Basic Information | |
---|---|
Family ID | F036952 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 169 |
Average Sequence Length | 45 residues |
Representative Sequence | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRSGAHSS |
Number of Associated Samples | 143 |
Number of Associated Scaffolds | 169 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 80.47 % |
% of genes near scaffold ends (potentially truncated) | 28.40 % |
% of genes from short scaffolds (< 2000 bps) | 73.37 % |
Associated GOLD sequencing projects | 137 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.633 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.651 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.769 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.686 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.00% β-sheet: 0.00% Coil/Unstructured: 56.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 169 Family Scaffolds |
---|---|---|
PF10590 | PNP_phzG_C | 34.32 |
PF01450 | IlvC | 20.12 |
PF07991 | IlvN | 15.38 |
PF01494 | FAD_binding_3 | 7.69 |
PF13091 | PLDc_2 | 1.18 |
PF00528 | BPD_transp_1 | 1.18 |
PF00072 | Response_reg | 0.59 |
PF13191 | AAA_16 | 0.59 |
PF00583 | Acetyltransf_1 | 0.59 |
PF13439 | Glyco_transf_4 | 0.59 |
PF13493 | DUF4118 | 0.59 |
PF00899 | ThiF | 0.59 |
PF01243 | Putative_PNPOx | 0.59 |
PF13545 | HTH_Crp_2 | 0.59 |
PF00535 | Glycos_transf_2 | 0.59 |
PF00211 | Guanylate_cyc | 0.59 |
PF08448 | PAS_4 | 0.59 |
PF12773 | DZR | 0.59 |
PF13424 | TPR_12 | 0.59 |
PF02335 | Cytochrom_C552 | 0.59 |
PF12697 | Abhydrolase_6 | 0.59 |
PF01725 | Ham1p_like | 0.59 |
PF07311 | Dodecin | 0.59 |
PF03725 | RNase_PH_C | 0.59 |
PF05494 | MlaC | 0.59 |
COG ID | Name | Functional Category | % Frequency in 169 Family Scaffolds |
---|---|---|---|
COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 71.01 |
COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 15.38 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 15.38 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 7.69 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 7.69 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 7.69 |
COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 0.59 |
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.59 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.59 |
COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.59 |
COG3303 | Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit | Inorganic ion transport and metabolism [P] | 0.59 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.63 % |
Unclassified | root | N/A | 2.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8789657 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300000550|F24TB_10318384 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
3300000956|JGI10216J12902_118962436 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300003503|JGI26141J51220_1006329 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300004062|Ga0055500_10002215 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
3300004114|Ga0062593_100007455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4799 | Open in IMG/M |
3300004114|Ga0062593_101667916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
3300004281|Ga0066397_10085045 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300004463|Ga0063356_101684007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 948 | Open in IMG/M |
3300004480|Ga0062592_101123733 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 729 | Open in IMG/M |
3300005093|Ga0062594_100045999 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300005294|Ga0065705_10614829 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005295|Ga0065707_11136895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300005328|Ga0070676_11413747 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005341|Ga0070691_10113478 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300005345|Ga0070692_11019396 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
3300005434|Ga0070709_11241470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 600 | Open in IMG/M |
3300005440|Ga0070705_100707633 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005444|Ga0070694_101570011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
3300005467|Ga0070706_100015077 | All Organisms → cellular organisms → Bacteria | 7139 | Open in IMG/M |
3300005518|Ga0070699_100418625 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300005526|Ga0073909_10498303 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300005535|Ga0070684_100043815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3866 | Open in IMG/M |
3300005547|Ga0070693_100712363 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300005878|Ga0075297_1011943 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300005879|Ga0075295_1016349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 835 | Open in IMG/M |
3300005937|Ga0081455_10001726 | All Organisms → cellular organisms → Bacteria | 26459 | Open in IMG/M |
3300005937|Ga0081455_10432892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 904 | Open in IMG/M |
3300005985|Ga0081539_10107606 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300006041|Ga0075023_100363262 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300006163|Ga0070715_10208839 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300006845|Ga0075421_101707348 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300006854|Ga0075425_102353160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
3300006880|Ga0075429_100435338 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300006881|Ga0068865_100625182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 913 | Open in IMG/M |
3300006914|Ga0075436_100314919 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300006954|Ga0079219_11102046 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300007076|Ga0075435_101244344 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 651 | Open in IMG/M |
3300007255|Ga0099791_10476856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
3300009038|Ga0099829_10001709 | All Organisms → cellular organisms → Bacteria | 12329 | Open in IMG/M |
3300009088|Ga0099830_10205604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1542 | Open in IMG/M |
3300009088|Ga0099830_10263244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1367 | Open in IMG/M |
3300009089|Ga0099828_10007952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7740 | Open in IMG/M |
3300009089|Ga0099828_10009357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7221 | Open in IMG/M |
3300009137|Ga0066709_103070526 | Not Available | 611 | Open in IMG/M |
3300009795|Ga0105059_1004717 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300009802|Ga0105073_1020737 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300009806|Ga0105081_1002514 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
3300009807|Ga0105061_1040127 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300009813|Ga0105057_1107562 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010048|Ga0126373_12600372 | Not Available | 564 | Open in IMG/M |
3300010359|Ga0126376_10465539 | Not Available | 1160 | Open in IMG/M |
3300010362|Ga0126377_11238336 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300011271|Ga0137393_10001174 | All Organisms → cellular organisms → Bacteria | 16490 | Open in IMG/M |
3300011406|Ga0137454_1021557 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300011414|Ga0137442_1022693 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300011419|Ga0137446_1031053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1136 | Open in IMG/M |
3300011427|Ga0137448_1146994 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300011433|Ga0137443_1121717 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300012034|Ga0137453_1031532 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300012133|Ga0137329_1023571 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012157|Ga0137353_1044505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
3300012204|Ga0137374_10017940 | All Organisms → cellular organisms → Bacteria | 8089 | Open in IMG/M |
3300012226|Ga0137447_1021364 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300012353|Ga0137367_10325027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1098 | Open in IMG/M |
3300012909|Ga0157290_10290365 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
3300012922|Ga0137394_10017030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5778 | Open in IMG/M |
3300012922|Ga0137394_10054087 | All Organisms → cellular organisms → Bacteria | 3320 | Open in IMG/M |
3300012925|Ga0137419_11961345 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012929|Ga0137404_10020173 | All Organisms → cellular organisms → Bacteria | 4796 | Open in IMG/M |
3300012930|Ga0137407_10115768 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
3300012931|Ga0153915_10361791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1634 | Open in IMG/M |
3300012931|Ga0153915_10952992 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 999 | Open in IMG/M |
3300012944|Ga0137410_10011750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5938 | Open in IMG/M |
3300012958|Ga0164299_11046027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
3300013102|Ga0157371_10750114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 733 | Open in IMG/M |
3300013102|Ga0157371_10933991 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300014262|Ga0075301_1010837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1408 | Open in IMG/M |
3300014497|Ga0182008_10785606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
3300015262|Ga0182007_10106524 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300015372|Ga0132256_101304619 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300017930|Ga0187825_10054940 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300017930|Ga0187825_10201243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
3300017939|Ga0187775_10500461 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300017997|Ga0184610_1000844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6866 | Open in IMG/M |
3300018000|Ga0184604_10085736 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300018028|Ga0184608_10056004 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
3300018031|Ga0184634_10029186 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
3300018052|Ga0184638_1123764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 944 | Open in IMG/M |
3300018056|Ga0184623_10397568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
3300018059|Ga0184615_10196455 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300018061|Ga0184619_10070398 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300018063|Ga0184637_10044622 | All Organisms → cellular organisms → Bacteria | 2697 | Open in IMG/M |
3300018070|Ga0184631_10248839 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300018071|Ga0184618_10080211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
3300018076|Ga0184609_10065987 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300018084|Ga0184629_10388514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
3300018084|Ga0184629_10518934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
3300018422|Ga0190265_10035286 | All Organisms → cellular organisms → Bacteria | 4205 | Open in IMG/M |
3300018422|Ga0190265_10036883 | All Organisms → cellular organisms → Bacteria | 4127 | Open in IMG/M |
3300018422|Ga0190265_10047118 | All Organisms → cellular organisms → Bacteria | 3729 | Open in IMG/M |
3300018422|Ga0190265_10134499 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
3300018422|Ga0190265_10395570 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300018429|Ga0190272_10107352 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
3300018429|Ga0190272_10906881 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300019259|Ga0184646_1603141 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300019360|Ga0187894_10084895 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
3300019458|Ga0187892_10002496 | All Organisms → cellular organisms → Bacteria | 36590 | Open in IMG/M |
3300019458|Ga0187892_10015461 | All Organisms → cellular organisms → Bacteria | 8279 | Open in IMG/M |
3300019487|Ga0187893_10120656 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
3300019487|Ga0187893_10641463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300019879|Ga0193723_1008504 | All Organisms → cellular organisms → Bacteria | 3346 | Open in IMG/M |
3300019879|Ga0193723_1112682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 760 | Open in IMG/M |
3300019880|Ga0193712_1065300 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300020060|Ga0193717_1188341 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300020060|Ga0193717_1191215 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
3300020061|Ga0193716_1066913 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300021081|Ga0210379_10072507 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300021081|Ga0210379_10156336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 971 | Open in IMG/M |
3300021090|Ga0210377_10014480 | All Organisms → cellular organisms → Bacteria | 5954 | Open in IMG/M |
3300022534|Ga0224452_1182124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
3300022694|Ga0222623_10426483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 503 | Open in IMG/M |
3300023072|Ga0247799_1096161 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300025324|Ga0209640_11253516 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300025551|Ga0210131_1018444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1005 | Open in IMG/M |
3300025885|Ga0207653_10230621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 705 | Open in IMG/M |
3300025910|Ga0207684_10002173 | All Organisms → cellular organisms → Bacteria | 20069 | Open in IMG/M |
3300025910|Ga0207684_10099517 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
3300025910|Ga0207684_10139316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2085 | Open in IMG/M |
3300025933|Ga0207706_10049074 | All Organisms → cellular organisms → Bacteria | 3731 | Open in IMG/M |
3300025935|Ga0207709_10866697 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300025965|Ga0210090_1001084 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
3300025972|Ga0207668_12057180 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300025999|Ga0208417_101721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 884 | Open in IMG/M |
3300026001|Ga0208000_102964 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300026005|Ga0208285_1000898 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300026285|Ga0209438_1000442 | All Organisms → cellular organisms → Bacteria | 12628 | Open in IMG/M |
3300026285|Ga0209438_1019282 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
3300026285|Ga0209438_1099135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 887 | Open in IMG/M |
3300026320|Ga0209131_1003627 | All Organisms → cellular organisms → Bacteria | 10231 | Open in IMG/M |
3300026497|Ga0257164_1084752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
3300026535|Ga0256867_10012335 | All Organisms → cellular organisms → Bacteria | 3728 | Open in IMG/M |
3300027651|Ga0209217_1131726 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10139240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
3300027873|Ga0209814_10562837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
3300027875|Ga0209283_10012140 | All Organisms → cellular organisms → Bacteria | 5133 | Open in IMG/M |
3300027909|Ga0209382_11097597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 822 | Open in IMG/M |
3300027910|Ga0209583_10334549 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300028380|Ga0268265_10181078 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300028589|Ga0247818_10256947 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300028792|Ga0307504_10008508 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
3300028828|Ga0307312_10403814 | Not Available | 897 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10030351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10163387 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1062292 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 896 | Open in IMG/M |
3300031720|Ga0307469_10223240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1492 | Open in IMG/M |
3300031720|Ga0307469_10401150 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1171 | Open in IMG/M |
3300032017|Ga0310899_10665385 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300032174|Ga0307470_11638378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
3300032174|Ga0307470_11842401 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300032180|Ga0307471_100175560 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
3300032770|Ga0335085_10014527 | All Organisms → cellular organisms → Bacteria | 11477 | Open in IMG/M |
3300033432|Ga0326729_1003631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3078 | Open in IMG/M |
3300033433|Ga0326726_10041442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4020 | Open in IMG/M |
3300033480|Ga0316620_10365634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1291 | Open in IMG/M |
3300033486|Ga0316624_10234457 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300033501|Ga0326732_1040176 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300033502|Ga0326731_1039316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1120 | Open in IMG/M |
3300033513|Ga0316628_100105418 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.96% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.96% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.37% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.37% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.78% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.78% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.78% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.18% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.18% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.18% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.18% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.18% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.18% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.18% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.18% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.59% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.59% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.59% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.59% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.59% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Host-Associated | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
3300012133 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2 | Environmental | Open in IMG/M |
3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025999 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026001 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 (SPAdes) | Environmental | Open in IMG/M |
3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_00934660 | 2088090015 | Soil | MSFVLRILAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG |
F24TB_103183843 | 3300000550 | Soil | MTFALRVLAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVFPRA* |
JGI10216J12902_1189624361 | 3300000956 | Soil | MTFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPGVLPRS* |
JGI26141J51220_10063292 | 3300003503 | Arabidopsis Thaliana Rhizosphere | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGGGRPAARLASGL* |
Ga0055500_100022152 | 3300004062 | Natural And Restored Wetlands | MSFALRILAVIVFVLAVAGVASPVPMTPLGLALWCASTLPPGSGAHSS* |
Ga0062593_1000074552 | 3300004114 | Soil | MSFVLRILAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG* |
Ga0062593_1016679161 | 3300004114 | Soil | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVVPPRA* |
Ga0066397_100850451 | 3300004281 | Tropical Forest Soil | MSFVLRVLAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVVPRA* |
Ga0063356_1016840071 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ILAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG* |
Ga0062592_1011237331 | 3300004480 | Soil | VRAHLWRCRMTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVVPPRA* |
Ga0062594_1000459993 | 3300005093 | Soil | MSFVLRVLAVIAFVVATLGVASPVLLTPLGLALWCASTLPLG |
Ga0065705_106148291 | 3300005294 | Switchgrass Rhizosphere | MSFVLRVLAVIAFVVATLGVASPVLLTPLGLALWCASTLPLGGGRSS* |
Ga0065707_111368952 | 3300005295 | Switchgrass Rhizosphere | MSFALRILAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGFRLG* |
Ga0070676_114137472 | 3300005328 | Miscanthus Rhizosphere | MSFALRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRSI* |
Ga0070691_101134782 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRILAVVVFVLAVAGVAPVPMTPLGLALWCASTLPPGGASSPS* |
Ga0070692_110193962 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | TFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVVPPRA* |
Ga0070709_112414702 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPVGASSAT* |
Ga0070705_1007076331 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRTTST* |
Ga0070694_1015700112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRVLAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGFRLG* |
Ga0070706_1000150778 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIALRIAAMIVFVLATVGVAPVPMTPLGLALWCASTLVR* |
Ga0070699_1004186252 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPP |
Ga0073909_104983031 | 3300005526 | Surface Soil | MSYALRILAVIAFVLAVAGVAPVPMTPLGLALWCASTLPPRGAASAS* |
Ga0070684_1000438151 | 3300005535 | Corn Rhizosphere | RRSGMSFVLRILAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG* |
Ga0070693_1007123632 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGR |
Ga0075297_10119432 | 3300005878 | Rice Paddy Soil | MSFALRVLAVVVFVLAVAGVAPVPMTPLGLALWCASTLPPRGASSAS* |
Ga0075295_10163492 | 3300005879 | Rice Paddy Soil | MSFALRILAVVVFVLAVAGVAPVPMTPLGLALWCASTLPPRGASSAS* |
Ga0081455_100017265 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPSPLPRA* |
Ga0081455_104328922 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSFALRVLAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVFPRA* |
Ga0081539_101076063 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MSFVLRILAVIVFVVAVAGVAPVPMTPLGLALWCASTLVPGTSA* |
Ga0075023_1003632622 | 3300006041 | Watersheds | MSFALRILAVIVFVLAVAGVTAVPMMPLGLALWCASTLPPRTASA* |
Ga0070715_102088392 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPSGASSAT* |
Ga0075421_1017073482 | 3300006845 | Populus Rhizosphere | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPPSGAHPG* |
Ga0075425_1023531602 | 3300006854 | Populus Rhizosphere | SFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPGSASSAT* |
Ga0075429_1004353382 | 3300006880 | Populus Rhizosphere | MSFVLRILAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRAS |
Ga0068865_1006251821 | 3300006881 | Miscanthus Rhizosphere | LAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRSI* |
Ga0075436_1003149192 | 3300006914 | Populus Rhizosphere | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPGSASSAT* |
Ga0079219_111020462 | 3300006954 | Agricultural Soil | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPVG |
Ga0075435_1012443442 | 3300007076 | Populus Rhizosphere | SFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPVGASSAT* |
Ga0099791_104768562 | 3300007255 | Vadose Zone Soil | MSFALRVLAVIAFVLATLGVASPVLLTPLGLALWCASTLPLRGGVRLG* |
Ga0099829_100017094 | 3300009038 | Vadose Zone Soil | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRSGAHPS* |
Ga0099830_102056045 | 3300009088 | Vadose Zone Soil | MSIALRIAAMIVFALATVGVAPVPMTPLGLALWCASTLVR* |
Ga0099830_102632442 | 3300009088 | Vadose Zone Soil | MSIALRIAAMIVFVLATAGVAPVPMTPLGLTLWCASTLVR* |
Ga0099828_100079522 | 3300009089 | Vadose Zone Soil | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSGAHPS* |
Ga0099828_100093573 | 3300009089 | Vadose Zone Soil | MSIAPRIAAMIVFVLATAGVAPVPMTPLGLTLWCASTLVR* |
Ga0066709_1030705262 | 3300009137 | Grasslands Soil | MSLALRILAVVVFLLAVAGVAPVPMTPLGLALWCASTLPLRGSLT* |
Ga0105059_10047172 | 3300009795 | Groundwater Sand | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRTAST* |
Ga0105073_10207372 | 3300009802 | Groundwater Sand | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRSGAHPG* |
Ga0105081_10025142 | 3300009806 | Groundwater Sand | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASMLPPRTAST* |
Ga0105061_10401272 | 3300009807 | Groundwater Sand | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRTASS* |
Ga0105057_11075621 | 3300009813 | Groundwater Sand | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPGGGHSS* |
Ga0126373_126003722 | 3300010048 | Tropical Forest Soil | IVAVVVFILATAGVAPVPMTPLGLALWCGSTLVP* |
Ga0126376_104655394 | 3300010359 | Tropical Forest Soil | RIVAVVVFVLATVGVAPVPMTPLGSRWCGSTLVP* |
Ga0126377_112383361 | 3300010362 | Tropical Forest Soil | MSFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGAVPPRA* |
Ga0137393_100011747 | 3300011271 | Vadose Zone Soil | MSFALRILAVIVFILAVAGVAPVPMTPLGLAVWCASTLPPRSGAHPS* |
Ga0137454_10215572 | 3300011406 | Soil | MSFALRILAVIVFILAVAGVASPVLMTPLGLALWCASTLPLGGGGRLS* |
Ga0137442_10226932 | 3300011414 | Soil | MSFALRVLAVIAFVVATLGVASPVLMTPLGLALWCASTLPPRSGAHPS* |
Ga0137446_10310533 | 3300011419 | Soil | MSFALRVLAVIAFVVATIGVASPVLMTPLGLALWCASTLPLGGGRSS* |
Ga0137448_11469942 | 3300011427 | Soil | MSFALRILAVIVFILAVAGVASPVLMTPLGLALWCASTLPPRSGAHPS* |
Ga0137443_11217172 | 3300011433 | Soil | MSFALRVLAGIAFVVATLGVASPVLLTPLGLALWCASTLPLGGGRSS* |
Ga0137453_10315321 | 3300012034 | Soil | MSFALRVLAVIAFVVATLGVASPVLMTPLGLALWCASTLPLGG |
Ga0137329_10235711 | 3300012133 | Soil | MSFALRILAVIVFILAVAGVASPVLMTPLGLALWCA |
Ga0137353_10445052 | 3300012157 | Soil | MSFALRILAVIAFVVATIGVASPVLMTPLGLALWCASTLPPPGGSRSS* |
Ga0137374_1001794010 | 3300012204 | Vadose Zone Soil | MSIALRIAAILLFFLATAGVAPVPMTPLGLALWCASTLVR* |
Ga0137447_10213641 | 3300012226 | Soil | MSFALRVLAVIAFVVATLGVASPVLMTPLGLALWCASTLPLGGGGRLS* |
Ga0137367_103250271 | 3300012353 | Vadose Zone Soil | MSIALRIAAILLFILATAGVAPVPMTPLGLALWCASTLVR* |
Ga0157290_102903651 | 3300012909 | Soil | MTFTLRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVVPPRA* |
Ga0137394_100170303 | 3300012922 | Vadose Zone Soil | MSFVLRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRWI* |
Ga0137394_100540873 | 3300012922 | Vadose Zone Soil | MSFALRILAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGLRLG* |
Ga0137419_119613451 | 3300012925 | Vadose Zone Soil | MSFVLRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGLRSI* |
Ga0137404_100201734 | 3300012929 | Vadose Zone Soil | MSFALRVLAVIAFVVAALAVASPVLLTPLGLALWCASTLPLGGGRWI* |
Ga0137407_101157683 | 3300012930 | Vadose Zone Soil | MSFALRVLAVIAFVVAALAVASPVLLTPLGLALWCASTLPLGGGRSI* |
Ga0153915_103617914 | 3300012931 | Freshwater Wetlands | MSFALRILAVIVFVLAVAGVASVPMTPLGLALWCASTLPPRGASRAS* |
Ga0153915_109529922 | 3300012931 | Freshwater Wetlands | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPHGASSAG* |
Ga0137410_100117503 | 3300012944 | Vadose Zone Soil | MSFALRILAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGVRLG* |
Ga0164299_110460271 | 3300012958 | Soil | LAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG* |
Ga0157371_107501142 | 3300013102 | Corn Rhizosphere | MSFVLRLLAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG* |
Ga0157371_109339912 | 3300013102 | Corn Rhizosphere | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGV |
Ga0075301_10108372 | 3300014262 | Natural And Restored Wetlands | MSFALRILAVIVFVLAVAGVASPVPMTPLGLALWCASTLPPGSGTHSS* |
Ga0182008_107856061 | 3300014497 | Rhizosphere | VLRILAVIVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG* |
Ga0182007_101065242 | 3300015262 | Rhizosphere | MSFVLRILAVVVFVVAVAGVAPVPMTPLGLAPWCASTLVPRASALG* |
Ga0132256_1013046191 | 3300015372 | Arabidopsis Rhizosphere | MSYALRILAVIAFVLAVAGVAPVPMTPLGLALWCASTLPPRGASSAS* |
Ga0187825_100549402 | 3300017930 | Freshwater Sediment | MSYALRILAVIAFVLAVAGVAPVPMTPLGLALWCASTLPPRGASSAS |
Ga0187825_102012432 | 3300017930 | Freshwater Sediment | MSYALRIVAVIAFVLAVAGVAPGPMTPLGLALWCASTLPPRGASRAS |
Ga0187775_105004612 | 3300017939 | Tropical Peatland | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRPVSHS |
Ga0184610_10008442 | 3300017997 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSGAHPS |
Ga0184604_100857362 | 3300018000 | Groundwater Sediment | MSFALRVLAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGFRLG |
Ga0184608_100560042 | 3300018028 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPESGAHPS |
Ga0184634_100291863 | 3300018031 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRSGAHPS |
Ga0184638_11237642 | 3300018052 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRSGAHSS |
Ga0184623_103975682 | 3300018056 | Groundwater Sediment | AVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSGAHPS |
Ga0184615_101964551 | 3300018059 | Groundwater Sediment | MSFALRILAVIVFVLAVAGVATVPMIPLGLALWCAST |
Ga0184619_100703983 | 3300018061 | Groundwater Sediment | MSFALRVLAVIAFVLATLGVATPVLLTPLGLALWCASTLPLGGGFRLG |
Ga0184637_100446222 | 3300018063 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPAVPMTPLGLALWCASTLPPRPAST |
Ga0184631_102488392 | 3300018070 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPLGGGRSS |
Ga0184618_100802113 | 3300018071 | Groundwater Sediment | VIAFVLATLGVATPVLLTPLGLALWCASTLPLGGGFRLG |
Ga0184609_100659873 | 3300018076 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSGAHPR |
Ga0184629_103885142 | 3300018084 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRSGTHPS |
Ga0184629_105189342 | 3300018084 | Groundwater Sediment | MSFALRILAVIVFILAVASVAPVQMTPLGLALWCASALPPRSGAHPS |
Ga0190265_100352865 | 3300018422 | Soil | MSFALRILAVVVFVLAVAGVAPVPMTPLGLALWCASTLPPGSGAHSS |
Ga0190265_100368834 | 3300018422 | Soil | MRGPSFMLRVAAVVVFVLAVAGVAPVPMTPLGLALWCGSTLVP |
Ga0190265_100471183 | 3300018422 | Soil | MSFALRILAVIAFVLATIGVASPVLLTPLGLALWCASTLPLGGAGRWS |
Ga0190265_101344993 | 3300018422 | Soil | MRGPSFLLRVAAVVVFVLAVAGVAPVPMTPLGLALWCGSTLVP |
Ga0190265_103955703 | 3300018422 | Soil | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRTGAHPT |
Ga0190272_101073525 | 3300018429 | Soil | LAVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSGAHPS |
Ga0190272_109068812 | 3300018429 | Soil | MSFALRVLAVIAFVVATLGVASPVLLTPLGLALWCASTLPLGGGRL |
Ga0184646_16031411 | 3300019259 | Groundwater Sediment | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSG |
Ga0187894_100848951 | 3300019360 | Microbial Mat On Rocks | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRSGAHPG |
Ga0187892_100024969 | 3300019458 | Bio-Ooze | MSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRTAST |
Ga0187892_1001546110 | 3300019458 | Bio-Ooze | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRSGAHSS |
Ga0187893_101206561 | 3300019487 | Microbial Mat On Rocks | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLP |
Ga0187893_106414631 | 3300019487 | Microbial Mat On Rocks | RMSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRSGAHPG |
Ga0193723_10085041 | 3300019879 | Soil | MSFVLRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRSS |
Ga0193723_11126821 | 3300019879 | Soil | AFVLAALGVASPVLLTPLGLALWCASTLPLGGGFRLG |
Ga0193712_10653002 | 3300019880 | Soil | MSFALRILAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGFRLG |
Ga0193717_11883412 | 3300020060 | Soil | MSFALRVLAVIAFVVATIGVASPVLMTPLGLALWCAS |
Ga0193717_11912152 | 3300020060 | Soil | MSFALRVLAVIAFVVATIGVASPVLMTPLGLALWCASTLPLGGGGRLS |
Ga0193716_10669132 | 3300020061 | Soil | MSFALRILAVIAFVVATLGVASPVLLTPLGLALWCASTLPLGGGRL |
Ga0210379_100725071 | 3300021081 | Groundwater Sediment | MSFALRILAVIVFILAVAGVASPVLMTPLGLALWCASTLPPRSGAHPS |
Ga0210379_101563363 | 3300021081 | Groundwater Sediment | RVSMSFALRILAVIVFILAVAGVASPVLMTPLGLALWCASTLPPRSGAHPS |
Ga0210377_100144804 | 3300021090 | Groundwater Sediment | MSFALRILAVIAFVVATIGVASPVLMTPLGLALWCASTLPLGGGRSS |
Ga0224452_11821241 | 3300022534 | Groundwater Sediment | VSMSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPQSGAHPS |
Ga0222623_104264832 | 3300022694 | Groundwater Sediment | ALRVLAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGFRLG |
Ga0247799_10961611 | 3300023072 | Soil | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCAST |
Ga0209640_112535162 | 3300025324 | Soil | MSFALRILAVIVFVLAVAGVATVPMIPLGLALWCASTLPPRTTSS |
Ga0210131_10184442 | 3300025551 | Natural And Restored Wetlands | MSFALRILAVIVFVLAVAGVASPVPMTPLGLALWCASTLPPGSGTHSS |
Ga0207653_102306211 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | RVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRSI |
Ga0207684_1000217319 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRTTST |
Ga0207684_100995174 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPSGASSAT |
Ga0207684_101393166 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIALRIAAMIVFVLATVGVAPVPMTPLGLALWCASTLVR |
Ga0207706_100490744 | 3300025933 | Corn Rhizosphere | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVVPPRA |
Ga0207709_108666971 | 3300025935 | Miscanthus Rhizosphere | SFVLRILAVVVFVVAVAGVAPVPMTPLGLALWCASTLVPRASALG |
Ga0210090_10010844 | 3300025965 | Natural And Restored Wetlands | MSFALRILAVIVFVLAVAGVASPVPMTPLGLALWCASTLPPGSGAHSS |
Ga0207668_120571802 | 3300025972 | Switchgrass Rhizosphere | MSFALRVLAVIAFVVAALGVASPVLLTPLGLALWC |
Ga0208417_1017212 | 3300025999 | Rice Paddy Soil | AVVVFVLAVAGVAPVPMTPLGLALWCASTLPPGGASSPS |
Ga0208000_1029642 | 3300026001 | Rice Paddy Soil | MSFVLRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRGASSAS |
Ga0208285_10008982 | 3300026005 | Rice Paddy Soil | MSFALRILAVVVFVLAVAGVAPVPMTPLGLALWCASTLPPGGASSPS |
Ga0209438_100044212 | 3300026285 | Grasslands Soil | MSFVLRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRWI |
Ga0209438_10192821 | 3300026285 | Grasslands Soil | MSFALRILAVIAFVLATLGVASPVLLTPLGLALWCASTLPLGGGLRLG |
Ga0209438_10991352 | 3300026285 | Grasslands Soil | MRISMSFALRILAVIAFVLATLGVASSVLLTPLGLALWCASTLPLGGGVRLG |
Ga0209131_10036271 | 3300026320 | Grasslands Soil | MSFALRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGLRSI |
Ga0257164_10847522 | 3300026497 | Soil | VSMSFALRILAVIVFILAVAGVAPVPMTPLGLALWCASTLPPRSGAHPS |
Ga0256867_100123356 | 3300026535 | Soil | MSFALRILAVIAFVAATIGIASPVLLTPLGLALWCASTLPLGSGTRWT |
Ga0209217_11317262 | 3300027651 | Forest Soil | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPGGA |
(restricted) Ga0233416_101392402 | 3300027799 | Sediment | MSFALRILAVVVFVLAVAGVGPMHMMTPLGLALWCASTLPPRSGAHPG |
Ga0209814_105628372 | 3300027873 | Populus Rhizosphere | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPGSASSAT |
Ga0209283_100121406 | 3300027875 | Vadose Zone Soil | MSIAPRIAAMIVFVLATAGVAPVPMTPLGLTLWCASTLVR |
Ga0209382_110975972 | 3300027909 | Populus Rhizosphere | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPPSGAHPG |
Ga0209583_103345491 | 3300027910 | Watersheds | MSFALRILAVIVFVLAVAGVTAVPMMPLGLALWCASTLPPRTASA |
Ga0268265_101810782 | 3300028380 | Switchgrass Rhizosphere | MSFALRVLAVIAFVVAALGVASPVLLTPLGLALWCASTLPLGGGRSI |
Ga0247818_102569472 | 3300028589 | Soil | MSFVLRILAVVVFVVAVAGVAPVPMTPLGLALWCASTLV |
Ga0307504_100085083 | 3300028792 | Soil | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRTAST |
Ga0307312_104038143 | 3300028828 | Soil | MRGRSFMLRVAAVVVFILATVGVAPVPMTPLGLALWCGSTLVP |
(restricted) Ga0255310_100303511 | 3300031197 | Sandy Soil | ILAVIVFVLAVAGVTAVPMMPLGLALWCASTLPPRTASA |
(restricted) Ga0255310_101633872 | 3300031197 | Sandy Soil | MSFALRILAVIAFVVATIGVASPVLMTPLGLALWCASTLAPGDGARSS |
(restricted) Ga0255312_10622923 | 3300031248 | Sandy Soil | RILAVIVFVLAVAGVAPVPMTPLGIALWCASTLPPRSGAHPG |
Ga0307469_102232403 | 3300031720 | Hardwood Forest Soil | MTFALRVLAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVFPRA |
Ga0307469_104011502 | 3300031720 | Hardwood Forest Soil | MSFVLRVLAVIAFVAAALGVASPVLLTPLGLALWCASTLPLGGGRLS |
Ga0310899_106653852 | 3300032017 | Soil | MTFALRILAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGAVPPRA |
Ga0307470_116383782 | 3300032174 | Hardwood Forest Soil | QHRRCRKSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPRTTST |
Ga0307470_118424012 | 3300032174 | Hardwood Forest Soil | MTFALRVLAVIVFVLATVGVAPVPMTPLGLALWCASTLPPGVFP |
Ga0307471_1001755601 | 3300032180 | Hardwood Forest Soil | MSFALRVLAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPGGASSAT |
Ga0335085_100145273 | 3300032770 | Soil | VSFALRILAVIVFVLAVGGVAPVPMTPLGLALWCASTLPPHPAAHS |
Ga0326729_10036312 | 3300033432 | Peat Soil | MSFALRILAVIAFVLAVAGVAPVPMTPLGLALWCASTLPPRGAPGAS |
Ga0326726_100414424 | 3300033433 | Peat Soil | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPHGASSAS |
Ga0316620_103656343 | 3300033480 | Soil | MSFALRILAVVVFVLAVAGVAPVPMTPLGLALWCASTLPPHGASSAG |
Ga0316624_102344572 | 3300033486 | Soil | MSFALRILAVIVFVLAVAGVAPVPMTPLGLALWCASTLPPHGASSAG |
Ga0326732_10401761 | 3300033501 | Peat Soil | MSFALRILAVIAFVLAVAGVAPVPMTPLGLALWCASTL |
Ga0326731_10393161 | 3300033502 | Peat Soil | AVIAFVLAVAGVAPVPMTPLGLALWCASTLPPRGAPGAS |
Ga0316628_1001054184 | 3300033513 | Soil | MSFALRILAVIVFVLAVAGVASVPMTPLGLALWCASTLPPRGASRAS |
⦗Top⦘ |