG/M
3300012911|Ga0157301_10020660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1450Open in IMG/M
3300012912|Ga0157306_10262899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300012913|Ga0157298_10009617All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1573Open in IMG/M
3300012915|Ga0157302_10303524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium621Open in IMG/M
3300012939|Ga0162650_100061319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium630Open in IMG/M
3300012957|Ga0164303_11342179All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300012988|Ga0164306_11232305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium629Open in IMG/M
3300013096|Ga0157307_1013429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1290Open in IMG/M
3300013308|Ga0157375_12485478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium618Open in IMG/M
3300014326|Ga0157380_11519612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium723Open in IMG/M
3300014326|Ga0157380_12351176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300015200|Ga0173480_10118189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1312Open in IMG/M
3300015200|Ga0173480_10240627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium981Open in IMG/M
3300015201|Ga0173478_10001581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4749Open in IMG/M
3300015201|Ga0173478_10027232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1693Open in IMG/M
3300015201|Ga0173478_10031036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1617Open in IMG/M
3300015201|Ga0173478_10033387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1576Open in IMG/M
3300015371|Ga0132258_13490357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1077Open in IMG/M
3300018031|Ga0184634_10375528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300018067|Ga0184611_1003022All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4019Open in IMG/M
3300018067|Ga0184611_1016461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2218Open in IMG/M
3300018067|Ga0184611_1061663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1265Open in IMG/M
3300018073|Ga0184624_10006820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3792Open in IMG/M
3300018074|Ga0184640_10227355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium845Open in IMG/M
3300018074|Ga0184640_10473602All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium554Open in IMG/M
3300018083|Ga0184628_10223863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium986Open in IMG/M
3300018469|Ga0190270_10445932All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1215Open in IMG/M
3300018476|Ga0190274_10068546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2666Open in IMG/M
3300018476|Ga0190274_10115012All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae2181Open in IMG/M
3300018481|Ga0190271_10151857All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300019356|Ga0173481_10118012All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1048Open in IMG/M
3300019356|Ga0173481_10230002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium822Open in IMG/M
3300019361|Ga0173482_10083046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1125Open in IMG/M
3300019361|Ga0173482_10625792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium545Open in IMG/M
3300019362|Ga0173479_10013503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2174Open in IMG/M
3300019362|Ga0173479_10141272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium950Open in IMG/M
3300019362|Ga0173479_10341443All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300019884|Ga0193741_1010764All Organisms → cellular organisms → Bacteria2389Open in IMG/M
3300019884|Ga0193741_1012664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2192Open in IMG/M
3300019884|Ga0193741_1165766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300020009|Ga0193740_1028140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes890Open in IMG/M
3300020020|Ga0193738_1000895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes13026Open in IMG/M
3300022737|Ga0247747_1026437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300022756|Ga0222622_10693029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium740Open in IMG/M
3300022886|Ga0247746_1011235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1850Open in IMG/M
3300022886|Ga0247746_1178595All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300022886|Ga0247746_1206483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium517Open in IMG/M
3300022899|Ga0247795_1014430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1261Open in IMG/M
3300022915|Ga0247790_10102950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium705Open in IMG/M
3300022915|Ga0247790_10141784All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300022917|Ga0247777_1199424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300023066|Ga0247793_1003567All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2115Open in IMG/M
3300023071|Ga0247752_1051915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium644Open in IMG/M
3300023168|Ga0247748_1053781All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300023261|Ga0247796_1029936All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium884Open in IMG/M
3300023261|Ga0247796_1037148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium813Open in IMG/M
3300024055|Ga0247794_10004113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3067Open in IMG/M
3300024055|Ga0247794_10285524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300025908|Ga0207643_10281594All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1031Open in IMG/M
3300025925|Ga0207650_11273630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium626Open in IMG/M
3300025926|Ga0207659_11334721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300025930|Ga0207701_10311900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1365Open in IMG/M
3300025931|Ga0207644_10774750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium802Open in IMG/M
3300025940|Ga0207691_11137067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300025981|Ga0207640_10537428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes980Open in IMG/M
3300026088|Ga0207641_10445368All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1251Open in IMG/M
3300027880|Ga0209481_10397448All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium707Open in IMG/M
3300027909|Ga0209382_11347274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300028380|Ga0268265_12494198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300031538|Ga0310888_10777250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300031562|Ga0310886_10720569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium622Open in IMG/M
3300031847|Ga0310907_10556853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium620Open in IMG/M
3300031854|Ga0310904_10454934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300031854|Ga0310904_11213740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300031908|Ga0310900_10647245All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium841Open in IMG/M
3300032012|Ga0310902_10728189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium670Open in IMG/M
3300032075|Ga0310890_10515478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium912Open in IMG/M
3300034660|Ga0314781_117942All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil37.06%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil8.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.29%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.76%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.18%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.18%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.18%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.18%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.18%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.18%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.59%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.59%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.59%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.59%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300023168Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0500.000028702162886013Switchgrass RhizosphereIFCMLSSSFGEINLLARCFLTELMALDQNEKKLIEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
INPhiseqgaiiFebDRAFT_10184617823300000364SoilMALDQNEKKLIEKLVEVLELLGXSKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPXSQARVIKMKKK*
F14TC_10118305023300000559SoilMALDQNEKKLIEKLAEILELLGASKKDIQAITVSQKVDANFLKKAAEFFDNTEACNVCSHAFHSWRNTVDDETVLSFIDDWITWKKQNSDPTSQARVIKMKKRS*
JGI1027J11758_1300113513300000789SoilMALDQNEKKLIEKLVEVLELLGXSKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPKSQARV
Ga0062593_10016419543300004114SoilMIPGSVDLSNELDITNIFCINFKKYCLLAHCFLTLRMALDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKM
Ga0063356_10105002333300004463Arabidopsis Thaliana RhizosphereMALDQNEKKFIEKLVAVLKLLNASEKDIQMISGAKKIDANFLKKAGNIFDKTEACNVCRNAFFTWRNSLDDETVLSFIDEWI
Ga0063356_10484804313300004463Arabidopsis Thaliana RhizosphereMTLDQNEKKLIEKLGSALNLLNASEKDLQVISATKKIDDNFLKNAGDIFDNTEACTVCRHAFHSWQNTLDDETVL
Ga0062592_10042203723300004480SoilMIPGSVDLSNELDITNIFCINFKKYCLLAHCFLTLRMALDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0062591_10009290133300004643SoilMALDQNEKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPTSQARVIKMK
Ga0066673_1035550623300005175SoilMALDQNEKKLVEKLVEVLELLNASQEDIQSIIGSEKIDDDFLKKATQFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNNGSDSEARIIQMKKRS*
Ga0065712_1003182523300005290Miscanthus RhizosphereMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0065715_1085867413300005293Miscanthus RhizosphereMALDQNEKKLVEKLVEVLELLGASEEDIHSIVGSEKIDEEFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS*
Ga0065705_1019983833300005294Switchgrass RhizosphereMTLDQNEKKLIEKLVEVLELLDASKKDIQAIAGSRRIDANFFKKAAEFFDTTDACNVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDPKSQAR
Ga0065705_1053807013300005294Switchgrass RhizosphereMALDTNEKLLIEKLAAALTLMHADPEDIRTISEATKIDEDFLITAGQIFDQTEACDVCLHAFHSWRRTLDDETVLSFIDDWINWKHQNKDPYPQARIRKMKKRT*
Ga0065705_1098625313300005294Switchgrass RhizosphereMALDQNEKKLIEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0065707_1021935713300005295Switchgrass RhizosphereMALDQNEKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPTSQARVIKMKKNSSAFSLLKYY
Ga0070682_10010906723300005337Corn RhizosphereMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0070669_10127941713300005353Switchgrass RhizosphereMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNVDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0070675_10185771813300005354Miscanthus RhizosphereVTISRHEPAGHIFECFFSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0070671_10096680723300005355Switchgrass RhizosphereMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNKGSATQARIVQMRKRS*
Ga0070674_10094941513300005356Miscanthus RhizosphereMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGS
Ga0070701_1065857523300005438Corn, Switchgrass And Miscanthus RhizosphereMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENK
Ga0070700_10000807313300005441Corn, Switchgrass And Miscanthus RhizosphereMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKK
Ga0068854_10124116623300005578Corn RhizosphereMALDQNEKKLIANVVTVLELLNANEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0068862_10207892613300005844Switchgrass RhizosphereMALDQNEKKLIANVVTVLELLNANEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0068862_10265757413300005844Switchgrass RhizosphereMALDQNEKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWK
Ga0066651_1030004313300006031SoilENLLARCFLAVGMALDQNEKKLVEKLVEVLELLNASQEDIQSIIGAQKVDDDFLKKATQFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNNGSDSEARIIQMKKRS*
Ga0066652_10000088393300006046SoilMALDQNEKKLVEKLVEVLELLNASQEDIQSIIGAQKVDDDFLKKATQFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNNGSDSEARIIQMKKRS*
Ga0066652_10047885213300006046SoilMALDENEKKLVEKLVEVLELLGASEEDIHSIVGSEKIDEEFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSEARIIQMRKR
Ga0068871_10054878823300006358Miscanthus RhizosphereMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKQNLGSGSQAPIVKMKKR*
Ga0075428_10001548973300006844Populus RhizosphereMSLDQNEKKLIEKLSIALNLLNASEEDLQTISGAEKIDNEFLEKADNIFDNTEACTVCRHAFHSWRKTLDDETVLSFIDDWINWKTHNNPNSKVSPSK*
Ga0075428_10012276623300006844Populus RhizosphereMALDHNEKKLIEKLTAALNLLNVNEKDRQVISGAKKIDASFLEKARSIFDNTEACSVCSHAFHTWRKTMDDETVLSFIEDWINWKKQNTNPNSKVAT*
Ga0075428_10055839023300006844Populus RhizosphereMPLDQNEKKLIETLTVALNLLNASEEDRQMISGAKKIDANFLQKAGKIFDNTEACTVCRHAFHSWRNTLDDETVLSFLDDWINWKTQNTDPDSKIATSK*
Ga0075421_10000716893300006845Populus RhizosphereMALDHNEKKLIEKLTAALNLLNVNEKDRQVISGAKKIDASFLEKARSIFDNTEACSVCSHAFHTWRKTMDDETVLSFIEDWINWKKQNTNPNSKVAS*
Ga0075430_10000494793300006846Populus RhizosphereMALDQNEKRLIEKLTAALNLLNVNEKDRQVISGAKKIDASFLEKARNIFDNTEACSVCSHAFHTWRKTMDDETVLSFIEDWINWKKQNTNPNSKVAS*
Ga0079217_1010297123300006876Agricultural SoilMIYLEEHGFLARCFLIQSMTLDQNEKKLIEKLVVVLELLGTSPRDIKSIIGTKKVDADFLQRAGKFFDNTEACNVCSHAFYSWRNTVDDETVLSFIDDWINWKKQNKGSASQARVIKMKKRS*
Ga0079215_1019944213300006894Agricultural SoilDQNEKKLIEKLVVVLELLGTSPRDIKSIIGTKKVDADFLQRAGKFFDNTEACNVCSHAFYSWRNTVDDETVLSFIDDWINWKKQNKGSASQARVIKMKKRS*
Ga0075419_1000138033300006969Populus RhizosphereMALDQNEKRLIEKLTAALNLLNVNEKDRQVISGAKKIDASFLEKARSIFDNTEACSVCSHAFHTWRKTMDDETVLSFIEDWINWKKQNTNPNSKVAS*
Ga0075419_1001094333300006969Populus RhizosphereMSLDQNEKKLIEKLSIALNLLNASEEDLQTISGAEKIDNEFLEKADNIFDNTEACTVCRHAFHSWRKTLDDETVLSFIDDWINWKTHNNLYSKVSPSK*
Ga0075419_1104836113300006969Populus RhizosphereKLVEVLELLSASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPKSQARVIKMKKK*
Ga0111539_1011855613300009094Populus RhizosphereMALDLNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS*
Ga0111539_1029721023300009094Populus RhizosphereMTLDQNEKKLIARVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVQMKKR*
Ga0111539_1160352523300009094Populus RhizosphereMTLDQNEKKLIEKLVEVLELLDASKKDIQAIAGSRKVDANFLKKAGEFFDNTEACNVCSHAFHSWRKTVDDETVLSFIDDWINWKKQNSDPNPQARVIKMKKR
Ga0075418_1001938963300009100Populus RhizosphereMSLDQNEKKLIEKLSIALNLLNASEEDVQTISGAEKIDNEFLEKADNIFDNTEACTVCRHAFHSWRKTLDDETVLSFIDDWINWKTHNNPNSKVSPSK*
Ga0075418_1125985823300009100Populus RhizosphereMTLDQNEKKLIARVVTVLELLNANEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVQMKKR*
Ga0114129_1083229133300009147Populus RhizosphereMALDQNEKRLIEKLTAALNLLNVNEKDRQVISGAKKIDASFLEKARNIFDNTEACSVCSHAFHTWRKTMDDETVLSFIEDWINWKKQNTNPNSKVAT*
Ga0114129_1158515223300009147Populus RhizosphereMSLDQNEKKLIEKLSIALNLLNASEEDLQTISGAEKIDNEFLEKADNIFDNTEACTVCRHAFHSWRNTLDDETVLSFLDDWINWKT
Ga0111538_1001692133300009156Populus RhizosphereMTLDQNEKKLIEKLVEVLELLDASKKDIQAIAGSRKVDANFLKKAGEFFDNTEACNVCSHAFHSWRKTVDDETVLSFIDDWINWKKQNSDPNPQARVIKMKKRS*
Ga0111538_1145219723300009156Populus RhizosphereMALDQNEKKLVEKLVEVLELLGASEEDIHSIVGSEKIDEEFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWK
Ga0111538_1202706923300009156Populus RhizosphereMTLDQNEKKLIARVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIV
Ga0105242_1109240413300009176Miscanthus RhizosphereMALDQNEKKLIASVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0105340_107880323300009610SoilMTLDQNEKKLIASVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWIN*
Ga0126305_1002292453300010036Serpentine SoilMSLDQNEKKLIAKLIEVLELLGASRKDIEAIAGSRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0126304_1096763923300010037Serpentine SoilMSLDQNEKKLIETLTAALNLLNASGEDRQMISGAKKIDANFLEKAGKIFDNTEACTVCRHAFHSWRKTLDEETVLSFLDDWINWKTQNTDPDSKIATSK*
Ga0134127_1197414313300010399Terrestrial SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSA
Ga0134127_1296832813300010399Terrestrial SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGS
Ga0137312_104734613300011400SoilHSFLARCFLTLSMALDQNEKKLIERLVVVLELLDASQQDIQAIRESKNVDADFLKRAAKFFDNTEACNVCSHAFHSWRNRVDDETVLSFIDDWINWKKQNKGSPSQARVIKMKKKS*
Ga0150984_11442263123300012469Avena Fatua RhizosphereMALDQNEKKLVGKLVEVLELLNASPEDIQSIIGSEKIDDNFLKRAAQFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNKGSDSEARIIQMRKRS*
Ga0157281_100734113300012883SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0157300_103997713300012884SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFDNTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0157287_100226233300012885SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSAS
Ga0157287_100664923300012885SoilQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0157305_1004217423300012891SoilLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0157305_1012071923300012891SoilMTLDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0157294_1002657423300012892SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRP*
Ga0157294_1002948813300012892SoilFFDWLSGSFRKLNLLARCFLTELMALDQNEKKLVEKLVEVLELLDASKEDIESIIGIEKIDEDFLKKATKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSDSQARVIKMKKRS*
Ga0157294_1012255923300012892SoilMALDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0157284_1001379433300012893SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSATQARIVQMRKRS*
Ga0157284_1019461123300012893SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQARIVK
Ga0157284_1019859223300012893SoilLIERLVMVLELLDASQQDIQSIRESKKVDSDFLKRAAKFFDNTEACNICSHAFHSWRNRVDDETVLSFIDDWINWKRQNKGSGSQARVIKMKKRS*
Ga0157309_1005896323300012895SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSDSQARVIKMKKRS*
Ga0157309_1007040613300012895SoilMIPGSVDLSNELDITNIFCINFKKYCLLAHCFLTLRMALDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKK*
Ga0157285_1024145823300012897SoilMALDQNEKKLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFDNTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVKMKKR*
Ga0157293_1000889823300012898SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIVGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS*
Ga0157293_1008685113300012898SoilMALDQNEKKLIANVVTVLELLNANEKDIQSIKTSEKVDDDFLDRAAQLFDNTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0157293_1029857113300012898SoilIMIPGSVDLSNGLDITNSFCINFKKYCLLAHCFLTLRMALDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0157299_1000864133300012899SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0157299_1020277123300012899SoilMALDQNEIKLIEKLTEVLELLDASKEDIRSIMGSEKIDDNFLKRAAEFFDNTEACNVCGHAFHSWRNTVDDETVLSFIDDWINWKKQNRNSNGQARVIKMKKRP*
Ga0157292_1003593323300012900SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS*
Ga0157292_1010456823300012900SoilMALDQNEKKLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQARIVK
Ga0157291_1001364933300012902SoilMTRLITFFDWLSGSFRKLNLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEKDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0157291_1001792323300012902SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVKMKKR*
Ga0157289_1005457213300012903SoilMALDQNEIKLIEKLTEVLELLDASKEDIRSIMGSEKIDDNFLKRAAEFFDNTEACNVCGHAFHSWRNTVDDETVLSFIDDWINW
Ga0157282_1003249313300012904SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFYSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0157296_1021911213300012905SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFYSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIIKMKKR*
Ga0157295_1003556213300012906SoilMALDQNEKKLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQARIVKMKKR*
Ga0157283_1002810523300012907SoilVNRLIAFFACLSSSFQEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS*
Ga0157290_1000329523300012909SoilVTISRHKPADPIICMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS*
Ga0157290_1011665323300012909SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQARIVKMKKR*
Ga0157290_1013095523300012909SoilLQLSFYFKKYSLLAHCFLTVRMSLDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0157308_1006090123300012910SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKATKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSDSQARVIKMKKRS*
Ga0157308_1019075513300012910SoilMALDQNEKKLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFDNTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0157301_1002066013300012911SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRP*
Ga0157306_1026289913300012912SoilMSLDQNEKKLIEKLVEVLELLGASKKDIEAIAGSRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS*
Ga0157298_1000961713300012913SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEEFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRP*
Ga0157302_1030352413300012915SoilSFQEINLLARCFLTELMALDQNEKKLVEKLVEVLELLGASEEDIHSIVGSEKIDEEFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS
Ga0162650_10006131913300012939SoilMALDQNEKKLIERLVVVLELLEASQQDIQAIRESKNVDADFLKRAAKFFDNTEACNVCSHAFHSWRNRVDDETVLRFIDDWINWKKQNKGSASQARVIKMKKKS*
Ga0164303_1134217913300012957SoilSAKTEPDLYLLARCFQGLSMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0164306_1123230523300012988SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKK
Ga0157307_101342933300013096SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFIDDWINWKKQNRNSNGQARVIKMKKRS*
Ga0157375_1248547823300013308Miscanthus RhizosphereMALDQNEKKLIANVVTVLELLNASEKDIESIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0157380_1151961213300014326Switchgrass RhizosphereMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKG
Ga0157380_1235117613300014326Switchgrass RhizosphereMALDQNEKRLVVVLELLDASQQDIQSIMEPKKVDSHFLNRAAKIFDNTEACNVCSHAFHSWRSRVDDETILSFIDDWINWKKQNKGSASQAPVIRMKKRS*
Ga0173480_1011818923300015200SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRP*
Ga0173480_1024062723300015200SoilWLSGSFRKLNLLARCFLTELMALDQNEKKLVEKLVEVLELLDASKEDIESIIGSEKIDEDFLKKATKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSDSQARVIKMKKRS*
Ga0173478_1000158153300015201SoilMALDQNEKKLIEKLVEVLELLGPSKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPKSQARVIKMKKK*
Ga0173478_1002723223300015201SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTDACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQAPIVKMKKR*
Ga0173478_1003103633300015201SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKSS*
Ga0173478_1003338723300015201SoilMALDQNEIKLIEKLTEVLELLDASKEDIRSIMGSEKIDDDFLKRAAEFFDNTEACNVCGHAFHSWRNTVDDETVLSFIDDWINWKKQNRNSNGQARVIKMKKRP*
Ga0132258_1349035723300015371Arabidopsis RhizosphereMALDQNEKKLVGKLVEVLELLNASQEDIQSIIGSDKIDDDFLKKATQFFDNTEACSVCSHAFHSWRKTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS*
Ga0184634_1037552823300018031Groundwater SedimentVTISRHKPADPIICMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0184611_100302213300018067Groundwater SedimentLDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0184611_101646123300018067Groundwater SedimentMTLDQNEKKLIARVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVQMKKR
Ga0184611_106166313300018067Groundwater SedimentLDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0184624_1000682033300018073Groundwater SedimentMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0184640_1022735523300018074Groundwater SedimentMTLDQNEKKLIARVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0184640_1047360213300018074Groundwater SedimentMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRP
Ga0184628_1022386313300018083Groundwater SedimentMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIV
Ga0190270_1044593213300018469SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDHDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0190274_1006854623300018476SoilMALDQNEKKLIEKLVAVLELLDVSRQDIQSIMESRSVDADFLKRAAKFFDNTEACNVCSHAFHSWRNRVDDETVLSFIDDWINWKKQNKGSASQARVIKMKKKS
Ga0190274_1011501233300018476SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0190271_1015185733300018481SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0173481_1011801223300019356SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKHLDDETVLHFIEDWINWKKENLGSGSQARIVKMKKRQ
Ga0173481_1023000213300019356SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVFSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0173482_1008304623300019361SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0173482_1062579223300019361SoilMALDQNEKKLVEKLVEVLELLDASEEDIHSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNKGSASQARIVQMRKRS
Ga0173479_1001350323300019362SoilQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0173479_1014127213300019362SoilMALDQNEKQLIERLVMVLELLDASQQDIQSIRESKKVDSDFLKRAAKFFDNTEACNICSHAFHSWRNRVDDETVLSFIDDWINWKRQNKGSGSQARVIKMKKRS
Ga0173479_1034144323300019362SoilMALDQNEIKLIEKLTEVLELLDASKEDIRSIMGSEKIDDNFLKRAAEFFDNTEACNVCGHAFHSWRNTVDDETVLSFIDDWINWKKQNRNSNGQARVIKMKKRP
Ga0193741_101076423300019884SoilMALDQNEKKLIERLVVVLELLDASQQDIQAIRESKNVDADFLKRAAKFFDNTEACNVCSHAFHSWRNRVDDETVLSFIDDWINWKKQNKGSASQARVIKMKKKS
Ga0193741_101266423300019884SoilMTLDQNEKKLIEKLTVALNLLNASEEDLQMISSANKIDASFLEKAGNIFDNTEACTVCRHAFHSWRNTLDDETVLSFIDDWINWKTQNTNPDSKITTSN
Ga0193741_116576613300019884SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0193740_102814023300020009SoilMALDQNEKKLIERLVVVLELLEASQQDIQAIRESKNVDADFLKRAAKFFDNTEACNVCSHAFHSWRNRVDDETVLSFIDDWINWKKQNKGSASQARVIKMKKKS
Ga0193738_100089533300020020SoilMALDQNEKKLIERLVVVLELLDASQQDIQAIRESKNVDADFLKRAAKFFDNTEACNVCSHAFHSWRNRVDDETVLSFIDDWINWKKQNKGSASQAPVIKILNEQRCKIGH
Ga0247747_102643723300022737SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRS
Ga0222622_1069302923300022756Groundwater SedimentVTISRHKPADPIICMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMKKR
Ga0247746_101123533300022886SoilKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPTSQARVIKMKKNSSAFSLLKYYL
Ga0247746_117859513300022886SoilVTISRHKPADPIFCMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKQNNGSDSQARIIQMRKRP
Ga0247746_120648313300022886SoilMALDQNEKRLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSG
Ga0247795_101443013300022899SoilIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETMLSFIDDWINWKKRNSDPKSQARVIKMKKK
Ga0247790_1010295013300022915SoilMALDQNEKKLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0247790_1014178413300022915SoilMALDQNEKKLVEKLVEVLELLGASEEDIHSIVGSEKIDEEFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0247777_119942413300022917Plant LitterEPDLYLLARCFQGLSMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0247793_100356743300023066SoilMIPGSVDLSNELDITNIFCINFKKYCLLAHCFLTLRMALDQNEKKLIEKLVEVLELLGASKKDIEAIAESRKIDADFFKKTAEFFDSTEACSVCSHAFHSWRNTVDDETVLSFIDDWINWKKQNSDTKSQARVIKMKKRS
Ga0247752_105191513300023071SoilMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQA
Ga0247748_105378113300023168SoilMALDQNEKRLIAKVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0247796_102993613300023261SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0247796_103714823300023261SoilMALDQNEIKLIEKLTEVLELLDASKEDIRSIMGSEKIDDDFLKRAAEFFDNTEACNVCGHAFHSWRNTVDDETVLSFIDDWINWKKQNRNSNGQARVIKMKKRP
Ga0247794_1000411333300024055SoilMALDQNEKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPKSQARVIKMKKK
Ga0247794_1028552413300024055SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGS
Ga0207643_1028159413300025908Miscanthus RhizosphereMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNVDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0207650_1127363023300025925Switchgrass RhizosphereVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNKGSATQARIVQMRKRS
Ga0207659_1133472123300025926Miscanthus RhizosphereVTISRHEPAGHIFECFFSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVFSFLDDWINWKKENKGSASQARI
Ga0207701_1031190023300025930Corn, Switchgrass And Miscanthus RhizosphereMALDQNEKKLVEKLVEVLELLGASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0207644_1077475023300025931Switchgrass RhizosphereMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACNVCSHAFHSWRNTVNDETVLSFLDDWINWKKKNKGSATQARIVQMRKRS
Ga0207691_1113706713300025940Miscanthus RhizosphereMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLG
Ga0207640_1053742823300025981Corn RhizosphereMALDQNEKKLIANVVTVLELLNANEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0207641_1044536823300026088Switchgrass RhizosphereMALDQNEKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTEACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNSDPNSQARVIKMKKK
Ga0209481_1039744823300027880Populus RhizosphereMALDHNEKKLIEKLTAALNLLNVNEKDRQVISGAKKIDASFLEKARSIFDNTEACSVCSHAFHTWRKTMDDETVLSFIEDWINWKKQNTNPNSKVAS
Ga0209382_1134727423300027909Populus RhizosphereMSLDQNEKKLIEKLSIALNLLNASEEDLQTISGAEKIDNEFLEKADNIFDNTEACTVCRHAFHSWRKTLDDETVLSFIDDWINWKTHNNPNSKVSPSK
Ga0268265_1249419813300028380Switchgrass RhizosphereMALDQNEKKLIEKLVEVLELLGASKKDIDAIAGSRKIDANFFKKAAEFFDTTGACSVCSHAFHSWRNTVDDETLLSFIDDWINWKKQNS
Ga0310888_1077725013300031538SoilDLYLLARCFQGLSMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETLLHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0310886_1072056923300031562SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVYDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0310907_1055685313300031847SoilKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0310904_1045493423300031854SoilMALDQNEKKLIASVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNVDDETALHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0310904_1121374013300031854SoilMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0310900_1064724513300031908SoilMALDQNEKKLIARVVTVLELLNANEKDIQSIKTSEKVDDDFLDRAAQLFENTEACTVCSHAFHSWRKNLDDETVLHFIEDWINWKKENLGSGSQAPIVKMKKR
Ga0310902_1072818923300032012SoilVTISRHKPADPIFCMLSSSFGEINLLARCFLTELMALDQNEKKLVEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS
Ga0310890_1051547813300032075SoilMALDQNEKKLIANVVTVLELLNASEKDIQSIKTSEKVDDDFLDRAAQLFEHTEACTVCSHAFHSWRKNLDDETALHFIEDWINWKKENLGSGSQARIVKMKKR
Ga0314781_117942_192_5063300034660SoilMALDQNEKKLIEKLVEVLELLDASEEDIQSIIGSEKIDEDFLKKAAKFFDNTEACSVCSHAFHSWRNTVNDETVLSFLDDWINWKKENKGSASQARIVQMRKRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.