Metagenome / Metatranscriptome Family F037034

Basic Information
Family ID	F037034
Family Type	Metagenome / Metatranscriptome
Number of Sequences	168
Average Sequence Length	40 residues
Representative Sequence	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNF
Number of Associated Samples	106
Number of Associated Scaffolds	168

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	67.27 %
% of genes near scaffold ends (potentially truncated)	98.21 %
% of genes from short scaffolds (< 2000 bps)	97.62 %
Associated GOLD sequencing projects	102
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.21

Most Common Taxonomy
Group	Unclassified (99.405 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (38.691 % of family members)
Environment Ontology (ENVO)	Unclassified (77.976 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (74.405 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.40 %
All Organisms	root	All Organisms	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.40 %
Viruses	superkingdom	All Organisms → Viruses	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.40 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.60 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005330\|Ga0070690_101041220	Not Available	646	Open in IMG/M
3300005347\|Ga0070668_101759731	Not Available	569	Open in IMG/M
3300005467\|Ga0070706_102023372	Not Available	521	Open in IMG/M
3300005617\|Ga0068859_101056929	Not Available	892	Open in IMG/M
3300005617\|Ga0068859_101248721	Not Available	818	Open in IMG/M
3300005617\|Ga0068859_101872002	Not Available	663	Open in IMG/M
3300005618\|Ga0068864_100563523	All Organisms → Viruses → Predicted Viral	1102	Open in IMG/M
3300005841\|Ga0068863_101371222	Not Available	714	Open in IMG/M
3300005841\|Ga0068863_102558365	Not Available	519	Open in IMG/M
3300005842\|Ga0068858_102213665	Not Available	543	Open in IMG/M
3300005843\|Ga0068860_100809206	Not Available	950	Open in IMG/M
3300005843\|Ga0068860_101407674	Not Available	718	Open in IMG/M
3300005843\|Ga0068860_101896753	Not Available	617	Open in IMG/M
3300005843\|Ga0068860_102260125	Not Available	564	Open in IMG/M
3300005843\|Ga0068860_102425040	Not Available	544	Open in IMG/M
3300005844\|Ga0068862_102039165	Not Available	584	Open in IMG/M
3300009092\|Ga0105250_10453262	Not Available	576	Open in IMG/M
3300009101\|Ga0105247_11447680	Not Available	558	Open in IMG/M
3300009980\|Ga0105135_123884	Not Available	552	Open in IMG/M
3300009990\|Ga0105132_124315	Not Available	617	Open in IMG/M
3300009992\|Ga0105120_1003452	Not Available	1273	Open in IMG/M
3300009992\|Ga0105120_1031630	Not Available	630	Open in IMG/M
3300010371\|Ga0134125_12156355	Not Available	606	Open in IMG/M
3300010399\|Ga0134127_12656968	Not Available	580	Open in IMG/M
3300010399\|Ga0134127_12893330	Not Available	559	Open in IMG/M
3300010400\|Ga0134122_12495690	Not Available	566	Open in IMG/M
3300012949\|Ga0153798_10262338	Not Available	575	Open in IMG/M
3300014968\|Ga0157379_11887792	Not Available	588	Open in IMG/M
3300015270\|Ga0182183_1009521	Not Available	981	Open in IMG/M
3300015290\|Ga0182105_1086245	Not Available	547	Open in IMG/M
3300015301\|Ga0182184_1080932	Not Available	544	Open in IMG/M
3300015306\|Ga0182180_1086975	Not Available	519	Open in IMG/M
3300015306\|Ga0182180_1092947	Not Available	507	Open in IMG/M
3300015310\|Ga0182162_1110484	Not Available	535	Open in IMG/M
3300015311\|Ga0182182_1018102	Not Available	949	Open in IMG/M
3300015311\|Ga0182182_1054849	Not Available	669	Open in IMG/M
3300015312\|Ga0182168_1040948	Not Available	785	Open in IMG/M
3300015312\|Ga0182168_1094144	Not Available	583	Open in IMG/M
3300015312\|Ga0182168_1102961	Not Available	563	Open in IMG/M
3300015313\|Ga0182164_1109893	Not Available	549	Open in IMG/M
3300015315\|Ga0182120_1030560	Not Available	871	Open in IMG/M
3300015315\|Ga0182120_1122500	Not Available	529	Open in IMG/M
3300015316\|Ga0182121_1112714	Not Available	560	Open in IMG/M
3300015317\|Ga0182136_1059780	Not Available	695	Open in IMG/M
3300015317\|Ga0182136_1068995	Not Available	660	Open in IMG/M
3300015325\|Ga0182148_1032430	Not Available	856	Open in IMG/M
3300015325\|Ga0182148_1112862	Not Available	557	Open in IMG/M
3300015325\|Ga0182148_1130685	Not Available	525	Open in IMG/M
3300015326\|Ga0182166_1026372	Not Available	909	Open in IMG/M
3300015328\|Ga0182153_1062940	Not Available	703	Open in IMG/M
3300015329\|Ga0182135_1025144	Not Available	965	Open in IMG/M
3300015329\|Ga0182135_1130886	Not Available	539	Open in IMG/M
3300015331\|Ga0182131_1155203	Not Available	504	Open in IMG/M
3300015333\|Ga0182147_1081156	Not Available	679	Open in IMG/M
3300015333\|Ga0182147_1094547	Not Available	640	Open in IMG/M
3300015334\|Ga0182132_1104986	Not Available	615	Open in IMG/M
3300015335\|Ga0182116_1094948	Not Available	661	Open in IMG/M
3300015335\|Ga0182116_1108105	Not Available	627	Open in IMG/M
3300015335\|Ga0182116_1161349	Not Available	528	Open in IMG/M
3300015336\|Ga0182150_1033436	Not Available	910	Open in IMG/M
3300015337\|Ga0182151_1045055	Not Available	824	Open in IMG/M
3300015339\|Ga0182149_1136314	Not Available	558	Open in IMG/M
3300015339\|Ga0182149_1158737	Not Available	523	Open in IMG/M
3300015348\|Ga0182115_1091367	Not Available	949	Open in IMG/M
3300015348\|Ga0182115_1153010	Not Available	738	Open in IMG/M
3300015348\|Ga0182115_1246499	Not Available	569	Open in IMG/M
3300015349\|Ga0182185_1229886	Not Available	563	Open in IMG/M
3300015350\|Ga0182163_1146239	Not Available	734	Open in IMG/M
3300015350\|Ga0182163_1156060	Not Available	710	Open in IMG/M
3300015352\|Ga0182169_1252738	Not Available	572	Open in IMG/M
3300015352\|Ga0182169_1315727	Not Available	501	Open in IMG/M
3300015353\|Ga0182179_1281691	Not Available	539	Open in IMG/M
3300015353\|Ga0182179_1283559	Not Available	537	Open in IMG/M
3300015353\|Ga0182179_1283803	Not Available	537	Open in IMG/M
3300015353\|Ga0182179_1326513	Not Available	501	Open in IMG/M
3300015354\|Ga0182167_1195146	Not Available	742	Open in IMG/M
3300015354\|Ga0182167_1231392	Not Available	670	Open in IMG/M
3300017412\|Ga0182199_1137891	Not Available	588	Open in IMG/M
3300017412\|Ga0182199_1202536	Not Available	505	Open in IMG/M
3300017414\|Ga0182195_1202222	Not Available	522	Open in IMG/M
3300017439\|Ga0182200_1081191	Not Available	645	Open in IMG/M
3300017440\|Ga0182214_1149305	Not Available	519	Open in IMG/M
3300017445\|Ga0182198_1099766	Not Available	662	Open in IMG/M
3300017692\|Ga0182210_1161255	Not Available	502	Open in IMG/M
3300017792\|Ga0163161_10741854	Not Available	821	Open in IMG/M
3300020031\|Ga0182119_105548	Not Available	548	Open in IMG/M
3300020223\|Ga0182118_102946	Not Available	807	Open in IMG/M
3300020223\|Ga0182118_109145	Not Available	587	Open in IMG/M
3300020223\|Ga0182118_110104	Not Available	571	Open in IMG/M
3300025517\|Ga0207869_1043190	Not Available	575	Open in IMG/M
3300025529\|Ga0207865_122031	Not Available	931	Open in IMG/M
3300025903\|Ga0207680_11096327	Not Available	569	Open in IMG/M
3300025906\|Ga0207699_10884496	Not Available	659	Open in IMG/M
3300025923\|Ga0207681_11609464	Not Available	544	Open in IMG/M
3300025972\|Ga0207668_10280748	Not Available	1365	Open in IMG/M
3300025972\|Ga0207668_11096658	Not Available	713	Open in IMG/M
3300026035\|Ga0207703_10459766	Not Available	1190	Open in IMG/M
3300026035\|Ga0207703_11185268	Not Available	734	Open in IMG/M
3300026035\|Ga0207703_12044750	Not Available	549	Open in IMG/M
3300026095\|Ga0207676_11930420	Not Available	589	Open in IMG/M
3300028049\|Ga0268322_1007879	Not Available	923	Open in IMG/M
3300028050\|Ga0268328_1009591	Not Available	976	Open in IMG/M
3300028050\|Ga0268328_1052779	Not Available	564	Open in IMG/M
3300028050\|Ga0268328_1066446	Not Available	517	Open in IMG/M
3300028051\|Ga0268344_1023261	Not Available	523	Open in IMG/M
3300028051\|Ga0268344_1026474	Not Available	503	Open in IMG/M
3300028053\|Ga0268346_1008881	Not Available	822	Open in IMG/M
3300028053\|Ga0268346_1022268	Not Available	628	Open in IMG/M
3300028054\|Ga0268306_1033560	Not Available	510	Open in IMG/M
3300028055\|Ga0268338_1028743	Not Available	580	Open in IMG/M
3300028056\|Ga0268330_1025402	Not Available	692	Open in IMG/M
3300028058\|Ga0268332_1000235	Not Available	2679	Open in IMG/M
3300028058\|Ga0268332_1008328	Not Available	1043	Open in IMG/M
3300028061\|Ga0268314_1042396	Not Available	550	Open in IMG/M
3300028061\|Ga0268314_1050165	Not Available	517	Open in IMG/M
3300028062\|Ga0268342_1004788	Not Available	1032	Open in IMG/M
3300028062\|Ga0268342_1004830	Not Available	1029	Open in IMG/M
3300028063\|Ga0268350_1055942	Not Available	570	Open in IMG/M
3300028064\|Ga0268340_1041149	Not Available	659	Open in IMG/M
3300028064\|Ga0268340_1062881	Not Available	567	Open in IMG/M
3300028140\|Ga0268334_1002012	Not Available	1045	Open in IMG/M
3300028140\|Ga0268334_1008348	Not Available	661	Open in IMG/M
3300028142\|Ga0268347_1005982	Not Available	850	Open in IMG/M
3300028142\|Ga0268347_1009863	Not Available	739	Open in IMG/M
3300028142\|Ga0268347_1017612	Not Available	621	Open in IMG/M
3300028142\|Ga0268347_1022053	Not Available	581	Open in IMG/M
3300028142\|Ga0268347_1033225	Not Available	510	Open in IMG/M
3300028142\|Ga0268347_1034225	Not Available	505	Open in IMG/M
3300028144\|Ga0268345_1017810	Not Available	589	Open in IMG/M
3300028144\|Ga0268345_1023267	Not Available	543	Open in IMG/M
3300028147\|Ga0268303_106228	Not Available	527	Open in IMG/M
3300028150\|Ga0268343_1007145	Not Available	711	Open in IMG/M
3300028151\|Ga0268308_1000551	Not Available	1897	Open in IMG/M
3300028151\|Ga0268308_1014647	Not Available	658	Open in IMG/M
3300028151\|Ga0268308_1023708	Not Available	565	Open in IMG/M
3300028153\|Ga0268320_1025412	Not Available	531	Open in IMG/M
3300028154\|Ga0268341_1008839	Not Available	742	Open in IMG/M
3300028154\|Ga0268341_1022763	Not Available	560	Open in IMG/M
3300028154\|Ga0268341_1023043	Not Available	558	Open in IMG/M
3300028155\|Ga0268349_1029211	Not Available	737	Open in IMG/M
3300028248\|Ga0268312_1015058	Not Available	676	Open in IMG/M
3300028251\|Ga0268324_1011232	Not Available	651	Open in IMG/M
3300028251\|Ga0268324_1022284	Not Available	530	Open in IMG/M
3300028256\|Ga0268304_1006383	Not Available	664	Open in IMG/M
3300028262\|Ga0268310_1050927	Not Available	507	Open in IMG/M
3300028379\|Ga0268266_10747716	Not Available	943	Open in IMG/M
3300028379\|Ga0268266_11216543	Not Available	728	Open in IMG/M
3300028381\|Ga0268264_11693689	Not Available	643	Open in IMG/M
3300028381\|Ga0268264_11990600	Not Available	590	Open in IMG/M
3300028463\|Ga0268325_103426	Not Available	553	Open in IMG/M
3300028466\|Ga0268321_110398	Not Available	520	Open in IMG/M
3300028468\|Ga0268317_1003431	Not Available	741	Open in IMG/M
3300028468\|Ga0268317_1012384	Not Available	515	Open in IMG/M
3300028469\|Ga0268337_1012630	Not Available	577	Open in IMG/M
3300028470\|Ga0268307_1005012	Not Available	806	Open in IMG/M
3300028472\|Ga0268315_1004969	Not Available	837	Open in IMG/M
3300028475\|Ga0268327_1012594	Not Available	636	Open in IMG/M
3300028476\|Ga0268329_1007403	Not Available	753	Open in IMG/M
3300028477\|Ga0268309_1012349	Not Available	595	Open in IMG/M
3300028523\|Ga0268313_1018488	Not Available	518	Open in IMG/M
3300028527\|Ga0268335_1004678	Not Available	752	Open in IMG/M
3300028529\|Ga0268311_1007784	Not Available	759	Open in IMG/M
3300032465\|Ga0214493_1115443	Not Available	634	Open in IMG/M
3300032465\|Ga0214493_1118354	Not Available	625	Open in IMG/M
3300032490\|Ga0214495_1097113	Not Available	680	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	94.05%
Environmental	Environmental	4.17%
Engineered	Engineered	1.79%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	94.05%
Terrestrial	Environmental → Terrestrial	4.17%
Lab Enrichment	Engineered → Lab Enrichment	1.19%
Bioreactor	Engineered → Bioreactor	0.60%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	73.81%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.90%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.95%
Soil	Environmental → Terrestrial → Soil	4.17%
Unclassified	Host-Associated → Plants → Unclassified	2.38%
Defined Media	Engineered → Lab Enrichment → Defined Media	1.19%
Unclassified	Engineered → Bioreactor → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	73.81%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.90%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.17%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.38%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	2.38%
Loam	Environmental → Terrestrial → Soil → Loam	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.79%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	1.19%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	73.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.90%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.17%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.38%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	2.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.79%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	1.19%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	38.69%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	35.12%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	11.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.17%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.38%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	2.38%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.19%
Ionic Liquid And High Solid Enriched	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched	1.19%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300020031	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300025517	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-5-D (SPAdes)	Engineered	Open in IMG/M
3300025529	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-4-D (SPAdes)	Engineered	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028147	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028155	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028463	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070690_1010412201	3300005330	Switchgrass Rhizosphere	MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRVRGTKFCTS
Ga0070668_1017597311	3300005347	Switchgrass Rhizosphere	MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNF
Ga0070706_1020233721	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MVPNAPKQYETNQNISLGSNGVDRVRSLRKILMRLRGTKFCTSSD
Ga0068859_1010569292	3300005617	Switchgrass Rhizosphere	MVPNAPKWYEMHQNVSLGSNGVDRVRSLRKIPMRLHG
Ga0068859_1012487211	3300005617	Switchgrass Rhizosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLQKIPMRLRGINFCT
Ga0068859_1018720022	3300005617	Switchgrass Rhizosphere	MVANAPKRYGMHQNMSLGSNGVDRVGSLRKILTRL
Ga0068864_1005635231	3300005618	Switchgrass Rhizosphere	MVPNAPELYETHQNVSLGSNGVDRVRSLRKILTRLRGTNFC
Ga0068863_1013712221	3300005841	Switchgrass Rhizosphere	MVPNAPKRYETHQNISLGSNGVDRVRSLRKILMRLRGTKF
Ga0068863_1025583651	3300005841	Switchgrass Rhizosphere	MVPNAPKWYEMHLNISLGSNGLDRVRSLRKIPTRLRGTN
Ga0068858_1022136652	3300005842	Switchgrass Rhizosphere	VSCSYETIPNAPKHHATHQNMSLGSNGVDWVCSLQKIPM*
Ga0068860_1008092062	3300005843	Switchgrass Rhizosphere	VVQNAPKWYETQQNMSLVSNGVDLVRSLRKILTRLRGTNFCTYS
Ga0068860_1014076741	3300005843	Switchgrass Rhizosphere	MVPDAPKRYETNQNISLGSNGVDRVRSLRKILMRLRGTKFC
Ga0068860_1018967531	3300005843	Switchgrass Rhizosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTN
Ga0068860_1022601251	3300005843	Switchgrass Rhizosphere	MIPNAPKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNF
Ga0068860_1024250401	3300005843	Switchgrass Rhizosphere	MISNETKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNF
Ga0068862_1020391651	3300005844	Switchgrass Rhizosphere	MVPNALKRKEKHQNKSLGSNGVDREHSLRKILARHRGMNFCINC
Ga0105250_104532621	3300009092	Switchgrass Rhizosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLR
Ga0105247_114476801	3300009101	Switchgrass Rhizosphere	MVPNARKWYEMHQNMSLGSNAVDQVHLLRIILICLHGINF
Ga0105135_1238841	3300009980	Switchgrass Associated	NAPKHYKTHQFMSLASNGVDRVRSLQKIPMGLHGTKFFTS*
Ga0105132_1243151	3300009990	Switchgrass Associated	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSSA
Ga0105120_10034521	3300009992	Switchgrass Associated	MVPNAHKRKETHQNMSLGSNGVDRERSLRKIMTRLRGMN
Ga0105120_10316302	3300009992	Switchgrass Associated	MVPNAPKWKETHQNMSLGSNGVDREHTLRKISKQLHGTIFW
Ga0134125_121563551	3300010371	Terrestrial Soil	MVPNAPKWYEAHQNMSLGSNGVDRMLSLRKIPMRL
Ga0134127_126569682	3300010399	Terrestrial Soil	MVPNAPKWYETHENMSLGSNGVDRVHWLRKIPMQL
Ga0134127_128933301	3300010399	Terrestrial Soil	MDAPKWYEMHQNISLGPNGVDRVRSLRKIPTQLRDMNFCT
Ga0134122_124956901	3300010400	Terrestrial Soil	MVANAPKWYEMHQNMSLGSNGVHRVGLLRKILTRLRGTNFCT
Ga0153798_102623381	3300012949	Switchgrass Degrading	MVPNAPKWYETHQNMSLWSNGVDRVLSFRKIPMRLRGT
Ga0157379_118877921	3300014968	Switchgrass Rhizosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCT
Ga0182183_10095212	3300015270	Switchgrass Phyllosphere	MVPNASKWYETHQKVSLGSNGVDRARSLRKILTRLRG
Ga0182105_10862451	3300015290	Switchgrass Phyllosphere	MVPNAPKWNEMDQNMSLGSNSVDRECLLRKFLTRHRGTNFCIN
Ga0182184_10809321	3300015301	Switchgrass Phyllosphere	MVPNARKRYESRQNMSLGSNGVDRVRSLRKIPMRLRGTNFCTSS
Ga0182180_10869751	3300015306	Switchgrass Phyllosphere	MVPNAPKRYETNKNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDRFPPS
Ga0182180_10929471	3300015306	Switchgrass Phyllosphere	MVPNAPKWYETHQNFSLGSNGVDRVLSFRKIPMQLRGTNFCTRSAR
Ga0182162_11104841	3300015310	Switchgrass Phyllosphere	MVPNATKWYKTQQNMSLGSNGVDRVRLLRKIPMRLR
Ga0182182_10181021	3300015311	Switchgrass Phyllosphere	MVAKAPKWYERHQNMSLGSNGVDRVGSLRKILTRLRG
Ga0182182_10548491	3300015311	Switchgrass Phyllosphere	MVPNAPKRYETHQNISLGSNGVDRVRSL*KIPMRLRGTN
Ga0182168_10409481	3300015312	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLCGTNFCIS
Ga0182168_10941441	3300015312	Switchgrass Phyllosphere	MVENAPKWYEIHQNMSLGSNGVDRVRSLRKILTRLRDTN
Ga0182168_11029611	3300015312	Switchgrass Phyllosphere	MVPNAHKWYETHQNISLGSNGVDRARSLRKIPTRLRGT
Ga0182164_11098931	3300015313	Switchgrass Phyllosphere	MVANAPKWYEMHQNMSLGSNGVHRVGSLRKILTRLR
Ga0182120_10305601	3300015315	Switchgrass Phyllosphere	MVANAPKWKETHQNMFLGSNSVDQEHSLRKIPTRLRGT
Ga0182120_11225001	3300015315	Switchgrass Phyllosphere	MVANAPKRYEMQQNMSLGSNGVDRVLSWRKIPMRLRGTNFC
Ga0182121_11127141	3300015316	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNF
Ga0182136_10597801	3300015317	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSLWSNGVDRVLSFRKIPMRLR
Ga0182136_10689951	3300015317	Switchgrass Phyllosphere	PKWHETHQNISLVLNGVDLVRSLRKIAMRLRGTNF*
Ga0182148_10324301	3300015325	Switchgrass Phyllosphere	MDPNAPKLYEMHQNISLGPNGVDRVRSLRKIPTQLR
Ga0182148_11128621	3300015325	Switchgrass Phyllosphere	MVPNAPKQYETNQNIGLGANGVDRVRSLRIIPKRLRGTNFCTSSARFASSF
Ga0182148_11306851	3300015325	Switchgrass Phyllosphere	MVANAPKWYEMHQNMSLGSNGVDRVLSLRKISMRLR
Ga0182166_10263721	3300015326	Switchgrass Phyllosphere	MVANAPKRYEIHQNMSLGSNGVDRVGLLRKILTQLRGTNF
Ga0182153_10629401	3300015328	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSFGSNGMDRMISLRKIPMRLHGTNFY
Ga0182135_10251441	3300015329	Switchgrass Phyllosphere	MVLDALKWYEMHQNISLGPNGVDRVHSLRKIPTRLRG
Ga0182135_11308861	3300015329	Switchgrass Phyllosphere	MVMDAPKWYEMHQNISLGPNGVDRVRSLRKIPTQL
Ga0182131_11552031	3300015331	Switchgrass Phyllosphere	MVPNAPKWYEMHQNVSLGSNGVDRVRSLRKIPTRLCGTN
Ga0182147_10811561	3300015333	Switchgrass Phyllosphere	MVPNAPKWKETKQNTSLGSNGVDRERSL*KILARYRGMNFCIN
Ga0182147_10945471	3300015333	Switchgrass Phyllosphere	MVPNSLKQYQMHQNMSLGSNGMDRVRSLRKIPTQLCGTNF
Ga0182132_11049861	3300015334	Switchgrass Phyllosphere	MVPNAPKHYKTQQNMSLGSNGVDRVRSLRKISRLF
Ga0182116_10949481	3300015335	Switchgrass Phyllosphere	MIPNAPKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNFCINCTS
Ga0182116_11081051	3300015335	Switchgrass Phyllosphere	MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDRFPPSFLR
Ga0182116_11613491	3300015335	Switchgrass Phyllosphere	MISNETKHYEPDQNMGLGSNGVDRVRSL*KIPTRLRGTNFCINCTS
Ga0182150_10334361	3300015336	Switchgrass Phyllosphere	MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTTHRGTNF
Ga0182151_10450551	3300015337	Switchgrass Phyllosphere	MVQNAPKWYETQQNMSLGSNGVDRVRSLRKIPTRLRGTNF
Ga0182149_11363141	3300015339	Switchgrass Phyllosphere	MVPNAHKLYEMHQNVSLGSNGVDRVRSLRKIPMRLRFTNFCTS
Ga0182149_11587371	3300015339	Switchgrass Phyllosphere	MVPNAPKRYEMHQNISLGSNGVDQVRSLRKIPMQLRGANFCTSSARFAPS
Ga0182133_11741301	3300015340	Switchgrass Phyllosphere	MLPNSTKRTENVSLGSNGVDRVRSLRKIPTRLRGTNF
Ga0182115_10913672	3300015348	Switchgrass Phyllosphere	SNETIQNAPKHYKMNMSLRSNGLDRVRSLRKILMRLYGTN*
Ga0182115_11530101	3300015348	Switchgrass Phyllosphere	MVLYAPEWYETHQNVSLGSNGVDRVRSLPKIPTQLRGTNFCTSSARFPS
Ga0182115_12464991	3300015348	Switchgrass Phyllosphere	MVPNALKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCT
Ga0182185_12298861	3300015349	Switchgrass Phyllosphere	MILNAPKLYETYQNMSLGSNGVDRVRSLRKIPK*LRDTN
Ga0182163_11462391	3300015350	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVRSMRNDSTRLRRTNFCTSSERF
Ga0182163_11560601	3300015350	Switchgrass Phyllosphere	VLDALKWYEMHQNISLGPNGVDRVRSLRKIPTRLRGTN
Ga0182169_12527381	3300015352	Switchgrass Phyllosphere	MVPNAPKLYEMHQNNSLRSNGVDRVRFLRKIPTQLCGT
Ga0182169_13157271	3300015352	Switchgrass Phyllosphere	MVPNAPKQYETNQNISLASNGVDRVRSLRKILMRLRGTKFCTSSDRFAPS
Ga0182179_12816911	3300015353	Switchgrass Phyllosphere	MVPNAPKHYKTQQNMSLGSNGVDGVRLLQKIPTQLH
Ga0182179_12835591	3300015353	Switchgrass Phyllosphere	MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDRFPPSFL
Ga0182179_12838031	3300015353	Switchgrass Phyllosphere	MVANAQKRYKMHQNMSLGSNGVDRVGSLRKILTQLRG
Ga0182179_13265131	3300015353	Switchgrass Phyllosphere	MVPNMPKWNEMHQNISLGSNGVDRVRSLRKILMQLRGSNICT
Ga0182167_11951461	3300015354	Switchgrass Phyllosphere	MVPNAPKRYETNQNISLGSNGVDRVRLLEKILMRVRGTKF
Ga0182167_12313921	3300015354	Switchgrass Phyllosphere	LNAPKWHETHQNISLVLNGVDLVRSLRKIAMRLRGTNF*
Ga0182199_11378911	3300017412	Switchgrass Phyllosphere	MVPNGPKWKEMHLNMSLGSSGVDRERSLRKILARYRGMNFCINCTSL
Ga0182199_12025361	3300017412	Switchgrass Phyllosphere	MVPNAPKRYKMHQNVSFRSNGVDRVRSLRKIPKRLRGT
Ga0182195_12022221	3300017414	Switchgrass Phyllosphere	MVPNASKWYEMNQNVSLGTNGVDRVRLLRKILTQLRGTNFCTSS
Ga0182200_10811911	3300017439	Switchgrass Phyllosphere	MVLKAPKYYETHQNVSLGSNGLDRVRSLRKIPTRLRATNF
Ga0182200_11388271	3300017439	Switchgrass Phyllosphere	MVSNAPKNYETHQNMSLGSNGVNRVRSFXKIPARLRAQNFALIAPVQ
Ga0182214_11493051	3300017440	Switchgrass Phyllosphere	MFPNAPKRKEKHQNMSLGSNGVDREHSLRKIITRLRGTN
Ga0182198_10997661	3300017445	Switchgrass Phyllosphere	MVANAPKRYETHQNMSLGSNGVDRVRSLRNILMRLRGTKF
Ga0182210_11612551	3300017692	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNICTSSAR
Ga0163161_107418541	3300017792	Switchgrass Rhizosphere	MVPNAPKRYETNQNISLGSNGVDRVCSLRKILMRVRGTKF
Ga0182119_1055481	3300020031	Switchgrass Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLQKIPMRLRGQ
Ga0182118_1029461	3300020223	Switchgrass Phyllosphere	MVANAPKWYEMHQNMSLGSNGVHRVGLLRKILTQLRGTNFC
Ga0182118_1091451	3300020223	Switchgrass Phyllosphere	MHAPNWYETHQNVSLGLNGVDQVPSLRKILTQLRGTNFCTR
Ga0182118_1101041	3300020223	Switchgrass Phyllosphere	MVPNAPKWYKTHQNMSLGSNGVDRVLSLRKIPMRLRGTNFC
Ga0207869_10431901	3300025517	Ionic Liquid And High Solid Enriched	MVPNAAKWYEMHQNVSLGSNRVDRVRSLRKIRTRLRG
Ga0207865_1220311	3300025529	Ionic Liquid And High Solid Enriched	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCIT
Ga0207680_110963271	3300025903	Switchgrass Rhizosphere	MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFLHYLGPF
Ga0207699_108844961	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MVPNAPKWYETNQNMSLGSNGMDRVLSLRKIPMRLRGINF
Ga0207681_116094641	3300025923	Switchgrass Rhizosphere	MVAKTPKRYETHKNMSLDTNGVDRVGSTRKILTRLRG
Ga0207668_102807481	3300025972	Switchgrass Rhizosphere	MVANAPKWYEMHENMSLGSNGVDRVGSLRKILMRLRGT
Ga0207668_110966581	3300025972	Switchgrass Rhizosphere	MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTRHCGTNF
Ga0207703_104597661	3300026035	Switchgrass Rhizosphere	MVPNAPKRYETNQNISLGSNGVDRVCSLRKILMRVRGTKFCTSSDR
Ga0207703_111852681	3300026035	Switchgrass Rhizosphere	MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFLHYLGPFCTEFCKATKH
Ga0207703_120447501	3300026035	Switchgrass Rhizosphere	MVPNAPKWYGTHQNMSLGSNGVDRVRSLRNDSTQL
Ga0207676_119304201	3300026095	Switchgrass Rhizosphere	MVLDAPKWYKMHQNVSLGTNGVDRVRSLRKILTRLRGT
Ga0268322_10078791	3300028049	Phyllosphere	VLDALKWYEMHQNVSLGPNGVDQVSSLRQILPQLRGTNF
Ga0268328_10095911	3300028050	Phyllosphere	MVPNAPKLYGTHQNVSLGFNWVDLVRSLRKITTRLRGM
Ga0268328_10276781	3300028050	Phyllosphere	MIPNAPKHYETHQNMSLGSNGVDRVRSLRKITTRLRGT
Ga0268328_10527791	3300028050	Phyllosphere	MVQNAPKLYETHQNMSLGSNGVDRVRWLRKIPTRLRGM
Ga0268328_10664461	3300028050	Phyllosphere	MVANEPKQYETHQNMSLGSNGGDRVRLSQILTRLRGTNFCTSS
Ga0268344_10232611	3300028051	Phyllosphere	MVLDAPKLYEMHQNVSLGTNGVDRVRSLRKILTRLRGTN
Ga0268344_10264742	3300028051	Phyllosphere	MVANAPKWYEIHQNMSLGTNRMDRVGLLRKILTQFRVTNF
Ga0268346_10088811	3300028053	Phyllosphere	MVLNALKCYETHQNVSLGSNGVDRAHSLRKIPTRLRGTNFC
Ga0268346_10222681	3300028053	Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCTSS
Ga0268306_10335601	3300028054	Phyllosphere	MVANAPKWYEMHQNMSLGSNGVDRVGLLRKILTRLRGTNF
Ga0268338_10287431	3300028055	Phyllosphere	MVPNAPKRYETNKNISLGSNGVDRVRSLRKILMRVRGTKFCTSSDR
Ga0268330_10254021	3300028056	Phyllosphere	MVPNAPKWYETHQNMSLGSNWVDRVHSMRNDSTRLRRTNF
Ga0268332_10002351	3300028058	Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDLVLSLQKIPMRLRGTNFCI
Ga0268332_10083281	3300028058	Phyllosphere	MVENAPKWYEIHQNMSLGSNGVDRVRSLRKILTRLRDTNFCTS
Ga0268314_10423961	3300028061	Phyllosphere	MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTTHRGT
Ga0268314_10501651	3300028061	Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRMLSLRKIPMRLRGSNFCI
Ga0268342_10047882	3300028062	Phyllosphere	MIPNAPKHYKTDQNKGLGSNGVDRVRSLXKIPTRLC
Ga0268342_10048302	3300028062	Phyllosphere	MVAKQPKRYEMHENISLGTNGVDRVGSLRKILTRLHGT
Ga0268350_10559421	3300028063	Phyllosphere	MVPNAPKRYETNQNISLRSNGVDRVRSLGKILMRVRGTKF
Ga0268340_10411491	3300028064	Phyllosphere	MVQNAPERKEMHQNMSLGSNGVDRERLLQKNLTRHRGRNFSINCT
Ga0268340_10628811	3300028064	Phyllosphere	MVQNAPKWYKTQQNMSLGSNGVDRVRSLRKIPRRLRGTNFCT
Ga0268334_10020121	3300028140	Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLQKIPMRLRGINFCTSS
Ga0268334_10083481	3300028140	Phyllosphere	MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFLH
Ga0268347_10059821	3300028142	Phyllosphere	EGNIMVPNAPKWYETHQNMSLGSNGVDRVLSLLKIPM
Ga0268347_10098631	3300028142	Phyllosphere	MIPNAPKHYEPDQNMGLGSNGVDRVRSLXKIPTRL
Ga0268347_10176121	3300028142	Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGPNF
Ga0268347_10220531	3300028142	Phyllosphere	MVANAPKWYEMHQNMSLGSNGLDRVAPLRKILMRLRGTN
Ga0268347_10332251	3300028142	Phyllosphere	MVANAPKRYEMHQNMSLGSNGVDRVGSLRKILTQLRGTNF
Ga0268347_10342251	3300028142	Phyllosphere	MHPKRYETHQNISLGSNRVDRVRSLRKILMRVRGTKFY
Ga0268345_10178101	3300028144	Phyllosphere	VLDALKWYEIHQNISLGPNGVDRVRSLRKIPTRLRGTNFCTSSAGF
Ga0268345_10232671	3300028144	Phyllosphere	MVPNARKRYETHQYMSLGSNGVDRVRSLPKIPMRLRGTNFCT
Ga0268303_1062281	3300028147	Phyllosphere	MVQNAPKWYETQQNMGLGSNGVDWVRSLRKIPTRLR
Ga0268343_10071451	3300028150	Phyllosphere	MVANAPKRYEIHQNMSLGSNGVDRVGLLRKILTQLRGTNFC
Ga0268308_10005511	3300028151	Phyllosphere	MVPNALKQYETHQNMSLGSNVMDRVPSLRKIPMRLH
Ga0268308_10146471	3300028151	Phyllosphere	MIPNAPKRYETNQNISLGSNGVDRVRSLRKNLMRLRGTK
Ga0268308_10237081	3300028151	Phyllosphere	MVKNAPKHYETHQNISLGSNGVDRVRLSXKTPTRLRRMNFYTNSEHF
Ga0268320_10254121	3300028153	Phyllosphere	MVPNAPKHYKTQQNMSLGSNGVDRVRPLQNIPTQLCR
Ga0268341_10088391	3300028154	Phyllosphere	MVPNAPKWYETHQNMSLWSNGVDRVLSFRKIPMRLRGTN
Ga0268341_10227631	3300028154	Phyllosphere	MVRTCGLIAPKYYEALQNMSLGSNGVVRFCSLRKNLMRLRGT
Ga0268341_10230431	3300028154	Phyllosphere	MVPNAPKRYETNQNISLGSNGVDRVRSLRKILMRLRGTKFCTSSDRFAP
Ga0268349_10292111	3300028155	Phyllosphere	MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRLRGTNFCTSS
Ga0268312_10150581	3300028248	Phyllosphere	MVQNAPKWYETQQNMGLGSNGVDRVRSLRNNLMQLR
Ga0268324_10112321	3300028251	Phyllosphere	MVPNAPKRYETHQNISLGSNGVDRVLSLQKIPTRL
Ga0268324_10222841	3300028251	Phyllosphere	MVPNAPKRYEMHQNISLGSNGLDRVRSLRNILMRLRG
Ga0268304_10063831	3300028256	Phyllosphere	MVAKAPKWYEMHQNMSLGSNGVDRVGSLRKILTRLRG
Ga0268310_10509271	3300028262	Phyllosphere	MVPNAPKWHETHQNMSLGSNGVDRVLSLQKIPKRL
Ga0268266_107477161	3300028379	Switchgrass Rhizosphere	MVPNAPKWYETHQNMSLGSNGVDRVLSLRKIPMRLRGTNFCI
Ga0268266_112165431	3300028379	Switchgrass Rhizosphere	MVPNAPKWKETHQNMSLDSNGVDRERSLQKFLTRHRGTNFCI
Ga0268264_116936891	3300028381	Switchgrass Rhizosphere	MISNETKHYEPDQNMGLGSNGVDRVRSLXKIPTRLRGTNFCINC
Ga0268264_119906001	3300028381	Switchgrass Rhizosphere	MVANAPKWYEMHQNMSLGSNGVDRVGLLRKILTRLRGTNFC
Ga0268325_1034261	3300028463	Phyllosphere	DNQTIPNAPKWYETHQNMSLGSNEVDRVLSLRKIPM
Ga0268321_1103982	3300028466	Phyllosphere	MVPNAPKWKETHQNMSLDSNGVDRERLLRKFLTTH
Ga0268317_10034311	3300028468	Phyllosphere	MVPNAPKRYETHQNISLGSNGVDRLLSLQKIPTRLRGTNFC
Ga0268317_10123841	3300028468	Phyllosphere	MVLNAPKWYEMLQNVSLGSNGVDRVHSLRKILMRVRGTNFCTS
Ga0268337_10126301	3300028469	Phyllosphere	TLLNAPKHYETHQNMTLGSNGVDRVRSLPKIMMRVDGTSF
Ga0268307_10050121	3300028470	Phyllosphere	MVPNAPKWFETRQNMSLGSNGVDRVCLLRKIPMQLRG
Ga0268315_10049692	3300028472	Phyllosphere	MVPNAPKWYETHQNMSLGSNGVDLVLSLQRIPMRLRGTNFCI
Ga0268327_10125941	3300028475	Phyllosphere	MVPNAPKRYETNQNISLGSNGVDRVRSLRKNLMRVRGTKLCTSSNRF
Ga0268329_10074031	3300028476	Phyllosphere	MVANAPKWYGMHQNMSLGSNGVDRVGSLRKILTRLRG
Ga0268309_10123491	3300028477	Phyllosphere	MVPNAPKQKETHQNLSLGSNGVDRERSLRKIQTIHRGTS
Ga0268313_10184881	3300028523	Phyllosphere	MVPNAPKWYETQQNMSLGSNGVDRVLSLRKIPMRLRGTNF
Ga0268335_10046781	3300028527	Phyllosphere	MVANAPKWYEMHQNMSLGSNGVHRVGLLRKILTLL
Ga0268311_10077842	3300028529	Phyllosphere	MVTNAPKWYEMHQNMSLGSNGVDRVGSLRKILTRLRG
Ga0214493_11154431	3300032465	Switchgrass Phyllosphere	MKAPKLYETHQNISLGSNELDRVRSLRKILTRLRGTNFCTRSAR
Ga0214493_11183541	3300032465	Switchgrass Phyllosphere	MVPNAPKWYEAHQNMSLGSNGVDRMLSLRKIPMRLRGTNF
Ga0214495_10971131	3300032490	Switchgrass Phyllosphere	MVPNARKLYETPQNISLGSNGVDRVRSLRKIPTRLRGTKFC

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.21
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.21
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F037034

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign