NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F036957

Metagenome Family F036957

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036957
Family Type Metagenome
Number of Sequences 169
Average Sequence Length 43 residues
Representative Sequence MLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVA
Number of Associated Samples 131
Number of Associated Scaffolds 169

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.34 %
% of genes near scaffold ends (potentially truncated) 92.90 %
% of genes from short scaffolds (< 2000 bps) 89.35 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.089 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(10.059 % of family members)
Environment Ontology (ENVO) Unclassified
(23.077 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.379 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 53.52%    β-sheet: 0.00%    Coil/Unstructured: 46.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 169 Family Scaffolds
PF14023DUF4239 11.24
PF17201Cache_3-Cache_2 7.10
PF069833-dmu-9_3-mt 6.51
PF07366SnoaL 3.55
PF00583Acetyltransf_1 2.37
PF16694Cytochrome_P460 2.37
PF00903Glyoxalase 1.78
PF00248Aldo_ket_red 1.78
PF12681Glyoxalase_2 1.78
PF00724Oxidored_FMN 1.78
PF17200sCache_2 1.78
PF00199Catalase 1.18
PF01546Peptidase_M20 1.18
PF09351DUF1993 1.18
PF00226DnaJ 1.18
PF02203TarH 0.59
PF00106adh_short 0.59
PF00581Rhodanese 0.59
PF13376OmdA 0.59
PF00107ADH_zinc_N 0.59
PF07509DUF1523 0.59
PF00027cNMP_binding 0.59
PF03601Cons_hypoth698 0.59
PF13302Acetyltransf_3 0.59
PF07486Hydrolase_2 0.59
PF13360PQQ_2 0.59
PF02634FdhD-NarQ 0.59
PF02517Rce1-like 0.59
PF13407Peripla_BP_4 0.59
PF00551Formyl_trans_N 0.59
PF07883Cupin_2 0.59
PF14248DUF4345 0.59
PF08240ADH_N 0.59
PF11755DUF3311 0.59
PF03350UPF0114 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 169 Family Scaffolds
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 6.51
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 6.51
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 1.78
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 1.78
COG0753CatalaseInorganic ion transport and metabolism [P] 1.18
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 1.18
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.59
COG1526Formate dehydrogenase assembly factor FdhD, a sulfurtransferaseEnergy production and conversion [C] 0.59
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.59
COG2862Uncharacterized membrane protein YqhAFunction unknown [S] 0.59
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 0.59
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.27 %
UnclassifiedrootN/A33.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105600306All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300000787|JGI11643J11755_11391875All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300000891|JGI10214J12806_10182251All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300000955|JGI1027J12803_100634090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1627Open in IMG/M
3300000955|JGI1027J12803_100878886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2211Open in IMG/M
3300000956|JGI10216J12902_115475003Not Available674Open in IMG/M
3300002239|JGI24034J26672_10105140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria535Open in IMG/M
3300004157|Ga0062590_102461421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris551Open in IMG/M
3300004463|Ga0063356_104357733All Organisms → cellular organisms → Bacteria → Proteobacteria609Open in IMG/M
3300004479|Ga0062595_102584029All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300004480|Ga0062592_100141428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1591Open in IMG/M
3300004480|Ga0062592_102718786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae501Open in IMG/M
3300005332|Ga0066388_103000685All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300005332|Ga0066388_105246197Not Available657Open in IMG/M
3300005332|Ga0066388_105454281All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300005332|Ga0066388_105980552All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005332|Ga0066388_107998956Not Available529Open in IMG/M
3300005332|Ga0066388_108640251Not Available506Open in IMG/M
3300005343|Ga0070687_100038827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2388Open in IMG/M
3300005365|Ga0070688_100337426All Organisms → cellular organisms → Bacteria → Proteobacteria1100Open in IMG/M
3300005365|Ga0070688_100596697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300005434|Ga0070709_10032755All Organisms → cellular organisms → Bacteria → Proteobacteria3136Open in IMG/M
3300005436|Ga0070713_101215231All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300005439|Ga0070711_100168691All Organisms → cellular organisms → Bacteria → Proteobacteria1666Open in IMG/M
3300005439|Ga0070711_101534447Not Available582Open in IMG/M
3300005455|Ga0070663_100368653All Organisms → cellular organisms → Bacteria → Proteobacteria1167Open in IMG/M
3300005546|Ga0070696_100850907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria754Open in IMG/M
3300005547|Ga0070693_100415068All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300005563|Ga0068855_100513692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1300Open in IMG/M
3300005564|Ga0070664_101180940All Organisms → cellular organisms → Bacteria → Proteobacteria722Open in IMG/M
3300005564|Ga0070664_101699538All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M
3300005577|Ga0068857_101403843All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300005719|Ga0068861_100016959Not Available5164Open in IMG/M
3300005764|Ga0066903_101174643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1422Open in IMG/M
3300005834|Ga0068851_10305282Not Available916Open in IMG/M
3300005843|Ga0068860_101319175All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300005844|Ga0068862_100191249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1842Open in IMG/M
3300006050|Ga0075028_101070423All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300006163|Ga0070715_10014379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2930Open in IMG/M
3300006172|Ga0075018_10558477Not Available604Open in IMG/M
3300006196|Ga0075422_10581562All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300006354|Ga0075021_10757458All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300006844|Ga0075428_101672371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria664Open in IMG/M
3300006845|Ga0075421_102712175Not Available512Open in IMG/M
3300006852|Ga0075433_10423732All Organisms → cellular organisms → Bacteria → Proteobacteria1174Open in IMG/M
3300006852|Ga0075433_11855614Not Available518Open in IMG/M
3300006852|Ga0075433_11901697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta510Open in IMG/M
3300006853|Ga0075420_101333368All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300006854|Ga0075425_101759065All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300006871|Ga0075434_102155533All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300006880|Ga0075429_100534061All Organisms → cellular organisms → Bacteria → Proteobacteria1028Open in IMG/M
3300006880|Ga0075429_101955968All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter508Open in IMG/M
3300006904|Ga0075424_102165338Not Available585Open in IMG/M
3300006904|Ga0075424_102717269All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300009092|Ga0105250_10433289All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300009098|Ga0105245_12999230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae523Open in IMG/M
3300009100|Ga0075418_13081590All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009147|Ga0114129_11004155All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300009147|Ga0114129_12235406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium658Open in IMG/M
3300009162|Ga0075423_11244690All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300009545|Ga0105237_10192843All Organisms → cellular organisms → Bacteria2037Open in IMG/M
3300009545|Ga0105237_11575863Not Available664Open in IMG/M
3300009678|Ga0105252_10366142Not Available656Open in IMG/M
3300010046|Ga0126384_10027793All Organisms → cellular organisms → Bacteria → Proteobacteria3725Open in IMG/M
3300010046|Ga0126384_10712191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales890Open in IMG/M
3300010046|Ga0126384_11915759All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010047|Ga0126382_10254172Not Available1290Open in IMG/M
3300010047|Ga0126382_11046609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales719Open in IMG/M
3300010048|Ga0126373_11287688Not Available797Open in IMG/M
3300010358|Ga0126370_10366735Not Available1170Open in IMG/M
3300010358|Ga0126370_12426429Not Available521Open in IMG/M
3300010359|Ga0126376_10474040Not Available1151Open in IMG/M
3300010362|Ga0126377_13139946All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010366|Ga0126379_11273730Not Available841Open in IMG/M
3300010371|Ga0134125_11769995All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300010373|Ga0134128_10094005All Organisms → cellular organisms → Bacteria → Proteobacteria3410Open in IMG/M
3300010373|Ga0134128_10578697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1250Open in IMG/M
3300010373|Ga0134128_11289068All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300010373|Ga0134128_12383936Not Available583Open in IMG/M
3300010398|Ga0126383_11581839Not Available745Open in IMG/M
3300010403|Ga0134123_10086266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2461Open in IMG/M
3300010403|Ga0134123_11095726All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300010403|Ga0134123_12393761All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300011406|Ga0137454_1030031Not Available788Open in IMG/M
3300012494|Ga0157341_1020613All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012505|Ga0157339_1052739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta543Open in IMG/M
3300012507|Ga0157342_1015089Not Available842Open in IMG/M
3300012507|Ga0157342_1085090All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012519|Ga0157352_1059852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium590Open in IMG/M
3300012896|Ga0157303_10205393Not Available571Open in IMG/M
3300012897|Ga0157285_10008895All Organisms → cellular organisms → Bacteria → Proteobacteria1917Open in IMG/M
3300012897|Ga0157285_10023380All Organisms → cellular organisms → Bacteria → Proteobacteria1335Open in IMG/M
3300012898|Ga0157293_10150419Not Available657Open in IMG/M
3300012901|Ga0157288_10266946All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012911|Ga0157301_10020010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1467Open in IMG/M
3300012951|Ga0164300_10067596All Organisms → cellular organisms → Bacteria → Proteobacteria1473Open in IMG/M
3300012955|Ga0164298_10667048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria724Open in IMG/M
3300012955|Ga0164298_10733657Not Available698Open in IMG/M
3300012957|Ga0164303_10817444Not Available643Open in IMG/M
3300012957|Ga0164303_10846085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300012960|Ga0164301_10020599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2944Open in IMG/M
3300012961|Ga0164302_10002018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi6647Open in IMG/M
3300012961|Ga0164302_10315371Not Available1028Open in IMG/M
3300012971|Ga0126369_10839348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300012986|Ga0164304_11825798Not Available509Open in IMG/M
3300013307|Ga0157372_11272193Not Available849Open in IMG/M
3300015371|Ga0132258_12438109All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300015372|Ga0132256_101833222All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300015372|Ga0132256_102636296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium603Open in IMG/M
3300016319|Ga0182033_11966461Not Available532Open in IMG/M
3300016341|Ga0182035_11111549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium704Open in IMG/M
3300018052|Ga0184638_1216930Not Available669Open in IMG/M
3300018053|Ga0184626_10441116Not Available514Open in IMG/M
3300018061|Ga0184619_10331289Not Available695Open in IMG/M
3300018064|Ga0187773_11052535Not Available537Open in IMG/M
3300018481|Ga0190271_10107782All Organisms → cellular organisms → Bacteria2586Open in IMG/M
3300018481|Ga0190271_11743969Not Available735Open in IMG/M
3300021478|Ga0210402_10899285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales812Open in IMG/M
3300021478|Ga0210402_10959351All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300021478|Ga0210402_11980831Not Available508Open in IMG/M
3300021560|Ga0126371_12778815Not Available593Open in IMG/M
3300021560|Ga0126371_13535283Not Available527Open in IMG/M
3300022694|Ga0222623_10381583All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300025735|Ga0207713_1139107All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300025900|Ga0207710_10027867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2450Open in IMG/M
3300025905|Ga0207685_10084010All Organisms → cellular organisms → Bacteria → Proteobacteria1325Open in IMG/M
3300025912|Ga0207707_10454264Not Available1096Open in IMG/M
3300025916|Ga0207663_10261874All Organisms → cellular organisms → Bacteria → Proteobacteria1277Open in IMG/M
3300025916|Ga0207663_10319013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1167Open in IMG/M
3300025917|Ga0207660_10543440All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300025920|Ga0207649_11451111Not Available543Open in IMG/M
3300025924|Ga0207694_10993050Not Available710Open in IMG/M
3300025926|Ga0207659_10394696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1156Open in IMG/M
3300025927|Ga0207687_10546584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. AP50971Open in IMG/M
3300025939|Ga0207665_10387311All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1062Open in IMG/M
3300025942|Ga0207689_11342714All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300025945|Ga0207679_12048754Not Available520Open in IMG/M
3300025957|Ga0210089_1011392All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300025986|Ga0207658_10188239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1713Open in IMG/M
3300026023|Ga0207677_11365724Not Available652Open in IMG/M
3300026116|Ga0207674_11253776Not Available711Open in IMG/M
3300026118|Ga0207675_100014220All Organisms → cellular organisms → Bacteria7419Open in IMG/M
3300026118|Ga0207675_101868898All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300026118|Ga0207675_102072788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium586Open in IMG/M
3300027360|Ga0209969_1029898All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300027401|Ga0208637_1044596All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300027911|Ga0209698_10223185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium1515Open in IMG/M
3300028608|Ga0247819_10136149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1269Open in IMG/M
3300031521|Ga0311364_10792704Not Available951Open in IMG/M
3300031547|Ga0310887_10974392Not Available540Open in IMG/M
3300031858|Ga0310892_11005476All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031892|Ga0310893_10285419All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300031908|Ga0310900_11164123Not Available640Open in IMG/M
3300031912|Ga0306921_11371150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium779Open in IMG/M
3300031941|Ga0310912_11479655Not Available512Open in IMG/M
3300031942|Ga0310916_11574707Not Available534Open in IMG/M
3300031943|Ga0310885_10413844All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300031944|Ga0310884_10728343Not Available602Open in IMG/M
3300032075|Ga0310890_10757235All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300032122|Ga0310895_10069902All Organisms → cellular organisms → Bacteria → Proteobacteria1349Open in IMG/M
3300032174|Ga0307470_10153521Not Available1411Open in IMG/M
3300032205|Ga0307472_101295036All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium701Open in IMG/M
3300032211|Ga0310896_10286263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales847Open in IMG/M
3300032261|Ga0306920_103590996All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300033289|Ga0310914_10125250Not Available2241Open in IMG/M
3300033551|Ga0247830_11479705Not Available543Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.06%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.37%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.37%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.18%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.18%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.18%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.18%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.18%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.18%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.59%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.59%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.59%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.59%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012505Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610Host-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10560030623300000364SoilMLRNLISVIGHALILAISTTASVWAADFGTAEEAK
JGI11643J11755_1139187523300000787SoilMLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKPC
JGI10214J12806_1018225113300000891SoilMLRNLISVIGHALILAISTTASVWAADFGTAEEAKAM
JGI1027J12803_10063409033300000955SoilMLRNLAFVVSFAVFQVLSTTAPVCAAEFGTAEEAKAMLERAVA
JGI1027J12803_10087888613300000955SoilMLRNLVSVIGHALILVLSTTASVWAADFGTAEEAKAML
JGI10216J12902_11547500313300000956SoilMLRNLAFVAGYAVITTASVWAADFGTAEEAKAMLERAV
JGI24034J26672_1010514013300002239Corn, Switchgrass And Miscanthus RhizosphereMLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKAMLEKAVA
Ga0062590_10246142113300004157SoilMLRNLAFVVGYALILVLSNTASVWAADFGTAEEAKAMLERAVAAVKEDKA
Ga0063356_10435773323300004463Arabidopsis Thaliana RhizosphereMLRNLAFVVGYALILVLSNTASVWAADFGTAEEAKAMLERAVAAVKEDK
Ga0062595_10258402913300004479SoilMLRNRAFAFGCAVSLIIFCTAASFAAADFGTPEEAKAMLEKAVA
Ga0062592_10014142833300004480SoilMIRKLAFVVGYAVFQLLSTTASVWAAEFGTAEEAKSMLERAVAAV
Ga0062592_10271878613300004480SoilMLRTLALVVGYAVIQVLFTTSSVWAADFGTAEEAKAMLERAVA
Ga0068999_1007705713300005205Natural And Restored WetlandsMLRNLAFVVGYAAALVLFTTGSSVPAAQYGTAEEAKAMLDRAVDAVKEDKTKA
Ga0068996_1013695513300005218Natural And Restored WetlandsMLRNLAFVVGYAAALVLFTTGSSVPAAQYGTAEEAKAMLDRAVDAVKEDKTKALDRRL*
Ga0066388_10300068513300005332Tropical Forest SoilMFRNLTFVVGYAVIQLLFTTASVWASNWGTAEEAKAMLEK
Ga0066388_10524619723300005332Tropical Forest SoilMTRKLAFVVAYAVILVSSTLTLVAAADFGTPEEAKAMLERAV
Ga0066388_10545428113300005332Tropical Forest SoilMIRNLAFVVGYAAILVLSTTASVWAADFGTAEEAKAMLERAVAA
Ga0066388_10598055213300005332Tropical Forest SoilMIRNLAFVGFALILVLSTARLVGAVEFGTAAEAKAMLERAVAAVKEDKA
Ga0066388_10799895633300005332Tropical Forest SoilMLRNLAFVVGYAVILVLSTAASVAAAEFGTAEEAKAMLERA
Ga0066388_10864025113300005332Tropical Forest SoilMAAQWRLVMLRNLAFVAGYAVIQLLFTTASVWATDFGTPEEAKAMLE
Ga0070687_10003882753300005343Switchgrass RhizosphereMLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVAAVKE
Ga0070688_10033742623300005365Switchgrass RhizosphereLIYAIVFAVGCAVSLIVVCTAASLAAADFGTPEEAKAMLEKAVAAVKQDKA
Ga0070688_10059669713300005365Switchgrass RhizosphereMSRNLGFVVSFALILVLSTTASVWGADFGTAEEAKAMLERAVAAVKEDKAK
Ga0070709_1003275513300005434Corn, Switchgrass And Miscanthus RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKA
Ga0070713_10121523113300005436Corn, Switchgrass And Miscanthus RhizosphereMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKA
Ga0070711_10016869133300005439Corn, Switchgrass And Miscanthus RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAK
Ga0070711_10153444723300005439Corn, Switchgrass And Miscanthus RhizosphereMLRNLAFVVGYAVIQVLSATALVWAADFGTAEEAKAMLERAVAAVKEDKAK
Ga0070663_10036865313300005455Corn RhizosphereMLRNLAFAVGCAVSLIVLSTAASLAAADFGTPEEAKAMLEKAVAAV
Ga0070696_10085090723300005546Corn, Switchgrass And Miscanthus RhizosphereMLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLERAVA
Ga0070693_10041506813300005547Corn, Switchgrass And Miscanthus RhizosphereMLRNLAFVISYAVIQVLFTTSSVWAADFGTPEEAKAMLERAV
Ga0068855_10051369213300005563Corn RhizosphereMLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAML
Ga0070664_10118094023300005564Corn RhizosphereMLRNLAFAVGCAVSLIVLSTAASLAAADFGTPEEAKAMLEKAVAAVK
Ga0070664_10169953813300005564Corn RhizosphereMPRNPASVIGHALILVLSTAASAWAAEFGTAEEAKAMLERAVAAV
Ga0068857_10140384313300005577Corn RhizosphereMLRHLALVVGYAVALACVTAAPVPAAQFGTPEEAKAMLE
Ga0068861_10001695913300005719Switchgrass RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKED
Ga0066903_10117464313300005764Tropical Forest SoilMMRKLAFAVTGYAVITTASAWAADFGTAEEAKAMLERAVAAVKE
Ga0068851_1030528223300005834Corn RhizosphereMLRNLAFAVGCAVSLIVVCMAASWAAADFGTPEEAKAMLEK
Ga0068860_10131917513300005843Switchgrass RhizosphereMLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAM
Ga0068862_10019124933300005844Switchgrass RhizosphereMLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAML
Ga0075028_10107042323300006050WatershedsMLRNLVFVVGYAVILVLSTTASVWAADFGTAEEAKAMLERAVA
Ga0070715_1001437953300006163Corn, Switchgrass And Miscanthus RhizosphereMLRNLAFVISYAVIQVLFTTSSVWAADFGTPEEAKAMLER
Ga0075018_1055847733300006172WatershedsMLRNIAFVVCFALIQVFSTAAFAADFGTAEEAKAMLEK
Ga0075422_1058156223300006196Populus RhizosphereMLRNLAFVVGYAVIQVLCTTASVWAADFGTAEEAKAMLEKA
Ga0097621_10219903023300006237Miscanthus RhizosphereMKLVMLRNLTFLFGYAAVLVLLTAGSVQAAQYGTGEEAKAMLERAV
Ga0075021_1075745823300006354WatershedsWRLVMLRNLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLEKQWPR*
Ga0075428_10167237133300006844Populus RhizosphereMLRHLAFVGCAVIQILSTAAPLPAAQFGTAEEAKAMLER
Ga0075421_10271217513300006845Populus RhizosphereMLRNLAFVVGYGVIQVLSTATLVWAGDFGTAEQAKAMLER
Ga0075433_1042373243300006852Populus RhizosphereMLRNLAFVVFVVFYLLATSAWAAEFGTAEEAKAMLERAVA
Ga0075433_1185561423300006852Populus RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEA
Ga0075433_1190169723300006852Populus RhizosphereMSRNLGFVVSFALILVLSTTASIWAAEFGTAEEAK
Ga0075420_10133336823300006853Populus RhizosphereMLRNLVFVAGYAVITAASVWAADFGTAEEAKAMLERA
Ga0075425_10175906523300006854Populus RhizosphereMLRNLAFVISYAVIQVLFTTSSVWAADFGTAEEAKAMLER
Ga0075434_10215553313300006871Populus RhizosphereMLRNLVFVAGYAVITAASVWAADFGTAEEAKAMLERAVTAVK
Ga0075429_10053406123300006880Populus RhizosphereMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAK
Ga0075429_10195596813300006880Populus RhizosphereMLRNLAFVVGYALILVLSNTASVWAADFGTAEEAKAMLERAVAAV
Ga0075424_10216533823300006904Populus RhizosphereMLRHLAFVGCAVIQILSTAAPLPAAQFGTAEEAKA
Ga0075424_10271726923300006904Populus RhizosphereMLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAV
Ga0105250_1043328923300009092Switchgrass RhizosphereMLRNLAFVISYAVIQVLFSTSSGWAADFGTAEEAKGMLERAV
Ga0105245_1299923023300009098Miscanthus RhizosphereMLRNLAFVVGYAVILVSSTVTLVEAADFGTPEEAKAMLERAVTAVKEDKA*
Ga0075418_1308159013300009100Populus RhizosphereLEEVMIRKLAFVVGYAVFQLLSTTASVWAAEFGTAEEAKS
Ga0114129_1100415523300009147Populus RhizosphereMLRNLALVVGYAVILVLSTVASVAAADFGTPEEAKANA*
Ga0114129_1223540613300009147Populus RhizosphereMPRNPASVIGHALILVLSTAASAWAAEFGTAEEAKAMLERA
Ga0075423_1124469013300009162Populus RhizosphereMEEAMIRNLAFIVSFALIMVLSTTVLLWASEFGTAEEAKAMLERAVAAVKEDK
Ga0105237_1019284343300009545Corn RhizosphereMLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERA
Ga0105237_1157586323300009545Corn RhizosphereMLRNLAFAVGCAVSLIVLCTAASWAAADFGTPEEAKAMLEKAAAAVKQDK
Ga0105252_1036614223300009678SoilMLRSFAFVVGFAAFLVLSTTASVWAAEYGTADEAKAMLERAVAAVKEDK
Ga0126384_1002779313300010046Tropical Forest SoilMMRKLAFVVGYAVIQVLSSPALFAAAEFGTAEEAKAMLER
Ga0126384_1071219113300010046Tropical Forest SoilMLRTLSFVVGYAVILVLSTAASVAAVNFGTPEEAKAML
Ga0126384_1191575923300010046Tropical Forest SoilMSRNLAFVISYAVIQVLFTTASIWAGNFGTPEEAKAMLE
Ga0126382_1025417223300010047Tropical Forest SoilMLRNLAFVIAYAVIQVLSTTASVCAADFGTAQEAKAMLERAVATVKEDK
Ga0126382_1104660923300010047Tropical Forest SoilMLRNLAFLIGRALILVLSTTASVWAAEYGTADEAKAMLERAVA
Ga0126373_1128768823300010048Tropical Forest SoilMEEVMIRKLAFVVGYAVIQVLSNPTSVAAAEFGTAEEAKAMLERAVAAVKE
Ga0126370_1036673513300010358Tropical Forest SoilMEEMMTRKLAIVVGYAVILVSSSVTLVAAADFGTPEEAK
Ga0126370_1242642923300010358Tropical Forest SoilMLRNLAFVVVYALFSLLATAVWAAEFGTAEEAKAMLERAVAAV
Ga0126376_1047404023300010359Tropical Forest SoilMEEIMTRKLAFVVGYAVILVFSTVALVAAADFGTPEEAKAMLERAVAAVKEDKA
Ga0126377_1313994613300010362Tropical Forest SoilMLRNLAFVVGYAVIYVLSTIAFVWAADFGTPEEAKAMLERAVTA
Ga0126379_1127373013300010366Tropical Forest SoilMMRKFAFVVGYAVIQILSSLALVAAAEFGTAEEAKAMLERAV
Ga0134125_1176999523300010371Terrestrial SoilMLRNLAFAVGCAVSLIVLCTAASLAAADFGTPEEAKAMLEKAV
Ga0134128_1009400513300010373Terrestrial SoilMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEA
Ga0134128_1057869713300010373Terrestrial SoilMLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAMLERAVAA
Ga0134128_1128906833300010373Terrestrial SoilMFRNFGFVVGFALILVLSTTASVWAAEFGTAEEAKAMLERAVA
Ga0134128_1238393623300010373Terrestrial SoilMLRNLAFVAGYAVILVLSTSAPVWAAEFGTAEEAKTMLERAVAAVKEDK
Ga0126383_1158183923300010398Tropical Forest SoilMIRNLAFVVGYAAVLVLSTTSSVWAADFGTAEEAKAMLERAVAAVKEDK
Ga0134123_1008626623300010403Terrestrial SoilMLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVAR*
Ga0134123_1109572613300010403Terrestrial SoilMLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLEKAV
Ga0134123_1239376123300010403Terrestrial SoilLWRLVMLRNLVFVVGYAVVLVLSTATLVAAAEFGTA*
Ga0137454_103003133300011406SoilMLRNLAFVVSFALILVLSTPASVSAAEFGTAEEAKAMLERAVAAVK
Ga0157341_102061323300012494Arabidopsis RhizosphereMLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLEKAVAAV
Ga0157339_105273923300012505Arabidopsis RhizosphereMIRNLGFVVGYAVILVLSTTASVWAADFGTAEEAKAMLERAVAAV
Ga0157342_101508923300012507Arabidopsis RhizosphereMSRNLAFVVSFALMLLLSTTASVWAAEFGTAEEAKAMLERAVAAVKEDKA
Ga0157342_108509013300012507Arabidopsis RhizosphereMEEAMIRNLAFIVSFALIMVLSTTVLLWASEFGTAEEAKAMLERAVA
Ga0157352_105985213300012519Unplanted SoilMLRNLAFAVGCAVSVIVLCTAASFAAADFGTPEEAKAMLEKA
Ga0157303_1020539323300012896SoilVLLAEGHAEPLEEVMMRKLAFVVGYAVIQVLSSPALFAAAEFGTAEEAKAMLERAVAAVKEDK
Ga0157285_1000889513300012897SoilMLRNLAFVVGYAVIQMLSTAAPLPAAQFGTAEEAKAMLERA
Ga0157285_1002338043300012897SoilMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVA
Ga0157293_1015041923300012898SoilMLRNLAFVVGYAVIQMLSTTASVWAADFGTAEEAKAMLERAVAAVKENKAKA
Ga0157288_1026694623300012901SoilLEEVMIRKLAFVVGYAVFQLLSTTASVWAAEFGTAEEAKSMLERAVAA
Ga0157301_1002001013300012911SoilMLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAMLE
Ga0164300_1006759633300012951SoilMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTTEEAAAMLERAVPAGKEDKATGL
Ga0164298_1066704813300012955SoilMLRNIAFVIGFVVFPVLSTAASVWAADFGTAEEAKARLERAVAR*
Ga0164298_1073365713300012955SoilMLRNLASVIGHALILVLSTTASVWAADFGTAEEAKAMLERAVA
Ga0164303_1081744413300012957SoilMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAA
Ga0164303_1084608513300012957SoilMLRNIAFVVGLVVFPVLSTAASVWAADFGTAEEAKAMLERAVA
Ga0164301_1002059943300012960SoilMLRNIAFVVGLVVFPVLSTAASVWAADFGTAEEAKAMLERAVAR*
Ga0164302_1000201823300012961SoilMLRNIAFVVCFALIQVFSTAAFAADFGTAEEAKSHA*
Ga0164302_1031537123300012961SoilMLRNLASVIGHALILVLSTTASVWAADFGTAEEAKAMLERAVAAVK
Ga0126369_1083934843300012971Tropical Forest SoilMEEVMIRKLAFVVGYAVIQVLSNPTSVAAAEFGTAEEAKAMLERA
Ga0164304_1182579813300012986SoilMEEVMLRNLAFVVGCAAVLAFFTAAPVPAAQYGTDEGAKAMLSRAIAA
Ga0157372_1127219313300013307Corn RhizosphereMLRNLALVVGYAVILVLSTVASVAAADFGTPEEAKAMLE
Ga0132258_1243810913300015371Arabidopsis RhizosphereMLRNLTFVVGYAVIQLLFTTAPVWASNWGTAEEAKAMLEKAVAA
Ga0132256_10183322213300015372Arabidopsis RhizosphereMLRPLAFVDSYAAVLILFAATPVPAAQFGTQEEARAMLEKAVAAVKEDK
Ga0132256_10263629623300015372Arabidopsis RhizosphereMLRNLAFVVGYAVFQLLAPTAWAAEFGTAEEAKAMLGRAVAAVK
Ga0182033_1196646113300016319SoilMSRNLAFVASYVTVLVLLTAAVSAAQYGTPEEAKAMLERAVA
Ga0182035_1111154923300016341SoilMLRNLAFVVVYAVILVSSRLTLVAAADFGTPEEAKAMLERAVTAVKED
Ga0184638_121693013300018052Groundwater SedimentMLRNLAFVVGYAVIQVLSTTASVWAADFGTEEEAK
Ga0184626_1044111613300018053Groundwater SedimentMLRSLAYVVGHMIVLVLLTAPSASAAQFGTAEEAKAMLERAV
Ga0184619_1033128913300018061Groundwater SedimentMLRNLAFVVSFAVIQGLSTAALVAAAEFGTAEEAKAMLERAVAAVKE
Ga0187773_1105253513300018064Tropical PeatlandMLRNLAFVVGYAVILVLSTTASVVAADFGTSQEAKAMLERAVAAV
Ga0190271_1010778263300018481SoilMLRSFAFVVGFAAFLVLSTTASVWAAEYGTADEAKAMLERAVA
Ga0190271_1174396933300018481SoilMLRSFAFVVGFAAFLVLSTTASVWAAEYGTADEAKAMLERA
Ga0210402_1089928513300021478SoilMLRNIAFVVGFAVIQVLSTAASVWAADFGTAEEAK
Ga0210402_1095935113300021478SoilMLRNLAFVVGYAVIQVLSTTASVWAADFGTAEEAK
Ga0210402_1198083123300021478SoilMLRNLASVISHALILVLSTTASVWAADFGTAEEAKAILERAV
Ga0126371_1277881523300021560Tropical Forest SoilMIRNRAFVVSFAVIQVLSSATLVAAAEFGTAEEAKAMLERAVAA
Ga0126371_1353528313300021560Tropical Forest SoilMLRNLAFVVGYAVILVSSTVTFVAAADFGTPEEAKAMLERA
Ga0222623_1038158323300022694Groundwater SedimentMLRNLAFVISYAVIQVLFITASVWAADFGSAEEAEAFSREQWPQ
Ga0207713_113910723300025735Switchgrass RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEE
Ga0207710_1002786713300025900Switchgrass RhizosphereMLRNLAFAVGCAVSLIVVCTAASFAAADFGTPEEAKAMLEKAV
Ga0207685_1008401033300025905Corn, Switchgrass And Miscanthus RhizosphereMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAM
Ga0207707_1045426423300025912Corn RhizosphereMLRKIAFAVSFAVIQVLTASVWAADFGTAEEAKAMLE
Ga0207663_1026187433300025916Corn, Switchgrass And Miscanthus RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAM
Ga0207663_1031901313300025916Corn, Switchgrass And Miscanthus RhizosphereMLRNLVLVVSYAAALVLSTAASVAETQFGTPEEAKAMLERAVAA
Ga0207660_1054344023300025917Corn RhizosphereMLRNLAFVISYAVIQVLFTTSSVWAADFGTPEEAKA
Ga0207649_1145111113300025920Corn RhizosphereMLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVAR
Ga0207694_1099305023300025924Corn RhizosphereMLRNLAFAVGCAVSLIVLSTAASLAAADFGTPEEAKAMLEKAI
Ga0207659_1039469633300025926Miscanthus RhizosphereMLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVAAVKEDKA
Ga0207687_1054658423300025927Miscanthus RhizosphereMSRNLGFVVSFALILVLSTTASVWGADFGTAEEAKAMLERAVAAVKEDKARRRLICS
Ga0207665_1038731113300025939Corn, Switchgrass And Miscanthus RhizosphereMLRNLVLVVSYAAALVLSTAASVAETQFGTPEEAKAMLERAVAAVKE
Ga0207689_1134271413300025942Miscanthus RhizosphereMLRTLALVVGYAVIQVLSITASVWAADFGTAEEAKAMLERAVAAV
Ga0207679_1204875413300025945Corn RhizosphereMLRNRAFAFGCAVSLIIFCTAASFAAADFGTPEEAKAMLEKAVAAVKQDKAKA
Ga0210089_101139223300025957Natural And Restored WetlandsMIRNLVFVVSFGVIQILSTVTSVPAAEFGTAEEAK
Ga0207658_1018823913300025986Switchgrass RhizosphereMLRNLAFVVGYAVIQMLSTTALVWAADFGTAEEAKAMLERAVA
Ga0207677_1136572413300026023Miscanthus RhizosphereMLRNLAFLVGYAVIQVLSTTASVWAADFGTAEEAKA
Ga0207674_1125377613300026116Corn RhizosphereMLRHLALVVGYAVALACVTAAPVPAAQFGTPEEAKAMLERAVAAV
Ga0207675_10001422013300026118Switchgrass RhizosphereMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDK
Ga0207675_10186889813300026118Switchgrass RhizosphereMLRDLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVA
Ga0207675_10207278813300026118Switchgrass RhizosphereMLRNLAFAVGCAVSLIVLCTAASWAAADFGTPEEAKAM
Ga0209969_102989813300027360Arabidopsis Thaliana RhizosphereMKLVMLRNLAFVISFALILVLSTTVSVWAAKFGTAQE
Ga0208637_104459613300027401SoilPAAAPWRLVMLRNIAFVVGFAVIQVLSTAASVAAADFGTAEEAKAMLEGQWPR
Ga0209698_1022318543300027911WatershedsMLRHLALVVSYAAVLVLFAATSVPAAQFGTAEEAKAMLE
Ga0247819_1013614913300028608SoilMLRNLAFVVGYAVIQVLSTTASVWAADFGTAEEAKAMLERAVAAMKEDK
Ga0311364_1079270413300031521FenMLRNLTLAVGYAVILVLSTAALVSAADFGTPAEAKA
Ga0310887_1097439213300031547SoilMLRNLAFVVGYAVIQVLSTTASVWATDFGTAEEAK
Ga0310892_1100547613300031858SoilMIRNLAFIVSFALIMVLSTTVLLRASEFGTAEEAKAMLERAVAA
Ga0310893_1028541923300031892SoilMLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKA
Ga0310900_1116412313300031908SoilMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKGL
Ga0306921_1137115023300031912SoilMLRNLAFVVVYAVILVSSTLTLVAAADFGTPEEAKAMLERAVTAVKEDKAK
Ga0310912_1147965513300031941SoilMLRNLAFVVGYAVILVSSTVTLVPAADFGTPEEAKAMLERA
Ga0310916_1157470723300031942SoilMKLVMLRNLAFVVAYAVIQVLSTTASVWAADFGTAEEAKAMLEKAAAA
Ga0310885_1041384423300031943SoilMLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAKAMLEKAVAA
Ga0310884_1072834313300031944SoilMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVK
Ga0310890_1075723533300032075SoilMLRNLAFVLSYAVILVLSTAASVLAAQFGTAEEAK
Ga0310895_1006990233300032122SoilMEKVMLRHLAFVVGCAAIQILSTAAPLPAAQFGTAEEAEAMLERAVAAVKEDKAKAL
Ga0307470_1015352113300032174Hardwood Forest SoilMSRNLGFVVSFALILVLSTTASVWAAEFGTAEEAKAM
Ga0307472_10129503613300032205Hardwood Forest SoilMLRNIAFVVGFAVIQVLSTAASVWAADFGTAEPKLCLRE
Ga0310896_1028626323300032211SoilMLRNLALVVGYAVILVLSTVASVAAADFGTPEEAKANA
Ga0306920_10359099623300032261SoilMTRKLGIVVGYAVILVSSAVTLVAAADFGTPEEAKAMLERAVTAVKEDKAK
Ga0310914_1012525023300033289SoilMLRNLAFVVGTTVMVLFTAAPVPAADFGTAEQAKAMLERAVAAVK
Ga0247830_1147970513300033551SoilMLRNIAFVVGFALIQVFSTAAFAADFGTAEEAKAMLERAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.