NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F036996

Metagenome Family F036996

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036996
Family Type Metagenome
Number of Sequences 168
Average Sequence Length 48 residues
Representative Sequence MRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Number of Associated Samples 19
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.19 %
% of genes near scaffold ends (potentially truncated) 20.24 %
% of genes from short scaffolds (< 2000 bps) 33.33 %
Associated GOLD sequencing projects 19
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (72.619 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(81.548 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(70.833 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.89%    β-sheet: 0.00%    Coil/Unstructured: 67.11%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF00612IQ 7.14
PF00078RVT_1 2.98
PF03732Retrotrans_gag 1.79
PF08263LRRNT_2 1.19
PF14008Metallophos_C 1.19
PF08284RVP_2 0.60
PF00361Proton_antipo_M 0.60
PF02788RuBisCO_large_N 0.60
PF09337zf-H2C2 0.60
PF13966zf-RVT 0.60
PF00098zf-CCHC 0.60
PF14392zf-CCHC_4 0.60
PF05879RHD3_GTPase 0.60
PF03372Exo_endo_phos 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG1850Ribulose 1,5-bisphosphate carboxylase, large subunit, or a RuBisCO-like proteinCarbohydrate transport and metabolism [G] 0.60

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.38 %
UnclassifiedrootN/A22.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10000411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta73152Open in IMG/M
3300028786|Ga0307517_10005776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida18510Open in IMG/M
3300028786|Ga0307517_10007404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus16001Open in IMG/M
3300028786|Ga0307517_10007600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15757Open in IMG/M
3300028786|Ga0307517_10013408Not Available11135Open in IMG/M
3300028786|Ga0307517_10014815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10426Open in IMG/M
3300028786|Ga0307517_10014869Not Available10405Open in IMG/M
3300028786|Ga0307517_10015675All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta10043Open in IMG/M
3300028786|Ga0307517_10020345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta8458Open in IMG/M
3300028786|Ga0307517_10021051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta8267Open in IMG/M
3300028786|Ga0307517_10022627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7866Open in IMG/M
3300028786|Ga0307517_10022825Not Available7818Open in IMG/M
3300028786|Ga0307517_10028178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6711Open in IMG/M
3300028786|Ga0307517_10030146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6371Open in IMG/M
3300028786|Ga0307517_10034251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5790Open in IMG/M
3300028786|Ga0307517_10034584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5750Open in IMG/M
3300028786|Ga0307517_10035754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5613Open in IMG/M
3300028786|Ga0307517_10041945Not Available4924Open in IMG/M
3300028786|Ga0307517_10049883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae4269Open in IMG/M
3300028786|Ga0307517_10065900All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3342Open in IMG/M
3300028786|Ga0307517_10068258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3241Open in IMG/M
3300028786|Ga0307517_10075354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2960Open in IMG/M
3300028786|Ga0307517_10076046All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2937Open in IMG/M
3300028786|Ga0307517_10080922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2775Open in IMG/M
3300028786|Ga0307517_10084041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2683Open in IMG/M
3300028786|Ga0307517_10094144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2421Open in IMG/M
3300028786|Ga0307517_10099847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2297Open in IMG/M
3300028786|Ga0307517_10113768All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae2040Open in IMG/M
3300028786|Ga0307517_10135086Not Available1757Open in IMG/M
3300028786|Ga0307517_10147533All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1626Open in IMG/M
3300028786|Ga0307517_10158807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa1524Open in IMG/M
3300028786|Ga0307517_10173812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Maleae → Malus → Malus domestica1408Open in IMG/M
3300028786|Ga0307517_10183892Not Available1342Open in IMG/M
3300028786|Ga0307517_10213338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1185Open in IMG/M
3300028786|Ga0307517_10380488Not Available754Open in IMG/M
3300028794|Ga0307515_10004030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida30667Open in IMG/M
3300028794|Ga0307515_10010707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae17525Open in IMG/M
3300028794|Ga0307515_10017013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13284Open in IMG/M
3300028794|Ga0307515_10017285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa13149Open in IMG/M
3300028794|Ga0307515_10043544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae6972Open in IMG/M
3300028794|Ga0307515_10044693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6832Open in IMG/M
3300028794|Ga0307515_10062114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max5284Open in IMG/M
3300028794|Ga0307515_10076016All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4463Open in IMG/M
3300028794|Ga0307515_10076114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4459Open in IMG/M
3300028794|Ga0307515_10080852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4229Open in IMG/M
3300028794|Ga0307515_10083429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4119Open in IMG/M
3300028794|Ga0307515_10107803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3288Open in IMG/M
3300028794|Ga0307515_10130387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2774Open in IMG/M
3300028794|Ga0307515_10149571Not Available2449Open in IMG/M
3300030521|Ga0307511_10012135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8466Open in IMG/M
3300030521|Ga0307511_10018977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa6555Open in IMG/M
3300030521|Ga0307511_10023958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5672Open in IMG/M
3300030521|Ga0307511_10038160All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae4132Open in IMG/M
3300030521|Ga0307511_10067769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2643Open in IMG/M
3300030521|Ga0307511_10076575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2390Open in IMG/M
3300030521|Ga0307511_10086662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2155Open in IMG/M
3300030521|Ga0307511_10092069All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2047Open in IMG/M
3300030521|Ga0307511_10149557Not Available1344Open in IMG/M
3300030521|Ga0307511_10264040Not Available813Open in IMG/M
3300030522|Ga0307512_10103906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1908Open in IMG/M
3300030522|Ga0307512_10142780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1459Open in IMG/M
3300030522|Ga0307512_10162143Not Available1306Open in IMG/M
3300030522|Ga0307512_10168525All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1262Open in IMG/M
3300030522|Ga0307512_10230028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa954Open in IMG/M
3300030522|Ga0307512_10264558Not Available840Open in IMG/M
3300030522|Ga0307512_10267656All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis831Open in IMG/M
3300030522|Ga0307512_10310629Not Available725Open in IMG/M
3300031456|Ga0307513_10011548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10970Open in IMG/M
3300031456|Ga0307513_10016961All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae8750Open in IMG/M
3300031456|Ga0307513_10025578All Organisms → cellular organisms → Eukaryota6832Open in IMG/M
3300031456|Ga0307513_10025592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6830Open in IMG/M
3300031456|Ga0307513_10058484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4096Open in IMG/M
3300031456|Ga0307513_10074710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3523Open in IMG/M
3300031456|Ga0307513_10096121All Organisms → cellular organisms → Eukaryota3001Open in IMG/M
3300031456|Ga0307513_10099965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae2927Open in IMG/M
3300031456|Ga0307513_10130059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2465Open in IMG/M
3300031456|Ga0307513_10290275Not Available1407Open in IMG/M
3300031456|Ga0307513_10303958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1360Open in IMG/M
3300031456|Ga0307513_10318513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1314Open in IMG/M
3300031456|Ga0307513_10499024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa934Open in IMG/M
3300031456|Ga0307513_10650053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa761Open in IMG/M
3300031507|Ga0307509_10020794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa7443Open in IMG/M
3300031507|Ga0307509_10040897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5037Open in IMG/M
3300031507|Ga0307509_10087048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3210Open in IMG/M
3300031507|Ga0307509_10114955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2684Open in IMG/M
3300031507|Ga0307509_10144293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2309Open in IMG/M
3300031507|Ga0307509_10147553Not Available2274Open in IMG/M
3300031507|Ga0307509_10167166Not Available2085Open in IMG/M
3300031507|Ga0307509_10238145All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1615Open in IMG/M
3300031507|Ga0307509_10319651Not Available1289Open in IMG/M
3300031507|Ga0307509_10322229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1281Open in IMG/M
3300031507|Ga0307509_10334549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1244Open in IMG/M
3300031507|Ga0307509_10367274Not Available1156Open in IMG/M
3300031507|Ga0307509_10608489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa764Open in IMG/M
3300031507|Ga0307509_10793758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa611Open in IMG/M
3300031616|Ga0307508_10029964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4917Open in IMG/M
3300031616|Ga0307508_10075855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2939Open in IMG/M
3300031616|Ga0307508_10240144Not Available1409Open in IMG/M
3300031616|Ga0307508_10263857Not Available1316Open in IMG/M
3300031616|Ga0307508_10312172Not Available1164Open in IMG/M
3300031616|Ga0307508_10361530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1042Open in IMG/M
3300031616|Ga0307508_10553447Not Available748Open in IMG/M
3300031616|Ga0307508_10848853Not Available534Open in IMG/M
3300031616|Ga0307508_10876347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa521Open in IMG/M
3300031649|Ga0307514_10019197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5596Open in IMG/M
3300031649|Ga0307514_10031111Not Available4281Open in IMG/M
3300031649|Ga0307514_10052734All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3142Open in IMG/M
3300031649|Ga0307514_10089633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta2246Open in IMG/M
3300031649|Ga0307514_10101755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2061Open in IMG/M
3300031649|Ga0307514_10162551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1475Open in IMG/M
3300031649|Ga0307514_10183638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1344Open in IMG/M
3300031649|Ga0307514_10506973Not Available571Open in IMG/M
3300031730|Ga0307516_10042653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4499Open in IMG/M
3300031730|Ga0307516_10078893All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3137Open in IMG/M
3300031730|Ga0307516_10131790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2278Open in IMG/M
3300031730|Ga0307516_10156069Not Available2037Open in IMG/M
3300031730|Ga0307516_10207687Not Available1674Open in IMG/M
3300031730|Ga0307516_10221945All Organisms → Viruses → Predicted Viral1598Open in IMG/M
3300031730|Ga0307516_10268958All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Arecales → Arecaceae → Coryphoideae → Phoeniceae → Phoenix → Phoenix dactylifera1391Open in IMG/M
3300031730|Ga0307516_10572347Not Available783Open in IMG/M
3300031838|Ga0307518_10025626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4253Open in IMG/M
3300031838|Ga0307518_10077718Not Available2397Open in IMG/M
3300031838|Ga0307518_10210447All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1280Open in IMG/M
3300031838|Ga0307518_10295587Not Available989Open in IMG/M
3300031838|Ga0307518_10317575All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Arecales → Arecaceae → Coryphoideae → Phoeniceae → Phoenix → Phoenix dactylifera933Open in IMG/M
3300032354|Ga0325403_1002987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida15245Open in IMG/M
3300032354|Ga0325403_1003511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14339Open in IMG/M
3300032354|Ga0325403_1006979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10783Open in IMG/M
3300032354|Ga0325403_1011593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8356Open in IMG/M
3300032354|Ga0325403_1013286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7749Open in IMG/M
3300032354|Ga0325403_1018491All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae6393Open in IMG/M
3300032354|Ga0325403_1029251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4662Open in IMG/M
3300032354|Ga0325403_1036454All Organisms → cellular organisms → Bacteria3912Open in IMG/M
3300032354|Ga0325403_1039741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3635Open in IMG/M
3300032354|Ga0325403_1043225All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3371Open in IMG/M
3300032354|Ga0325403_1046823Not Available3131Open in IMG/M
3300032354|Ga0325403_1048595Not Available3014Open in IMG/M
3300032354|Ga0325403_1052829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2764Open in IMG/M
3300032354|Ga0325403_1053685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2718Open in IMG/M
3300032354|Ga0325403_1066044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2146Open in IMG/M
3300032354|Ga0325403_1082012Not Available1606Open in IMG/M
3300032354|Ga0325403_1084387Not Available1541Open in IMG/M
3300032354|Ga0325403_1099362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix → Salix suchowensis1197Open in IMG/M
3300032355|Ga0325401_1020929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida6095Open in IMG/M
3300032355|Ga0325401_1042877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3646Open in IMG/M
3300032355|Ga0325401_1079984Not Available2033Open in IMG/M
3300032374|Ga0325400_1011417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida8481Open in IMG/M
3300032389|Ga0325405_1004090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14938Open in IMG/M
3300032389|Ga0325405_1006062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12228Open in IMG/M
3300032389|Ga0325405_1006673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica11654Open in IMG/M
3300032389|Ga0325405_1035642All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3619Open in IMG/M
3300032390|Ga0325404_1004100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15511Open in IMG/M
3300032390|Ga0325404_1024777All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida5059Open in IMG/M
3300032390|Ga0325404_1073438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1370Open in IMG/M
3300032741|Ga0325414_1042223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3358Open in IMG/M
3300033179|Ga0307507_10008698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta13896Open in IMG/M
3300033179|Ga0307507_10083387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2795Open in IMG/M
3300033179|Ga0307507_10157118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1691Open in IMG/M
3300033179|Ga0307507_10229262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1234Open in IMG/M
3300033179|Ga0307507_10683269Not Available515Open in IMG/M
3300033180|Ga0307510_10031781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae5954Open in IMG/M
3300033180|Ga0307510_10081421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3139Open in IMG/M
3300033180|Ga0307510_10108697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2525Open in IMG/M
3300033180|Ga0307510_10119817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2340Open in IMG/M
3300033180|Ga0307510_10487593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa674Open in IMG/M
3300033180|Ga0307510_10553034Not Available597Open in IMG/M
3300033180|Ga0307510_10662357Not Available503Open in IMG/M
3300034389|Ga0325419_035811All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3619Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza81.55%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem17.26%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf1.19%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_10000411593300028786EctomycorrhizaMKLTQTIAKYPKYDDNILAVTKSTETKQVLKDNAKHTCYGKTKPDSGT
Ga0307517_10005776133300028786EctomycorrhizaMAQKIAKYPKYVDNILARTKSIETKQVLKANAKQTRYGKIKPDSGT
Ga0307517_10007404153300028786EctomycorrhizaMKMTQTTTNYLKYDDNILLGTKSTETKQVLKANAKHTRYGKTKPDSGT
Ga0307517_1000760073300028786EctomycorrhizaMKLMKMTQTTAKYLKYDDDILEGTKSIETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1001340843300028786EctomycorrhizaMKVMKMTQKTAKYPKYDDNILAGTKSIETKQVLKNNAKQTSYGKTKPDSRT
Ga0307517_1001481583300028786EctomycorrhizaMTQTTTKYPEYDDNILAGTKSIDTKQVLKDNVKQTHYGKTKPDSGT
Ga0307517_10014869103300028786EctomycorrhizaMTQTTKYPKYDDNILAGTKSTKTKQVLKDNAKQTCYSKIKPNFGT
Ga0307517_1001567543300028786EctomycorrhizaMKLMRMTQTTAKHPKYDDNILEGTKSTEIKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1002034573300028786EctomycorrhizaMNQTTDKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1002105163300028786EctomycorrhizaMKLMRMTQTTAKYPNYDDNILEGTKSTETKQVLKDNAKQTHYSKTKPDFRT
Ga0307517_1002262753300028786EctomycorrhizaMKLMRMTQTTAKYPKYDDKILEGTKSTETKQVLKDNAKQTHYSKTKPDSGT
Ga0307517_10022825133300028786EctomycorrhizaMKLMRMTQTTAKYPKYDDNILEGTKSTETKQVLKDNAKQTCYGKTKPDSGT
Ga0307517_1002817863300028786EctomycorrhizaMRMTQTTAKYTKYDDKILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1003014653300028786EctomycorrhizaMTQTIAKYPKYNDNILEETKSTETKQVLKDNAKQTCYGKTKHNSGT
Ga0307517_1003425143300028786EctomycorrhizaMKLMRMTQTTANYPKYDDNILEGTKSTETKQVLKDNAKQTCYSKTKPDSGT
Ga0307517_1003458453300028786EctomycorrhizaMKMTQTTAKYPKYDDNLLEGTKSTKTKQVLKDNAKQTRYGKAKPDSRT
Ga0307517_1003575413300028786EctomycorrhizaMMKMTQTTTKYPKYDDNILARTKSTETKQVLKDNAKQTRYGKTKPDSKT
Ga0307517_1004194513300028786EctomycorrhizaVKVIKMTQKIAKYPKYDDTILARTKSTETKQVLKDKAKQTRYGKTKPDSRT
Ga0307517_1004988373300028786EctomycorrhizaMRVPQTTAKYPKYNDNIMEGTKSTKIKQVLKDNAKQTRYNKTKPDSGT
Ga0307517_1006590053300028786EctomycorrhizaMKLMRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTCYSKTKPDSGT
Ga0307517_1006825833300028786EctomycorrhizaMRMTQTTTKYQKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1007535423300028786EctomycorrhizaMKMIQTTTKYPKYDDNILARTKSTETKQVLKDNAKQTRYGKTKPDSKT
Ga0307517_1007604633300028786EctomycorrhizaMKMTQKTTKHPKYDDNKLEGMKSTETKQVLKANARQTRYGNTKPDFRT
Ga0307517_1008092253300028786EctomycorrhizaMKLIRMTQTIAKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1008404143300028786EctomycorrhizaMKLMRMTQTTAKYPKYDDKILEGTKLTETKQVWKDNAKQTRYSKTKPNSGT
Ga0307517_1009414413300028786EctomycorrhizaMKLMRMTQTTVKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1009984713300028786EctomycorrhizaMKITQTAAKYPKYDDNMLEGTKSTETKQLLKDNAKQTCYDKTKPDSGT
Ga0307517_1011376823300028786EctomycorrhizaDRKQTNMKLMRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1013508623300028786EctomycorrhizaMKLMRMTQTTTKYPKFDDKILEGTKSTATKQVLKDNAKQTRYSKTKPDSRT
Ga0307517_1014753323300028786EctomycorrhizaMKLMRMTQTTAKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKTDSGT
Ga0307517_1015880743300028786EctomycorrhizaQTTVKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307517_1017381213300028786EctomycorrhizaMKITQTAAPYPKYDDNMLEGTKSTETKQLLKDNAKQTCYGKTKPDSGT
Ga0307517_1018389213300028786EctomycorrhizaMKMTQTTVKYPKYDDNILVGTKSTETKQVLKDNAKQTHYSKTKPDYGT
Ga0307517_1021333843300028786EctomycorrhizaMKLMKMTQIIAKYHKYDDNILEGTKLIETKQVLKDNAKQTCYGKTKLDSGT
Ga0307517_1038048813300028786EctomycorrhizaMKMTQIIDKYPKYDDNILAGTKSTERKQVLKDNAKQTRYGKIKPESGT
Ga0307515_10004030313300028794EctomycorrhizaMKMTQTTANYPKYDDNILEGTKSTETKQVLKDNAKHTHYGKTKPDSRT
Ga0307515_10010707123300028794EctomycorrhizaMKVMKMTQTTTKYPEYDDNILAGTKSIDTKQVLKDNVKQTHYGKTKPDSGT
Ga0307515_10017013103300028794EctomycorrhizaMKLMRMTQTTTKYQKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKLDSGT
Ga0307515_1001728573300028794EctomycorrhizaMKLTQTIAKYPKYDDNILAVTKSTETKQVLKDNAKQTCYGKTKPDSGT
Ga0307515_1004354453300028794EctomycorrhizaMKMTQTIAKYPKYNDNILEETKSTETKQVLKDNAKQTCYGKTKRNSGT
Ga0307515_1004469353300028794EctomycorrhizaMKLMRMTQTTAKYPKYNDNILEGTKSTKTKQVLKDNAKQIVTARQKPDSGN
Ga0307515_1006211433300028794EctomycorrhizaMKLMRVPQTTAKYPKYNDNIMEGTKSTKIKQVLKDNAKQTRYNKTKPDSGT
Ga0307515_1007601633300028794EctomycorrhizaMRMTQTTAKYPKYDDKILEGTKSTETKQVLKDNAKQTHYSKTKPDSGT
Ga0307515_1007611423300028794EctomycorrhizaLFGPELIENKKNVKVMKMTQTTVKYPKYDDNILVGTKSTETKQVLKDNAKQTHYSKTKPDYGT
Ga0307515_1008085223300028794EctomycorrhizaMKMTQTTTKYPKYDDNILARTKSTETKQVLKDNAKQTRYGKTKPDSKT
Ga0307515_1008342943300028794EctomycorrhizaMRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307515_1010780353300028794EctomycorrhizaMKMTQKTTKHPKYDDNILEGMKSTETKEVLKANARQTRYGKTKPDFRT
Ga0307515_1013038723300028794EctomycorrhizaMRMTQTTVKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYNKTKPDFET
Ga0307515_1014957123300028794EctomycorrhizaMKVMKMTQIIDKYPKYDDNILAGTKSTERKQVLKDNAKQSRYGKIKPESRT
Ga0307511_1001213553300030521EctomycorrhizaMKMMKMTQTTTKYPKYDDNILARTKSTETKQVLKDNAKQTRYGKTKPDSKT
Ga0307511_1001897713300030521EctomycorrhizaMKMTQTTTKYPEYDDNILAGTKSIDTKQVLKDNVKQTHYGKTKPDSGT
Ga0307511_1002395843300030521EctomycorrhizaMKMTQTTAKYPKYNDNILEGTKSTETKQVLKDNAKQTRYGKTKPDSGT
Ga0307511_1003816053300030521EctomycorrhizaAKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKTDSGT
Ga0307511_1006776913300030521EctomycorrhizaMRMTQTTVKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307511_1007657523300030521EctomycorrhizaMRMTQTTAKYTKYDDKMLEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307511_1008666223300030521EctomycorrhizaMKMTQKTTKHPKYDDNILEGMKSTETKQVLKANARQTRYGKTKPDFRT
Ga0307511_1009206923300030521EctomycorrhizaMKLMRMTQTTVKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYNKTKPDFGT
Ga0307511_1014955713300030521EctomycorrhizaMKMTQTTAKYPKYDDNILAGTKSTETKQVLKDNAKQTHYNKTKPDYGT
Ga0307511_1026404013300030521EctomycorrhizaDRKQTNMKLMRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTCYSKTKPDSGT
Ga0307512_1010390633300030522EctomycorrhizaMKMTQTTAKYPKCNDNILEGTKSAETKQVLKDNAKQTRYGKTKPDSGT
Ga0307512_1014278013300030522EctomycorrhizaQNXLKTKKNVKVMKMTQTTAKYPKYDDNILAGTKSTETKQVLKDNAKQTHYNKTKPDYGT
Ga0307512_1016214323300030522EctomycorrhizaMKVMKMTQIIDKYPKYDDNILAGTKSTERKQVLKDNAKQSRYGKIKLESRT
Ga0307512_1016852513300030522EctomycorrhizaMTQTTAKYPKYDDKILEGTKLTETKQVWKDNAKQTRYSKTKPNSGT
Ga0307512_1023002813300030522EctomycorrhizaMKLMRMTQTTANYPKYDDNILEETKSTETKQVLKDNAKQTCYSKTKPDSET
Ga0307512_1026455813300030522EctomycorrhizaKTANYPKYDDNILEGTKSTETKQVLKDNAKHTHYGKTKPDSRT
Ga0307512_1026765613300030522EctomycorrhizaMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKTDSGT
Ga0307512_1031062913300030522EctomycorrhizaMKLMKMTQIIAKYPKYDDNILEGTKLIETKQVLKDNAKQTCYGKTKLDSGT
Ga0307513_10011548163300031456EctomycorrhizaMKMTQTTTNYLKYDDNILLGTTSTETKQVLKANAKHTRYGKTKPDSGT
Ga0307513_1001696193300031456EctomycorrhizaVKVIKMTQTTKYPKYDDNILAGTKSTKTKQVLKDNAKQTCYSKIKPNFGT
Ga0307513_1002557823300031456EctomycorrhizaMSQTTTKYPKYDDNILAGTKSTETKQVLKDNAKQTRYGKIKPNCGT
Ga0307513_1002559263300031456EctomycorrhizaMKLMRMTQTTTKYPKYDDNILEETKSTETKQVLKDNAKQTCYSKTKPDSET
Ga0307513_1005848413300031456EctomycorrhizaMRMTQTTAKYTKYDDKKLEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307513_1007471033300031456EctomycorrhizaMKMTQTTTNYLKYDDNILLGTKSIETKQVLKANTKHTRYGKTKPDSGT
Ga0307513_1009612143300031456EctomycorrhizaMKLMRVPQTIAKYPKYDDNIMEGTKSTKIKQVLKDNAKQTRYNKTKPDSGT
Ga0307513_1009996513300031456EctomycorrhizaMRMTQTTAKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKTDSGT
Ga0307513_1013005913300031456EctomycorrhizaMKLMRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307513_1029027513300031456EctomycorrhizaQTTVKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYNKTKPDFGT
Ga0307513_1030395833300031456EctomycorrhizaMTQTTVKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYNKTKPDF
Ga0307513_1031851323300031456EctomycorrhizaMKMTQTIDKYPKYNDNILEETKSTETKQVLKDNAKQTCYGKTKRNSGT
Ga0307513_1049902413300031456EctomycorrhizaMKMTQKTTKHPKYDDNILEGMKSTETKQVLKANTRQTRYGKTKPDFRT
Ga0307513_1065005313300031456EctomycorrhizaMTQTIAKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1002079433300031507EctomycorrhizaMKLMRMTQTTAKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYSKTKPDFGT
Ga0307509_1004089723300031507EctomycorrhizaMKLMRMTQTTAKYTKYDDKILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1008704843300031507EctomycorrhizaMKLMRMTQKIAKYPNYDDNILEGTKSIETKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1011495533300031507EctomycorrhizaMKLMRMTQTTAKHPKYDDNILEGTKSTKIKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1014429333300031507EctomycorrhizaKQTDVKVMKMTQTTTNYLKYDDNILLGTKSTETKQVLKANAKHTRYGKTKPDSGT
Ga0307509_1014755343300031507EctomycorrhizaMRMTQTTAKYPKYDDKILEAKKSTETKQVLKDNAKQTRYSKTKPDSRT
Ga0307509_1016716633300031507EctomycorrhizaMRMNQTIDKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1023814513300031507EctomycorrhizaAKYHKYDDNILEGTKLIETKQVLKDNAKQTCYGKTKLDSGT
Ga0307509_1031965123300031507EctomycorrhizaYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1032222913300031507EctomycorrhizaMKLMRMTQTTTKYKKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKLDSGT
Ga0307509_1033454913300031507EctomycorrhizaMTQTTTKYQKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307509_1036727423300031507EctomycorrhizaSQTTTKYPKYDDNILAGTKSTETKQVLKDNAKQTRYGKIKPNCGT
Ga0307509_1060848913300031507EctomycorrhizaMSQTTTKYPKYDDNILAGTKSTETKQVLKDNAKQTRYGKIKPN
Ga0307509_1079375813300031507EctomycorrhizaMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKP
Ga0307508_1002996413300031616EctomycorrhizaTNMKLMRMTQTTTKYQKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKLDSGT
Ga0307508_1007585553300031616EctomycorrhizaMKLMRMTQTTTKYPKFDDKLLEGTKSTATKQVLKDNAKQTRYSKTKPDSRT
Ga0307508_1024014413300031616EctomycorrhizaVKVIKMTQKIAKYPKYDDTILARTKSTETKQVLKDKAKHTCYGKTKPDSRT
Ga0307508_1026385723300031616EctomycorrhizaMKLMRMTQTTAKYPKYDDKILEAKKSTETKQVLKDNAKQTRYSKTKPDSRT
Ga0307508_1031217213300031616EctomycorrhizaMKVMKMTQIIDKYPKYDDNILAGTKSTERKQVLKDNAKQTRYGKIKPESGT
Ga0307508_1036153013300031616EctomycorrhizaMKLMRMTQTTTKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKTDSGT
Ga0307508_1055344713300031616EctomycorrhizaQTTTNYLKYDDNILLGTTSTETKQVLKANAKHTRYGKTKPDSGT
Ga0307508_1084885313300031616EctomycorrhizaMKLMKMTQIIAKYPKYDDNILEGTIETKQVLKDNAKQTCYGKTKLDSGT
Ga0307508_1087634713300031616EctomycorrhizaTNMKLMRMTQTTTKYQKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307514_1001919743300031649EctomycorrhizaMKLMRMTQTTAKHPKYDDNILEETKSTEIKQVLKDNAKQTRYSKTKPDSGT
Ga0307514_1003111113300031649EctomycorrhizaRTDKKQTNMKLMRMIQTTAKYPKYDDKILEGTKSTETKQVLKDNAKQTHYSKTKPDSGT
Ga0307514_1005273413300031649EctomycorrhizaMTQTIAKYPKYNDNILEETKSTETKQVLKDNAKQTCYGKTKRNSGT
Ga0307514_1008963353300031649EctomycorrhizaMKITQTAAPYPKYNDNMLEGTKSTETKQLSKDNAKQTCYGKTKPDSGT
Ga0307514_1010175513300031649EctomycorrhizaMKMTQKTTKHPKYDDNILEGMKSTETKQVLKANARQTRYGNTKPDFRT
Ga0307514_1016255123300031649EctomycorrhizaMKMTQTIAKYPKYNDNILEETKSTETKQVLKDNAKQTCYGK
Ga0307514_1018363813300031649EctomycorrhizaMKMTQTTAKYPKYDDNLLEGTKSTKTKQVLKDNAKQTRYGKAEPDSRT
Ga0307514_1050697323300031649EctomycorrhizaTPAKYPKYNDNILEGTKSTKTKQVLKDNAKQIVTARQKPDSGN
Ga0307516_1004265333300031730EctomycorrhizaMTQTTTKYPKYDDNILARTKSTETKQVLKDNAKQNRYGKTKPDSKT
Ga0307516_1007889353300031730EctomycorrhizaMRMTQTTAKYPKYNDNILEGTKSTKTKQVLKDNAKQIVTARQKPDSGN
Ga0307516_1013179023300031730EctomycorrhizaMKMTQTTAKYPKYDDNILAGTKSTKTKQVLKDNAKQTHYNKTKPDYGT
Ga0307516_1015606933300031730EctomycorrhizaNVKVMKMTETTAKYPKYDDHILARTKSTEEKLLLKDNAKQTRYGKTKPDSGT
Ga0307516_1020768713300031730EctomycorrhizaMKLMRMTQTTVKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYNKTKPDFET
Ga0307516_1022194533300031730EctomycorrhizaMKLMRMTQTTANYPKYDDNILEETKSTETKQVLKDNAKQTCYSKTKPDSGT
Ga0307516_1026895813300031730EctomycorrhizaSLHRFQMKMMKMTQTIAKYPKYNDNILEETKSTETKQVLKDNAKQTCYGKTKRNSGT
Ga0307516_1057234713300031730EctomycorrhizaDRKQTNVKVMKMTETTAKYPKYDDHILARTKSTEAKLLLKDNAKQTRYGKTKPDSGT
Ga0307518_1002562633300031838EctomycorrhizaMKLMRMTQKIAKYPNYDDNILEGTKSIETKQVLKDNAKQTRYSKTKPDSRT
Ga0307518_1007771823300031838EctomycorrhizaMKMTQKTAKYPKYDDNILAGTKSIETKQVLKNNAKQTSYGKTKPDSRT
Ga0307518_1021044723300031838EctomycorrhizaMTQTTTKYKKYDDNIPEGAKSTETKQVLKDNAKQTRYSKTKLDSGT
Ga0307518_1029558713300031838EctomycorrhizaKQTSVKVIKMTQKIAKYPKYDDTILARTKSTETKQVLKDKAKHTCYGKTKPDSRT
Ga0307518_1031757523300031838EctomycorrhizaVDHIEPSESLHRFQMKMMKMTQTIAKYPKYNDNILEETKSTETKQVLKDNAKQTCYGKTKRNSGT
Ga0325403_100298773300032354XylemMKLMRMTQTTAKYPKYDDNILEGTKSTETKQVLKDNAKQIVTARQKPDSGN
Ga0325403_100351153300032354XylemMTQTTAKYPKYDDNILSGTKSMETKQVLKDNTKQTHYCKTKPDSGT
Ga0325403_100697923300032354XylemMKMTQTTTKYPKYDDNILEGTKSIETKQVLKDNAKQTRYGKTKPDSRT
Ga0325403_101159383300032354XylemMKMTQTTAKYLKNDDILAGTKSTETKQVLKDHANQARYSMTKPDSRT
Ga0325403_101328623300032354XylemMKITQTAAKYPKYDDNMLEGTKSTETKQLLKDNAKQTCYDKTKPDSRT
Ga0325403_101849123300032354XylemMTQTTTKYPKYDDNIMAGTKSTETKQVLKDNAKQTCYSKIKPNSGI
Ga0325403_102925153300032354XylemMKMTQKIAKYLKYDDNKLAGTKSTDTKQVLKANAKQTRYDKTKPDSRT
Ga0325403_103645453300032354XylemKMTQTTAKYDDNILEGTKSIKTKQVLKDNAKQTCYSKTKPDSET
Ga0325403_103974153300032354XylemMRMSQTTAKYPKYDDNTLEGTKSTETKQVLKDNAKQTCYSKTKPDSGT
Ga0325403_104322523300032354XylemMKMIQTIAKYPKYDDSILAGTKLTETKQVLKDNAKQTRYGKTKPDSGT
Ga0325403_104682323300032354XylemMTQTAAKYLKYDDNILAGTKSIETKQVLKDNTKNTRYSKTKPDSRT
Ga0325403_104859513300032354XylemMTQTTAKYLKYDDNILAGTKSIETKQVLKDNTKNTRYSKTKPDSGT
Ga0325403_105282923300032354XylemMKMTQTTAKYSKYNDNILEGTKSIETKQVLKDNAKQTRYSKTKPNSGT
Ga0325403_105368513300032354XylemMKMTLKTAKYPKYDDNILEGTKSIETKHSLKNNAKQARYGKTKPDSRT
Ga0325403_106604413300032354XylemMTQTTAKYDDNILEGTKSIKTKQVLKDNAKQTCYSKTKPDS
Ga0325403_108201233300032354XylemMSQKTTKYPKYDDNILAGTKSTKTKQVLKDNAKQTRYGKIKPDCGT
Ga0325403_108438713300032354XylemKMTQTTAKYDDNILEGTKSIKTKQVLKDNAKQTCYSKTKPDSGT
Ga0325403_109936213300032354XylemMKLMRMTQTTAKYPKYDDNILLEGTKSTGTKQVLKDNAKQTRYSKTKPDSRT
Ga0325401_102092963300032355XylemMKITQTAAKYPKYDDNMLEGTKSTETKQLLEDNAKQTCYDKTKPDSRT
Ga0325401_104287713300032355XylemMKMIQTTMKYPKYGDNILAGTKSIETKQVLKVNTKHTRYGKTKPDSRT
Ga0325401_107998423300032355XylemMKLMRMSQTTAKYPKYDDNTLEGTKSTETKQVLKDNAKQTCYSKTKPDSGT
Ga0325400_1011417103300032374XylemMKMIQTIAKYPKYDDSILAGTKLTETKQVLKDNAKQTRYGKTKPDFGT
Ga0325405_100409013300032389XylemMTQTAAKYLKYDDNILAGTKSIETKQVLKDNTKKTRYSKTKPDSGT
Ga0325405_100606223300032389XylemMRMTQTTAKYPKYDDNILLEGTKSTGTKQVLKDNAKQTRYSKTKPDSRT
Ga0325405_100667363300032389XylemMKLMKMTQTTAKYDDNILEGTKSIKTKQVLKDNAKQTCYSKTKLDSGT
Ga0325405_103564213300032389XylemMKMTQKTAKYPKYDYNKLARTKSTETKQVLKANAKQTRYDKTKSISGT
Ga0325404_100410043300032390XylemMKMTQTAAKYLKYDDNILAGTKSIETKQVLKDNTKKTRYSKTKPDSGT
Ga0325404_102477733300032390XylemMKITQTAAKYPKYDDNMLEGTKSTETKQLLKDNTKQTCYDKTKPDSRT
Ga0325404_107343823300032390XylemVKVVKMTQTTAKYPKYDDNILSGTKSMETKQVLKDNTKQTHYCKTKPDSGT
Ga0325414_104222353300032741LeafMKLMRMSQTTAKYPKYDDNTLEGTKSTETKQVLKDNAKQTCYSKTKLDSGT
Ga0307507_1000869843300033179EctomycorrhizaMKLMKMTQTTGKYLKYDDDILEGTKSIETKQVLKDNAKQTRYSKTKPDSGT
Ga0307507_1008338743300033179EctomycorrhizaMRMNQTTDKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307507_1015711813300033179EctomycorrhizaMRMTQTTAKHPKYDDNILEETKSTEIKQVLKDNAKQTRYSKTKPDSGT
Ga0307507_1022926213300033179EctomycorrhizaMRMTQTTAKYPKYDDKILEGTKLTETKQVWKDNAKQTRYSKTKPNSGT
Ga0307507_1068326923300033179EctomycorrhizaRKQTNMKLMRMTQTTVKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPDSGT
Ga0307510_1003178123300033180EctomycorrhizaMKLIRMTQTTAKYPKYDDKILEGTKSTETKQVLKDNAKQTHYSKTKPDSGT
Ga0307510_1008142153300033180EctomycorrhizaMKLMRMTQTTAKYPKYDDKVLKGTKSTETKQVLKDNAKQTRYSKTKPDFGT
Ga0307510_1010869723300033180EctomycorrhizaMKLMRMTQTTVKYPKYDDNILEGTKSTETKQVLKDNAKQTRYSKTKPNSGT
Ga0307510_1011981713300033180EctomycorrhizaMKMTQIIAKYPKYDDNILEGTIETKQVLKDNAKQTCYGKTKLDSGT
Ga0307510_1048759313300033180EctomycorrhizaMRMTQTTAKHPKYDDNILEGTKSTEIKQVLKDNAKQTRYSKTKPDSGT
Ga0307510_1055303413300033180EctomycorrhizaTNVKLMKMTQTTAKYPKYNDNILEGTKSTETKQVLKDNAKQTRYGKTKPDSGT
Ga0307510_1066235713300033180EctomycorrhizaMRMTQTTVKYPKYDDKVLEGTKSTETKQVLKDNAKQTRYNKTKPDFGT
Ga0325419_035811_3327_34733300034389LeafMKMTQKTAKYPNYDYNKLARTKSTETKQVLKANAKQTRYDKTKPISGT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.