Basic Information | |
---|---|
Family ID | F036836 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 169 |
Average Sequence Length | 41 residues |
Representative Sequence | RLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSAAQSG |
Number of Associated Samples | 133 |
Number of Associated Scaffolds | 169 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.18 % |
% of genes near scaffold ends (potentially truncated) | 98.82 % |
% of genes from short scaffolds (< 2000 bps) | 88.17 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.396 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.710 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.669 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.479 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 0.00% Coil/Unstructured: 70.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 169 Family Scaffolds |
---|---|---|
PF04149 | DUF397 | 3.55 |
PF12728 | HTH_17 | 2.96 |
PF13470 | PIN_3 | 2.37 |
PF00293 | NUDIX | 2.37 |
PF05988 | DUF899 | 2.37 |
PF01381 | HTH_3 | 2.37 |
PF06114 | Peptidase_M78 | 2.37 |
PF00805 | Pentapeptide | 1.78 |
PF13560 | HTH_31 | 1.78 |
PF00206 | Lyase_1 | 1.18 |
PF12680 | SnoaL_2 | 1.18 |
PF05729 | NACHT | 1.18 |
PF00248 | Aldo_ket_red | 1.18 |
PF13191 | AAA_16 | 0.59 |
PF00196 | GerE | 0.59 |
PF13359 | DDE_Tnp_4 | 0.59 |
PF03551 | PadR | 0.59 |
PF03703 | bPH_2 | 0.59 |
PF05016 | ParE_toxin | 0.59 |
PF02737 | 3HCDH_N | 0.59 |
PF00174 | Oxidored_molyb | 0.59 |
PF01402 | RHH_1 | 0.59 |
PF00392 | GntR | 0.59 |
PF14559 | TPR_19 | 0.59 |
PF01936 | NYN | 0.59 |
PF02668 | TauD | 0.59 |
PF01850 | PIN | 0.59 |
PF07505 | DUF5131 | 0.59 |
PF13551 | HTH_29 | 0.59 |
PF13289 | SIR2_2 | 0.59 |
PF13546 | DDE_5 | 0.59 |
PF02452 | PemK_toxin | 0.59 |
PF02133 | Transp_cyt_pur | 0.59 |
PF13374 | TPR_10 | 0.59 |
PF08240 | ADH_N | 0.59 |
PF01648 | ACPS | 0.59 |
PF11225 | DUF3024 | 0.59 |
PF01814 | Hemerythrin | 0.59 |
PF00717 | Peptidase_S24 | 0.59 |
COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
---|---|---|---|
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 2.37 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.78 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.59 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.59 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.59 |
COG1432 | NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturation | General function prediction only [R] | 0.59 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.59 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.59 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.59 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.59 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.59 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.59 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.59 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.59 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.59 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.59 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.59 |
COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.40 % |
Unclassified | root | N/A | 42.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004152|Ga0062386_100081404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2472 | Open in IMG/M |
3300004152|Ga0062386_101570378 | Not Available | 549 | Open in IMG/M |
3300004635|Ga0062388_102270672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300005440|Ga0070705_100117893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1709 | Open in IMG/M |
3300005440|Ga0070705_100763435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
3300005445|Ga0070708_100009333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7905 | Open in IMG/M |
3300005454|Ga0066687_10881553 | Not Available | 533 | Open in IMG/M |
3300005537|Ga0070730_10737605 | Not Available | 623 | Open in IMG/M |
3300005921|Ga0070766_10877322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
3300005921|Ga0070766_10906736 | Not Available | 604 | Open in IMG/M |
3300005952|Ga0080026_10067289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 961 | Open in IMG/M |
3300005995|Ga0066790_10021704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2807 | Open in IMG/M |
3300006052|Ga0075029_100689023 | Not Available | 689 | Open in IMG/M |
3300006102|Ga0075015_100954020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 523 | Open in IMG/M |
3300006175|Ga0070712_100599979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
3300006176|Ga0070765_100173906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1939 | Open in IMG/M |
3300006176|Ga0070765_100922428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
3300006577|Ga0074050_11771363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
3300006755|Ga0079222_12539414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
3300006852|Ga0075433_11936591 | Not Available | 505 | Open in IMG/M |
3300009520|Ga0116214_1025973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2096 | Open in IMG/M |
3300009520|Ga0116214_1125956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter livingstonensis | 948 | Open in IMG/M |
3300009520|Ga0116214_1317257 | Not Available | 600 | Open in IMG/M |
3300009524|Ga0116225_1012283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4610 | Open in IMG/M |
3300009624|Ga0116105_1194391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia californiensis | 557 | Open in IMG/M |
3300009672|Ga0116215_1247145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 781 | Open in IMG/M |
3300009672|Ga0116215_1387374 | Not Available | 605 | Open in IMG/M |
3300009672|Ga0116215_1544789 | Not Available | 501 | Open in IMG/M |
3300009683|Ga0116224_10226082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa | 894 | Open in IMG/M |
3300009683|Ga0116224_10267791 | Not Available | 814 | Open in IMG/M |
3300009698|Ga0116216_10134888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
3300009698|Ga0116216_10781591 | Not Available | 572 | Open in IMG/M |
3300009700|Ga0116217_10660067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 649 | Open in IMG/M |
3300009824|Ga0116219_10792946 | Not Available | 517 | Open in IMG/M |
3300010339|Ga0074046_10796326 | Not Available | 553 | Open in IMG/M |
3300010341|Ga0074045_10010144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7843 | Open in IMG/M |
3300010361|Ga0126378_10968137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
3300010371|Ga0134125_10307329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1761 | Open in IMG/M |
3300010371|Ga0134125_10953323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 941 | Open in IMG/M |
3300010379|Ga0136449_100193028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3891 | Open in IMG/M |
3300010379|Ga0136449_100270269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → unclassified Plantactinospora → Plantactinospora sp. BB1 | 3134 | Open in IMG/M |
3300010379|Ga0136449_100382519 | Not Available | 2509 | Open in IMG/M |
3300010379|Ga0136449_100431369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2322 | Open in IMG/M |
3300010379|Ga0136449_102983999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
3300010379|Ga0136449_104586087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 507 | Open in IMG/M |
3300010401|Ga0134121_10453179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1171 | Open in IMG/M |
3300010876|Ga0126361_10876234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
3300012096|Ga0137389_10636804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 916 | Open in IMG/M |
3300012206|Ga0137380_11446051 | Not Available | 572 | Open in IMG/M |
3300012209|Ga0137379_10099606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica → unclassified Actinospica → Actinospica sp. MGRD01-02 | 2796 | Open in IMG/M |
3300012211|Ga0137377_11207265 | Not Available | 686 | Open in IMG/M |
3300012354|Ga0137366_10115863 | Not Available | 2026 | Open in IMG/M |
3300012356|Ga0137371_10387512 | Not Available | 1084 | Open in IMG/M |
3300012357|Ga0137384_10163549 | Not Available | 1862 | Open in IMG/M |
3300015371|Ga0132258_12695406 | Not Available | 1240 | Open in IMG/M |
3300015373|Ga0132257_101045624 | Not Available | 1029 | Open in IMG/M |
3300016270|Ga0182036_10597213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 885 | Open in IMG/M |
3300016294|Ga0182041_11350507 | Not Available | 653 | Open in IMG/M |
3300016319|Ga0182033_10564566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
3300016341|Ga0182035_11103871 | Not Available | 706 | Open in IMG/M |
3300016341|Ga0182035_11480828 | Not Available | 611 | Open in IMG/M |
3300016357|Ga0182032_11001308 | Not Available | 714 | Open in IMG/M |
3300016357|Ga0182032_11724904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300017924|Ga0187820_1241823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. | 577 | Open in IMG/M |
3300017926|Ga0187807_1246117 | Not Available | 585 | Open in IMG/M |
3300017932|Ga0187814_10073036 | Not Available | 1258 | Open in IMG/M |
3300017932|Ga0187814_10425904 | Not Available | 519 | Open in IMG/M |
3300017933|Ga0187801_10509803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
3300017943|Ga0187819_10071508 | Not Available | 2064 | Open in IMG/M |
3300017959|Ga0187779_10398068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. | 897 | Open in IMG/M |
3300017970|Ga0187783_10836067 | Not Available | 664 | Open in IMG/M |
3300017995|Ga0187816_10539925 | Not Available | 525 | Open in IMG/M |
3300018001|Ga0187815_10318473 | Not Available | 660 | Open in IMG/M |
3300018007|Ga0187805_10641842 | Not Available | 503 | Open in IMG/M |
3300018046|Ga0187851_10032793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3519 | Open in IMG/M |
3300018085|Ga0187772_10169546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1453 | Open in IMG/M |
3300018085|Ga0187772_11328556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300018086|Ga0187769_10261156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura verrucosospora | 1290 | Open in IMG/M |
3300020199|Ga0179592_10155288 | Not Available | 1046 | Open in IMG/M |
3300020582|Ga0210395_10930088 | Not Available | 645 | Open in IMG/M |
3300021171|Ga0210405_11282666 | Not Available | 539 | Open in IMG/M |
3300021178|Ga0210408_11350953 | Not Available | 539 | Open in IMG/M |
3300021180|Ga0210396_11744293 | Not Available | 505 | Open in IMG/M |
3300021406|Ga0210386_10082967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2601 | Open in IMG/M |
3300021474|Ga0210390_10810816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300021560|Ga0126371_11060343 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300021560|Ga0126371_12406395 | Not Available | 637 | Open in IMG/M |
3300021560|Ga0126371_13829303 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300025929|Ga0207664_11100109 | Not Available | 710 | Open in IMG/M |
3300026557|Ga0179587_10210015 | Not Available | 1236 | Open in IMG/M |
3300026947|Ga0207853_1050373 | Not Available | 522 | Open in IMG/M |
3300027096|Ga0208099_1004728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1661 | Open in IMG/M |
3300027641|Ga0208827_1141152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300027884|Ga0209275_10107327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1437 | Open in IMG/M |
3300027905|Ga0209415_10023148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9437 | Open in IMG/M |
3300028747|Ga0302219_10223899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
3300028775|Ga0302231_10088959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
3300028781|Ga0302223_10077101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1112 | Open in IMG/M |
3300028798|Ga0302222_10317516 | Not Available | 607 | Open in IMG/M |
3300029882|Ga0311368_10111792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 2307 | Open in IMG/M |
3300029882|Ga0311368_10853639 | Not Available | 614 | Open in IMG/M |
3300029943|Ga0311340_11307849 | Not Available | 577 | Open in IMG/M |
3300029944|Ga0311352_11377195 | Not Available | 531 | Open in IMG/M |
3300029999|Ga0311339_11514803 | Not Available | 596 | Open in IMG/M |
3300030013|Ga0302178_10079585 | Not Available | 1724 | Open in IMG/M |
3300030053|Ga0302177_10537899 | Not Available | 601 | Open in IMG/M |
3300030494|Ga0310037_10058718 | Not Available | 1821 | Open in IMG/M |
3300030503|Ga0311370_10337622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1927 | Open in IMG/M |
3300030509|Ga0302183_10069730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
3300030509|Ga0302183_10122979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1021 | Open in IMG/M |
3300030520|Ga0311372_12005583 | Not Available | 677 | Open in IMG/M |
3300030524|Ga0311357_10541670 | Not Available | 1078 | Open in IMG/M |
3300030580|Ga0311355_11065563 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300030580|Ga0311355_11547720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
3300030580|Ga0311355_11827641 | Not Available | 515 | Open in IMG/M |
3300030618|Ga0311354_10665800 | Not Available | 1001 | Open in IMG/M |
3300030677|Ga0302317_10190025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 947 | Open in IMG/M |
3300030706|Ga0310039_10398029 | Not Available | 507 | Open in IMG/M |
3300030707|Ga0310038_10295779 | Not Available | 732 | Open in IMG/M |
3300030707|Ga0310038_10354008 | Not Available | 649 | Open in IMG/M |
3300030707|Ga0310038_10479026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 529 | Open in IMG/M |
3300030739|Ga0302311_10423642 | Not Available | 931 | Open in IMG/M |
3300031027|Ga0302308_10281110 | Not Available | 1034 | Open in IMG/M |
3300031234|Ga0302325_10230715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3122 | Open in IMG/M |
3300031234|Ga0302325_12056920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 702 | Open in IMG/M |
3300031525|Ga0302326_10245034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2930 | Open in IMG/M |
3300031525|Ga0302326_11269019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
3300031525|Ga0302326_12291965 | Not Available | 685 | Open in IMG/M |
3300031544|Ga0318534_10084791 | Not Available | 1804 | Open in IMG/M |
3300031546|Ga0318538_10525787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 641 | Open in IMG/M |
3300031546|Ga0318538_10613772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 590 | Open in IMG/M |
3300031668|Ga0318542_10141165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas bogoriensis | 1191 | Open in IMG/M |
3300031680|Ga0318574_10545565 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300031724|Ga0318500_10089481 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300031747|Ga0318502_10204008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura hibisca | 1144 | Open in IMG/M |
3300031764|Ga0318535_10279510 | Not Available | 747 | Open in IMG/M |
3300031769|Ga0318526_10243613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Planobispora → Planobispora longispora | 735 | Open in IMG/M |
3300031770|Ga0318521_10209629 | Not Available | 1127 | Open in IMG/M |
3300031792|Ga0318529_10454726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 596 | Open in IMG/M |
3300031793|Ga0318548_10567983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 552 | Open in IMG/M |
3300031797|Ga0318550_10508742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea lactucae | 581 | Open in IMG/M |
3300031798|Ga0318523_10496948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 604 | Open in IMG/M |
3300031805|Ga0318497_10530525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
3300031821|Ga0318567_10127242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1396 | Open in IMG/M |
3300031832|Ga0318499_10283456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
3300031859|Ga0318527_10471655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces noursei | 535 | Open in IMG/M |
3300031896|Ga0318551_10219941 | Not Available | 1055 | Open in IMG/M |
3300031912|Ga0306921_12644361 | Not Available | 517 | Open in IMG/M |
3300031941|Ga0310912_10237866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1399 | Open in IMG/M |
3300031947|Ga0310909_10969078 | Not Available | 696 | Open in IMG/M |
3300032001|Ga0306922_11047848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
3300032008|Ga0318562_10324325 | Not Available | 895 | Open in IMG/M |
3300032035|Ga0310911_10459578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Plantactinospora → unclassified Plantactinospora → Plantactinospora sp. BB1 | 738 | Open in IMG/M |
3300032052|Ga0318506_10065946 | Not Available | 1494 | Open in IMG/M |
3300032068|Ga0318553_10041209 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
3300032091|Ga0318577_10201938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
3300032160|Ga0311301_12331134 | Not Available | 607 | Open in IMG/M |
3300032261|Ga0306920_102649407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 686 | Open in IMG/M |
3300032261|Ga0306920_104352428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura spongiicola | 508 | Open in IMG/M |
3300032770|Ga0335085_11382779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 739 | Open in IMG/M |
3300032770|Ga0335085_11892979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
3300032895|Ga0335074_10677130 | Not Available | 1002 | Open in IMG/M |
3300032896|Ga0335075_10509590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. | 1226 | Open in IMG/M |
3300032954|Ga0335083_10764335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
3300032954|Ga0335083_11356982 | Not Available | 545 | Open in IMG/M |
3300033158|Ga0335077_12056792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300033289|Ga0310914_10422919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas bogoriensis | 1206 | Open in IMG/M |
3300033289|Ga0310914_10620827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
3300033290|Ga0318519_10476756 | Not Available | 750 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 16.57% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 15.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.51% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.33% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.14% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.37% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.18% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.18% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.18% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.59% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.59% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026947 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 (SPAdes) | Environmental | Open in IMG/M |
3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062386_1000814041 | 3300004152 | Bog Forest Soil | GHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSAPSSPQP* |
Ga0062386_1015703782 | 3300004152 | Bog Forest Soil | LGHSGGGATTLRHHADPVPEVDRRAAAYLAQLTARSAPLSPPP* |
Ga0062388_1022706722 | 3300004635 | Bog Forest Soil | AARLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVGSE* |
Ga0070705_1001178931 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAPSK* |
Ga0070705_1007634351 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLGHGSGGATTLRHYADPVTEVDRRAAAYLAQLTAGSGAGSG* |
Ga0070708_1000093339 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VGGFDLRNTAARLGDSGGGATTLRHYADPVSEVDRRAVVYLAQLTAGPAAQSS* |
Ga0066687_108815532 | 3300005454 | Soil | HGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAPSE* |
Ga0070730_107376051 | 3300005537 | Surface Soil | RNTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTARSTPSSPQP* |
Ga0070766_108773221 | 3300005921 | Soil | ARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTVRSAAESGG* |
Ga0070766_109067362 | 3300005921 | Soil | SGGATTLRHYADPVSEVDRRAAAYLAQLTAGSEPRSE* |
Ga0080026_100672893 | 3300005952 | Permafrost Soil | TAARLGHSGGGATTLRHYADPVSEVDRRAAAYLAKLTAGPTS* |
Ga0066790_100217047 | 3300005995 | Soil | LGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSAPQGS* |
Ga0075029_1006890232 | 3300006052 | Watersheds | TAARLGHSGGGATTLRHYADPVPEVDRRASTYLAQLTSRSAPSSSES* |
Ga0075015_1009540203 | 3300006102 | Watersheds | GHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSSPQN* |
Ga0070712_1005999793 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLPTAARLGHSGGGATTLKHWADPVSEVDRRAAAYLAQLTIVPV |
Ga0070765_1001739063 | 3300006176 | Soil | ARLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSGAQTD* |
Ga0070765_1009224283 | 3300006176 | Soil | TAARLGHSGGGATTLRHYADPVPEVDRRAAAYLARLTAGSTSQD* |
Ga0074050_117713632 | 3300006577 | Soil | LGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTARSEGQTGWRTAAAHGAL* |
Ga0079222_125394141 | 3300006755 | Agricultural Soil | AARLGHSGGGATTLRHYADPVPEVDRRAAVYLAQLTARPAPSSPEP* |
Ga0075433_119365911 | 3300006852 | Populus Rhizosphere | LRHYADPVSEVDRRAAAYLAELTASTASDARGPEA* |
Ga0116214_10259734 | 3300009520 | Peatlands Soil | ATTLRHYADPVSEVDRRAAAYLAQLTAGSAAQSD* |
Ga0116214_11259561 | 3300009520 | Peatlands Soil | NTAARLGHSGGGATTLRHYADPVPEVDRRAADYLAKLTAGSAAKSS* |
Ga0116214_13172572 | 3300009520 | Peatlands Soil | LRNTAARLGHSGGGATTLRHYADPVPEIDRRAAAYLAQLTAGSATQSG* |
Ga0116225_10122831 | 3300009524 | Peatlands Soil | SGGGAATLRHYADPVPEVDRRAAAYLAQLTARSTPSSHQP* |
Ga0116105_11943912 | 3300009624 | Peatland | GATTLRHYADPVPEVDRRAAAYLAQLTAGSVPKSD* |
Ga0116215_12471451 | 3300009672 | Peatlands Soil | LGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPLSPQP* |
Ga0116215_13873741 | 3300009672 | Peatlands Soil | AARLGHSGGGATTLRHYADPVREVDRRAAVYLAKLTAGSAAKST* |
Ga0116215_15447891 | 3300009672 | Peatlands Soil | RLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTAGSAAEAAGTADG* |
Ga0116224_102260821 | 3300009683 | Peatlands Soil | GATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0116224_102677911 | 3300009683 | Peatlands Soil | RNTAARLGHSGGGATTLRHYADPVPEVDRRASTYLAQLTSRSAPSSSES* |
Ga0116216_101348881 | 3300009698 | Peatlands Soil | TLRHYADPVPEVDRRAAAYLAQLTARSTPSSRQP* |
Ga0116216_107815911 | 3300009698 | Peatlands Soil | RLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0116217_106600672 | 3300009700 | Peatlands Soil | GGATTLKHYADPISEVDRRAAAYLAQLTTRSAAKSG* |
Ga0116219_107929462 | 3300009824 | Peatlands Soil | GATTLRHYADPVSEVDRRAAAYLAQLTAGSAAQNA* |
Ga0074046_107963261 | 3300010339 | Bog Forest Soil | TTLRHYADPVPEVDRRAAPYLAQLTARSAPSSPQP* |
Ga0074045_100101446 | 3300010341 | Bog Forest Soil | GHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSAAQSG* |
Ga0126378_109681373 | 3300010361 | Tropical Forest Soil | LRNTAARLGHSGSGATTLRHYADPVPEVDRRAAAYLAQLTAGPDAQSS* |
Ga0134125_103073291 | 3300010371 | Terrestrial Soil | SGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVQGT* |
Ga0134125_109533232 | 3300010371 | Terrestrial Soil | GSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAPSE* |
Ga0136449_1001930281 | 3300010379 | Peatlands Soil | GGGATTLKHYADPVSEVDRRAAVYLAQLTTRPAAQSG* |
Ga0136449_1002702691 | 3300010379 | Peatlands Soil | SGGGATTLKHYADPVSEVDRRAAAYLAQLTTRSAAQSG* |
Ga0136449_1003825193 | 3300010379 | Peatlands Soil | GHSGGGATTLKHYADPVSEVDRRAAAYLAQLTTRSAAQSG* |
Ga0136449_1004313691 | 3300010379 | Peatlands Soil | HSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0136449_1029839992 | 3300010379 | Peatlands Soil | ATTLRHYADPVPEVDRRAAAYLAQLTAGSETQSG* |
Ga0136449_1045860871 | 3300010379 | Peatlands Soil | SGGGATTLRHYADPVPEVDRRAAAYLAKLTAGPAAQSS* |
Ga0134121_104531791 | 3300010401 | Terrestrial Soil | GSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSAAQGS* |
Ga0126361_108762342 | 3300010876 | Boreal Forest Soil | AARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0137389_106368041 | 3300012096 | Vadose Zone Soil | SGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0137380_114460511 | 3300012206 | Vadose Zone Soil | LGHGGGGATTLRHYADPVSEVDRRAAAYLAQLTAPTKSSGTTPA* |
Ga0137379_100996064 | 3300012209 | Vadose Zone Soil | RLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSAAQSG* |
Ga0137377_112072652 | 3300012211 | Vadose Zone Soil | LNIKGLRHYAGLVPEVDRRAAAYLAQLTAGSAAQSG* |
Ga0137366_101158631 | 3300012354 | Vadose Zone Soil | GQSGGGATTLRHYSDAVPEVYRRAAACLAQLTAQFTPSPPEP* |
Ga0137371_103875121 | 3300012356 | Vadose Zone Soil | HGGGGATTLRHYADPVSEVDRRAAAYLAQLTAPSEIKATPT* |
Ga0137384_101635492 | 3300012357 | Vadose Zone Soil | GGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0132258_126954064 | 3300015371 | Arabidopsis Rhizosphere | VFDVRNTAARFGHGGGGATSLRHNTDPVSEAGWRGAAYLAQQTAESTP* |
Ga0132257_1010456241 | 3300015373 | Arabidopsis Rhizosphere | LGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG* |
Ga0182036_105972131 | 3300016270 | Soil | LGHSGGGATTLRHYADPVPEADRRAAAYLEQLTAGPAVQSS |
Ga0182041_113505072 | 3300016294 | Soil | GFDLGNTAARLGHSGGGATTLKHYADPVSEVDRRAAVRLAQLTSGSANARPL |
Ga0182033_105645661 | 3300016319 | Soil | AARLGHSGGGATTLKHYADPVSEVDRRAAAYLAQLTTRSAAQSG |
Ga0182035_111038712 | 3300016341 | Soil | GGATTLRHYADPVPEVDRRAAAYLAQLTARSTSQD |
Ga0182035_114808281 | 3300016341 | Soil | GFDLRNTAARLGHSGGGETTLRHHADPVPEVGRRAAAYLAQLTAGSAPQSG |
Ga0182032_110013081 | 3300016357 | Soil | LEPGLDHHYADPVPRVDRQAAAYLAQLTARSTPPPPQP |
Ga0182032_117249041 | 3300016357 | Soil | HSGRGATTLRHYADPVPEVDRRPAAYLAKLTARSVASSG |
Ga0187820_12418231 | 3300017924 | Freshwater Sediment | AARLGHGGGGATALRHYADPVPEVDRRAAAYRAKLTARSEVQTG |
Ga0187807_12461173 | 3300017926 | Freshwater Sediment | GATTLRHYADPVSEVDRRAAAYLAQLTAGSAAETD |
Ga0187814_100730361 | 3300017932 | Freshwater Sediment | TAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQPTAGSATQSG |
Ga0187814_104259042 | 3300017932 | Freshwater Sediment | AARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG |
Ga0187801_105098032 | 3300017933 | Freshwater Sediment | RNTAARLGHGGGATTLRHYADPVSEVDRRAAAYLAQLTTGNDKPAAAH |
Ga0187819_100715081 | 3300017943 | Freshwater Sediment | HSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSATQSG |
Ga0187779_103980681 | 3300017959 | Tropical Peatland | RLGHSGGGATTLRHYADPVPEVDRRAAAYLARLTAGSTSQD |
Ga0187783_108360671 | 3300017970 | Tropical Peatland | GATTLRHYADPVPEVDRRAAAYLAQLTAGSAPQSG |
Ga0187816_105399251 | 3300017995 | Freshwater Sediment | HGSGGATTLRHYADPVSEVDRRAAAYLAQLTTRSTAQSS |
Ga0187815_103184731 | 3300018001 | Freshwater Sediment | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTAGSAAESSR |
Ga0187805_106418421 | 3300018007 | Freshwater Sediment | RLGHSGGGATTLRHYADPVPEVDRRAAAYLARLTAGSKSQD |
Ga0187851_100327931 | 3300018046 | Peatland | GGGATTLPHYADPVPEVDRRAAAYLAQLTAGSATQSG |
Ga0187772_101695463 | 3300018085 | Tropical Peatland | AARLGHSGGGATTVRHYADPVPEVDRRAAAYLARLTAGSTSQD |
Ga0187772_113285561 | 3300018085 | Tropical Peatland | TAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTARSVAPSG |
Ga0187769_102611561 | 3300018086 | Tropical Peatland | HSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAPQSR |
Ga0179592_101552882 | 3300020199 | Vadose Zone Soil | ARLGHGSGGATTLRHYADLVSEVDRRGAAYLAQLTSGSAAQSG |
Ga0210395_109300881 | 3300020582 | Soil | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSVPRGG |
Ga0210405_112826661 | 3300021171 | Soil | LGNTAARLGHSGGGATTLKHCADPVSEVDRRAAAYLAQLTTRSAAQSG |
Ga0210408_113509532 | 3300021178 | Soil | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARRTPSPPQP |
Ga0210396_117442931 | 3300021180 | Soil | ARLGHSGGGATTLRHYADPAPEVDRRAAAYLAQLTAGSTPQTG |
Ga0210386_100829675 | 3300021406 | Soil | TTLRHYADPVPEVDRRAAAYLAKLTARSEAQSSRRP |
Ga0210390_108108161 | 3300021474 | Soil | RNTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTARSEAQSSRRP |
Ga0126371_110603431 | 3300021560 | Tropical Forest Soil | TAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPASQSGGRP |
Ga0126371_124063953 | 3300021560 | Tropical Forest Soil | GATTLRHYADPVPEVDRRAAAYLAQLTAGPATQSG |
Ga0126371_138293031 | 3300021560 | Tropical Forest Soil | SGGGATTLRHYADPVSEVDRRAAVYLAQPTRGSAPLG |
Ga0207664_111001092 | 3300025929 | Agricultural Soil | GHSGGGATTLRHYADPVPEVDRRAAVYLAQLTARPAPSSPEP |
Ga0179587_102100152 | 3300026557 | Vadose Zone Soil | NSAARLGHGSGGATTLRHYADLVSEVDRRGAAYLAQLTSGSAAQSG |
Ga0207853_10503732 | 3300026947 | Tropical Forest Soil | RLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSGAQSD |
Ga0208099_10047281 | 3300027096 | Forest Soil | GRSGGGATTLRHYADPVPEVDRRAAAYLAQVTARSAAHSG |
Ga0208827_11411521 | 3300027641 | Peatlands Soil | LGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGSAAKSS |
Ga0209275_101073271 | 3300027884 | Soil | ARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTAGSAARSSG |
Ga0209415_100231481 | 3300027905 | Peatlands Soil | RLGHGSGGATTLRHYADPVSEVDRRAAAYLAALTAGDADGATT |
Ga0302219_102238992 | 3300028747 | Palsa | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSSAQS |
Ga0302231_100889593 | 3300028775 | Palsa | GATTLRHYADPVPEVDRRAAAYLAQLTARSTPSSAQS |
Ga0302223_100771011 | 3300028781 | Palsa | HRGGGATTLRHYADPVPEVDRRAAAYLAKLTAGSATQGS |
Ga0302222_103175161 | 3300028798 | Palsa | AARLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAPSK |
Ga0311368_101117924 | 3300029882 | Palsa | GHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARRTPSSPQN |
Ga0311368_108536391 | 3300029882 | Palsa | HASATAAAAALRHYADPVPEIDRRAAAYLAQLTAGSATQSG |
Ga0311340_113078493 | 3300029943 | Palsa | GGGATTLRHYADPVPEVDRRAAAYLAKLTARSTPVE |
Ga0311352_113771951 | 3300029944 | Palsa | GSGGATTLRHYADPVSEVDRRAAAYLAQLTARSAVESA |
Ga0311339_115148033 | 3300029999 | Palsa | GHSGGGATTLRHYADPVPEVDRRAAAYLAKLTARSTPVE |
Ga0302178_100795852 | 3300030013 | Palsa | ASATAAAAALRHYADPVPEIDRRAAAYLAQLTAGSATQSG |
Ga0302177_105378992 | 3300030053 | Palsa | GSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSAAKSD |
Ga0310037_100587184 | 3300030494 | Peatlands Soil | LGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSSHQP |
Ga0311370_103376221 | 3300030503 | Palsa | AARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSAQS |
Ga0302183_100697301 | 3300030509 | Palsa | GGATTLRHYADPVPEVDRRAAAYLAQLTARRTPSSPQN |
Ga0302183_101229791 | 3300030509 | Palsa | DLRNTAGRLGRSGGGATTLRHYADPVPDVDRRPAAYLAQLTGE |
Ga0311372_120055831 | 3300030520 | Palsa | GSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAPSK |
Ga0311357_105416703 | 3300030524 | Palsa | AARLGHGSGGATTLRHYADPVSEVDRRAAVYLAQLTAGSVAPNK |
Ga0311355_110655631 | 3300030580 | Palsa | LRNTAARLGHSGGGATTLPHYADPVPEVDRRAAAYLAQLTAGSATQSG |
Ga0311355_115477202 | 3300030580 | Palsa | AARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTGRRTSPIPES |
Ga0311355_118276411 | 3300030580 | Palsa | GHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPTTESG |
Ga0311354_106658001 | 3300030618 | Palsa | GSGGATTLRHYADPVSEVDRRAAVYLAQLTAGSVAPNK |
Ga0302317_101900253 | 3300030677 | Palsa | ARLGHSGGGATTLRHYADPVPEVDRRAAAYLAKLTAGSATQGS |
Ga0310039_103980291 | 3300030706 | Peatlands Soil | SGRIPRHYADPVPEVDRRAAAYLAQLTAGSTAQSR |
Ga0310038_102957791 | 3300030707 | Peatlands Soil | RLGHSGGGATTLKHYADPVSEVDRRAAAYLAQLTTRSAAQSG |
Ga0310038_103540081 | 3300030707 | Peatlands Soil | RLGHSGGGATTLRHYADPVPEVDRRAAVYLAKLTAGSAAKRS |
Ga0310038_104790262 | 3300030707 | Peatlands Soil | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSSPQS |
Ga0302311_104236422 | 3300030739 | Palsa | AGGFDLRNTDGRLGRSGGGATTLRHYADPVPDVDRRPAAYLAQLTGE |
Ga0302308_102811102 | 3300031027 | Palsa | SAGSTCGTLPHASATAAAAALRHYADPVPEIDRRAAAYLAQLTAGSATQSG |
Ga0302325_102307151 | 3300031234 | Palsa | SGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVVPSK |
Ga0302325_120569203 | 3300031234 | Palsa | SGGGATTLRHYADPVSEVDRRAAAYLAELTAGPTS |
Ga0302326_102450348 | 3300031525 | Palsa | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSG |
Ga0302326_112690192 | 3300031525 | Palsa | RLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGPVAPSK |
Ga0302326_122919651 | 3300031525 | Palsa | RLGHGSGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAPSK |
Ga0318534_100847911 | 3300031544 | Soil | VGGGATTLRHYADPVPEVDRRAAAYLAKLTARSAAANS |
Ga0318538_105257872 | 3300031546 | Soil | NTAARLGHSGGGATTLRHYADPVPDVDRRAAAYLAQLTAGPAAQSS |
Ga0318538_106137721 | 3300031546 | Soil | HSGGGATTLRHYADPVPEVDRRAVAYLAQLTARSTPASPQP |
Ga0318542_101411653 | 3300031668 | Soil | GHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTSQD |
Ga0318574_105455652 | 3300031680 | Soil | HSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPATQGG |
Ga0318500_100894811 | 3300031724 | Soil | TAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAPPPSVSAMFDLPLA |
Ga0318502_102040081 | 3300031747 | Soil | NTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318535_102795102 | 3300031764 | Soil | LGEVGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSAPPP |
Ga0318526_102436131 | 3300031769 | Soil | RLGHSGGGATTLRHYADPVPEVDRRAAAYLSRLTADAAIPAKTLPG |
Ga0318521_102096292 | 3300031770 | Soil | GHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPATQGG |
Ga0318529_104547261 | 3300031792 | Soil | LGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318548_105679831 | 3300031793 | Soil | RLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318550_105087422 | 3300031797 | Soil | NTAARLGHSGGGATTLKHYADPVSEVDRRAAAYLAQLTTRSAAQSG |
Ga0318523_104969483 | 3300031798 | Soil | SGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318497_105305252 | 3300031805 | Soil | SATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318567_101272421 | 3300031821 | Soil | LGHSGGSATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318499_102834562 | 3300031832 | Soil | HSGGSATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0318527_104716551 | 3300031859 | Soil | RNTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSAPPP |
Ga0318551_102199412 | 3300031896 | Soil | TTLRHYADPVPEVDRRAAAYLAQLTARSTPSAPPP |
Ga0306921_126443611 | 3300031912 | Soil | GHSGGGATTLRHYADPVPEVDRRAVAYLAQLTARSTPASPQP |
Ga0310912_102378664 | 3300031941 | Soil | GGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAAQSS |
Ga0310909_109690782 | 3300031947 | Soil | GGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAQGS |
Ga0306922_110478481 | 3300032001 | Soil | HSGGATTLWHYADPVPEVDRRAAAYLAQLTARSTPASPQP |
Ga0318562_103243251 | 3300032008 | Soil | GATTLRHYADPVSEVDRRAAAYLAQLTAGSAAQSE |
Ga0310911_104595783 | 3300032035 | Soil | RLGHSGGGATTLEHYADPVSEVDRRAAAYIAQLTTRPAAQSG |
Ga0318506_100659461 | 3300032052 | Soil | RLGHGGGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVGSE |
Ga0318553_100412094 | 3300032068 | Soil | GGATTLRHYADPVPEVDRRAAAYLAQLTAGPATQGG |
Ga0318577_102019383 | 3300032091 | Soil | LTAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTSQD |
Ga0311301_123311341 | 3300032160 | Peatlands Soil | SGDGATTLRHYADPVPEVDRRAAAYLAQLTAGSAPQSG |
Ga0306920_1026494072 | 3300032261 | Soil | TAARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTAGPAVQSS |
Ga0306920_1043524282 | 3300032261 | Soil | GGATTLRHYADPVPEVDRRAAAYLAQLTAGPTAQSS |
Ga0335085_113827792 | 3300032770 | Soil | ARLGHSGGGATTLRHYADPVPEVDRRAAAYLAQLTASPAPSFPEP |
Ga0335085_118929791 | 3300032770 | Soil | GATTLRHYADPVPEVDRRAAAYLAQLTAGSAPQNG |
Ga0335074_106771301 | 3300032895 | Soil | GGGGATTLRHYADPVSEVDRRAAAYLASLTKTSAADSSSPIDR |
Ga0335075_105095901 | 3300032896 | Soil | SGGGATTLRHYADPVPEVDRRAAAYLARLTAGPTSQD |
Ga0335083_107643352 | 3300032954 | Soil | RLGHSGGGATTLKHYADPVSEVDRRAAAYLAQLTTKPAAQSG |
Ga0335083_113569822 | 3300032954 | Soil | GGATTLRHYADPVPEVDRRAAAYLAKLTAGSATQSG |
Ga0335077_120567921 | 3300033158 | Soil | GGGATTLRHYADPVPEVDRRAAAYLAQLTAGSAPQNG |
Ga0310914_104229191 | 3300033289 | Soil | GGGATTLRHYADPVPEVDRRAAAYLAQLTARSTSQD |
Ga0310914_106208271 | 3300033289 | Soil | HSGGGATTLRHYADPVPEVDRRAAAYLAQLTARSTPSAPPP |
Ga0318519_104767561 | 3300033290 | Soil | TAARLGHGGGGATTLRHYADPVSEVDRRAAAYLAQLTAGSVAQSD |
⦗Top⦘ |