Metagenome / Metatranscriptome Family F037035

Basic Information
Family ID	F037035
Family Type	Metagenome / Metatranscriptome
Number of Sequences	168
Average Sequence Length	48 residues
Representative Sequence	DHGTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIE
Number of Associated Samples	75
Number of Associated Scaffolds	168

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	49.67 %
% of genes near scaffold ends (potentially truncated)	45.83 %
% of genes from short scaffolds (< 2000 bps)	89.88 %
Associated GOLD sequencing projects	75
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.29

Most Common Taxonomy
Group	Eukaryota (63.690 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (77.381 % of family members)
Environment Ontology (ENVO)	Unclassified (94.643 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (91.667 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 10.96% Coil/Unstructured: 89.04%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 168 Family Scaffolds
PF00665	rve	4.76

COG ID	Name	Functional Category	% Frequency in 168 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	4.76
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	4.76
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	4.76
COG4584	Transposase	Mobilome: prophages, transposons [X]	4.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	63.69 %
Unclassified	root	N/A	36.31 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	63.10 %
Unclassified	root	N/A	36.31 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.60 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	63.10 %
Unclassified	root	N/A	36.31 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.60 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	63.10 %
Unclassified	root	N/A	36.31 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.60 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	63.10 %
Unclassified	root	N/A	36.31 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.60 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	63.10 %
Unclassified	root	N/A	36.31 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	1.79 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1.79 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.19 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.60 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.19 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.60 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	1.19 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.60 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	1.19 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.60 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1.19 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.60 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.31 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1.19 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.60 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005335\|Ga0070666_11013971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	616	Open in IMG/M
3300009092\|Ga0105250_10270199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	730	Open in IMG/M
3300009972\|Ga0105137_107522	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	569	Open in IMG/M
3300009976\|Ga0105128_104363	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	811	Open in IMG/M
3300009976\|Ga0105128_113205	Not Available	596	Open in IMG/M
3300009977\|Ga0105141_120773	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	579	Open in IMG/M
3300009980\|Ga0105135_126236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	535	Open in IMG/M
3300009981\|Ga0105133_101305	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1199	Open in IMG/M
3300009981\|Ga0105133_107514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	764	Open in IMG/M
3300009981\|Ga0105133_110468	Not Available	700	Open in IMG/M
3300009989\|Ga0105131_118265	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	672	Open in IMG/M
3300009989\|Ga0105131_125430	Not Available	609	Open in IMG/M
3300009990\|Ga0105132_117342	Not Available	681	Open in IMG/M
3300009990\|Ga0105132_123561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	623	Open in IMG/M
3300009995\|Ga0105139_1013239	Not Available	1118	Open in IMG/M
3300009995\|Ga0105139_1014210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1096	Open in IMG/M
3300009995\|Ga0105139_1024965	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	924	Open in IMG/M
3300009995\|Ga0105139_1063119	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	675	Open in IMG/M
3300010371\|Ga0134125_11769414	Not Available	672	Open in IMG/M
3300010371\|Ga0134125_11777874	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	670	Open in IMG/M
3300010371\|Ga0134125_12310202	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	585	Open in IMG/M
3300010403\|Ga0134123_12763863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	559	Open in IMG/M
3300013023\|Ga0157366_1141504	Not Available	681	Open in IMG/M
3300013025\|Ga0157367_1308598	Not Available	524	Open in IMG/M
3300013025\|Ga0157367_1310868	Not Available	521	Open in IMG/M
3300014968\|Ga0157379_11022471	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	789	Open in IMG/M
3300015284\|Ga0182101_1039282	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	689	Open in IMG/M
3300015284\|Ga0182101_1039607	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	687	Open in IMG/M
3300015293\|Ga0182103_1027902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	760	Open in IMG/M
3300015293\|Ga0182103_1028903	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	753	Open in IMG/M
3300015293\|Ga0182103_1064730	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	590	Open in IMG/M
3300015293\|Ga0182103_1067462	Not Available	582	Open in IMG/M
3300015293\|Ga0182103_1093633	Not Available	522	Open in IMG/M
3300015297\|Ga0182104_1080716	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	583	Open in IMG/M
3300015301\|Ga0182184_1032909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	733	Open in IMG/M
3300015301\|Ga0182184_1038343	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	698	Open in IMG/M
3300015301\|Ga0182184_1081758	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	542	Open in IMG/M
3300015306\|Ga0182180_1039904	Not Available	685	Open in IMG/M
3300015309\|Ga0182098_1028021	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	836	Open in IMG/M
3300015309\|Ga0182098_1046186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	714	Open in IMG/M
3300015309\|Ga0182098_1072584	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	616	Open in IMG/M
3300015309\|Ga0182098_1112686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	527	Open in IMG/M
3300015310\|Ga0182162_1083367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	594	Open in IMG/M
3300015312\|Ga0182168_1050354	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	732	Open in IMG/M
3300015312\|Ga0182168_1077489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	628	Open in IMG/M
3300015315\|Ga0182120_1039309	Not Available	801	Open in IMG/M
3300015315\|Ga0182120_1060953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	689	Open in IMG/M
3300015315\|Ga0182120_1118118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	537	Open in IMG/M
3300015315\|Ga0182120_1137803	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	504	Open in IMG/M
3300015315\|Ga0182120_1139748	Not Available	502	Open in IMG/M
3300015316\|Ga0182121_1097002	Not Available	596	Open in IMG/M
3300015316\|Ga0182121_1118199	Not Available	549	Open in IMG/M
3300015317\|Ga0182136_1059538	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	696	Open in IMG/M
3300015318\|Ga0182181_1053081	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	658	Open in IMG/M
3300015319\|Ga0182130_1084739	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	603	Open in IMG/M
3300015320\|Ga0182165_1024922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	956	Open in IMG/M
3300015320\|Ga0182165_1049058	Not Available	763	Open in IMG/M
3300015320\|Ga0182165_1080082	Not Available	640	Open in IMG/M
3300015324\|Ga0182134_1062550	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	699	Open in IMG/M
3300015324\|Ga0182134_1105217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	576	Open in IMG/M
3300015325\|Ga0182148_1137731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	515	Open in IMG/M
3300015326\|Ga0182166_1118314	Not Available	545	Open in IMG/M
3300015326\|Ga0182166_1125140	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	533	Open in IMG/M
3300015327\|Ga0182114_1073173	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	693	Open in IMG/M
3300015327\|Ga0182114_1076163	Not Available	683	Open in IMG/M
3300015327\|Ga0182114_1101693	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	610	Open in IMG/M
3300015328\|Ga0182153_1055024	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	737	Open in IMG/M
3300015328\|Ga0182153_1089658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	620	Open in IMG/M
3300015328\|Ga0182153_1126346	Not Available	543	Open in IMG/M
3300015329\|Ga0182135_1118416	Not Available	561	Open in IMG/M
3300015329\|Ga0182135_1121792	Not Available	555	Open in IMG/M
3300015329\|Ga0182135_1128959	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	542	Open in IMG/M
3300015329\|Ga0182135_1140218	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	524	Open in IMG/M
3300015331\|Ga0182131_1055292	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	749	Open in IMG/M
3300015331\|Ga0182131_1105338	Not Available	590	Open in IMG/M
3300015332\|Ga0182117_1027784	Not Available	1009	Open in IMG/M
3300015332\|Ga0182117_1113717	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	598	Open in IMG/M
3300015332\|Ga0182117_1133444	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	559	Open in IMG/M
3300015333\|Ga0182147_1051320	Not Available	802	Open in IMG/M
3300015334\|Ga0182132_1104205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	617	Open in IMG/M
3300015334\|Ga0182132_1127391	Not Available	568	Open in IMG/M
3300015334\|Ga0182132_1133005	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	558	Open in IMG/M
3300015335\|Ga0182116_1067601	Not Available	756	Open in IMG/M
3300015335\|Ga0182116_1085097	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	691	Open in IMG/M
3300015335\|Ga0182116_1116009	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	609	Open in IMG/M
3300015336\|Ga0182150_1045466	Not Available	822	Open in IMG/M
3300015337\|Ga0182151_1115802	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	583	Open in IMG/M
3300015338\|Ga0182137_1029189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1014	Open in IMG/M
3300015338\|Ga0182137_1171412	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	512	Open in IMG/M
3300015339\|Ga0182149_1062735	Not Available	757	Open in IMG/M
3300015348\|Ga0182115_1095317	Not Available	930	Open in IMG/M
3300015348\|Ga0182115_1160696	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	720	Open in IMG/M
3300015348\|Ga0182115_1187908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	662	Open in IMG/M
3300015348\|Ga0182115_1212848	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	618	Open in IMG/M
3300015348\|Ga0182115_1284002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	523	Open in IMG/M
3300015349\|Ga0182185_1081874	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	905	Open in IMG/M
3300015349\|Ga0182185_1204363	Not Available	598	Open in IMG/M
3300015349\|Ga0182185_1243095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	548	Open in IMG/M
3300015349\|Ga0182185_1245307	Not Available	545	Open in IMG/M
3300015350\|Ga0182163_1136086	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	760	Open in IMG/M
3300015350\|Ga0182163_1149774	Not Available	725	Open in IMG/M
3300015350\|Ga0182163_1202296	Not Available	622	Open in IMG/M
3300015350\|Ga0182163_1284605	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	518	Open in IMG/M
3300015350\|Ga0182163_1294782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	508	Open in IMG/M
3300015352\|Ga0182169_1212064	Not Available	632	Open in IMG/M
3300015352\|Ga0182169_1272747	Not Available	548	Open in IMG/M
3300015352\|Ga0182169_1281391	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	538	Open in IMG/M
3300015352\|Ga0182169_1305626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	512	Open in IMG/M
3300015353\|Ga0182179_1085910	Not Available	922	Open in IMG/M
3300015353\|Ga0182179_1112752	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	823	Open in IMG/M
3300015353\|Ga0182179_1175435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	676	Open in IMG/M
3300015353\|Ga0182179_1270668	Not Available	550	Open in IMG/M
3300015353\|Ga0182179_1300148	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	522	Open in IMG/M
3300015354\|Ga0182167_1043537	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1510	Open in IMG/M
3300015354\|Ga0182167_1184104	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	767	Open in IMG/M
3300015354\|Ga0182167_1201457	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	728	Open in IMG/M
3300015354\|Ga0182167_1229719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	673	Open in IMG/M
3300015354\|Ga0182167_1230174	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	673	Open in IMG/M
3300015354\|Ga0182167_1279798	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	596	Open in IMG/M
3300015354\|Ga0182167_1335618	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	530	Open in IMG/M
3300015354\|Ga0182167_1341069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	525	Open in IMG/M
3300015354\|Ga0182167_1360896	Not Available	506	Open in IMG/M
3300017412\|Ga0182199_1055171	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	824	Open in IMG/M
3300017412\|Ga0182199_1117452	Not Available	626	Open in IMG/M
3300017414\|Ga0182195_1171896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	559	Open in IMG/M
3300017421\|Ga0182213_1087560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	860	Open in IMG/M
3300017422\|Ga0182201_1069272	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	649	Open in IMG/M
3300017440\|Ga0182214_1112422	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	587	Open in IMG/M
3300017445\|Ga0182198_1028870	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1018	Open in IMG/M
3300017445\|Ga0182198_1034377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	962	Open in IMG/M
3300017691\|Ga0182212_1057101	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	860	Open in IMG/M
3300017693\|Ga0182216_1009207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1598	Open in IMG/M
3300017693\|Ga0182216_1027401	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1102	Open in IMG/M
3300017693\|Ga0182216_1059445	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	842	Open in IMG/M
3300017693\|Ga0182216_1182320	Not Available	547	Open in IMG/M
3300017694\|Ga0182211_1043952	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1018	Open in IMG/M
3300017694\|Ga0182211_1115536	Not Available	631	Open in IMG/M
3300017694\|Ga0182211_1173693	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	515	Open in IMG/M
3300020023\|Ga0182178_1017590	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	552	Open in IMG/M
3300020223\|Ga0182118_112944	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	532	Open in IMG/M
3300026088\|Ga0207641_11398672	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	701	Open in IMG/M
3300028050\|Ga0268328_1048007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	584	Open in IMG/M
3300028058\|Ga0268332_1014338	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	894	Open in IMG/M
3300028061\|Ga0268314_1031986	Not Available	609	Open in IMG/M
3300028064\|Ga0268340_1004637	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1266	Open in IMG/M
3300028153\|Ga0268320_1005402	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	824	Open in IMG/M
3300028248\|Ga0268312_1024044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	586	Open in IMG/M
3300028253\|Ga0268316_1011980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	629	Open in IMG/M
3300028475\|Ga0268327_1010850	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	665	Open in IMG/M
3300032465\|Ga0214493_1085273	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	752	Open in IMG/M
3300032699\|Ga0214494_1113731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	500	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.02%
Environmental	Environmental	2.98%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	95.24%
Terrestrial	Environmental → Terrestrial	2.98%
Fungi	Host-Associated → Fungi	1.79%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	82.74%
Unclassified	Host-Associated → Plants → Unclassified	10.12%
Soil	Environmental → Terrestrial → Soil	2.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.79%
Mycelium	Host-Associated → Fungi → Mycelium	1.79%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	82.74%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	10.12%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.98%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.19%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.60%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	82.74%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	10.12%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.98%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	1.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.19%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	77.38%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	10.12%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.36%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.98%
Fungus Garden	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden	1.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.60%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070666_110139712	3300005335	Switchgrass Rhizosphere	LNAADHGTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTKIE*
Ga0105250_102701993	3300009092	Switchgrass Rhizosphere	VTLQDDDENTFKVNGQRLEVSLEQEMPELKEVDVFELSEI*
Ga0105137_1075221	3300009972	Switchgrass Associated	AITLQDDDGNVFKANGQRLKIFLEPEIPELKEVDVYELTEIE*
Ga0105128_1043632	3300009976	Switchgrass Associated	MLNPADHGTITLQDDDGNIFKANGQRLKIFLEPEIPELEEVDVYELSELEHTSTIIAIP*
Ga0105128_1132051	3300009976	Switchgrass Associated	VLDAADHGVVTLQDDDGNTFKVNGQRLKVYLEQEMPELEEVDVFELSEI*
Ga0105141_1207731	3300009977	Switchgrass Associated	VLDGVDHGAVTLQDDDGNTFKINGQRLKVFLEQEMLELEEVDVFELSEI*
Ga0105135_1262361	3300009980	Switchgrass Associated	MLNPADHGTITLQDDDGNIFKANGQRLKIFLEPEIPELEEVDVYELSELEHASTVVAVP*
Ga0105135_1291791	3300009980	Switchgrass Associated	TITLQDDDGNIFKANGQRLKIFLEPEIPKLEEVEVYELSELDHASTVVVVP*
Ga0105133_1013052	3300009981	Switchgrass Associated	VLDAADHGAVTFQDDDGNIFKDNGQRLKVFLEQEMSELEEVDVFELSEI*
Ga0105133_1075141	3300009981	Switchgrass Associated	LNTADHGTITLQDDDWNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0105133_1104682	3300009981	Switchgrass Associated	LRDDDRNVFKSNGQILKIFLEPKIPELEEVDVYELYEIE*
Ga0105131_1182652	3300009989	Switchgrass Associated	VLNAADHDAITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYKLSEIE*
Ga0105131_1254301	3300009989	Switchgrass Associated	IQDDDGNNFKANGQKLKVFLEPEMLELEEVDVFELTEI*
Ga0105132_1173421	3300009990	Switchgrass Associated	LQGDDGNIFKANGRTLKVFLEPEMPELKEVGVVELTEI*
Ga0105132_1235612	3300009990	Switchgrass Associated	DHGAITLQDDDRNVFKSNGQILKIFLEPKIPELEEVDVYKLSEIE*
Ga0105139_10132391	3300009995	Switchgrass Associated	LQDDDGNTFKVNGQRLKVFLEQEMPELEEVDIFELSEI*
Ga0105139_10142103	3300009995	Switchgrass Associated	VLNAANYGTITLQDDDENIFKANGQRLKIFLEPKILELEEVDVYELSELEHASTVVAVP*
Ga0105139_10249651	3300009995	Switchgrass Associated	LNAADHDTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0105139_10631193	3300009995	Switchgrass Associated	VLNAADHGTITLQDEDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIK*
Ga0134125_117694141	3300010371	Terrestrial Soil	GAVTLQDDDRNTFKVNGQRLKVFLEQEMPELEEVDVFELSEI*
Ga0134125_117778742	3300010371	Terrestrial Soil	LNAADHRAITLQHNDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0134125_123102021	3300010371	Terrestrial Soil	LNAADHGTTTLQDDDGNFFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0134127_109891782	3300010399	Terrestrial Soil	VLDATDHGAVTLQDDDRNTFKVNDQRLKVFLEQEMPELEEV
Ga0134123_127638632	3300010403	Terrestrial Soil	VLNTSDHCAITLQDNDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0157366_11415042	3300013023	Fungus Garden	TLQDEDGKVFEANGQCLKVFIEPEMPQLEEVDVYELQGTA*
Ga0157367_13085981	3300013025	Fungus Garden	GPFTVLEAADHGAVTLQDDVGRVFKANGQRLKIFLEPEMPTLEEVDVFELHEVV*
Ga0157367_13108681	3300013025	Fungus Garden	ILQDDDGKIFKANEQRLKVFLEPETPQIKEVDVYELQEQA*
Ga0157379_110224711	3300014968	Switchgrass Rhizosphere	VLDAADHGTVTLQDDDGNTFKVNGQRFKVFLEQEMPELDEVDVFELSEI*
Ga0182101_10392822	3300015284	Switchgrass Phyllosphere	LNAADYGTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTKIE*
Ga0182101_10396071	3300015284	Switchgrass Phyllosphere	VLKAADHGAETLQNDDGSIFKANAQRLKVFLEPEMPELKEVDVFELIEI*
Ga0182103_10279022	3300015293	Switchgrass Phyllosphere	ADHVAKTLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIK*
Ga0182103_10289032	3300015293	Switchgrass Phyllosphere	LVLDADDHGVVTLQDDDENIFKVNGQRLKVFLEQEMPELEEVDIFELSEI*
Ga0182103_10647301	3300015293	Switchgrass Phyllosphere	LNAADHGTITLQDDEGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0182103_10674621	3300015293	Switchgrass Phyllosphere	MRCHFRYNGVVTLHDDDGNTFKVNGQRLKVFLEQEISELEEVDVFELSEI*
Ga0182103_10936331	3300015293	Switchgrass Phyllosphere	PYLVLDADDHGVVTLQDDDENIFKVNGQRLKVLLEQEMPELEEVDVFELSEI*
Ga0182104_10807162	3300015297	Switchgrass Phyllosphere	VLNAADHGAVTLQDDDRNIFKANGQRLKVFLKPEMPDLEEVDVFELTEIQN*
Ga0182184_10329091	3300015301	Switchgrass Phyllosphere	NAADHGTITLQDDDGNIFKANGQRLKIFLEPEIPEQEEVDVYELSELENASTVVAVP*
Ga0182184_10383431	3300015301	Switchgrass Phyllosphere	YLVLDAADHGAVTLQDDDMNTFKVNGQRLKVFLEQEMPELEEVDVFELSEI*
Ga0182184_10817582	3300015301	Switchgrass Phyllosphere	FLVLNTADHGIVTLQGDDRNVFKANGQRLKIFLEPEIPELEQVDVYELSELEHASTIIAVP*
Ga0182180_10399041	3300015306	Switchgrass Phyllosphere	LQDDDVNIFKVNGQRLKVFREQEMPELEEIDVFQLSET*
Ga0182098_10280212	3300015309	Switchgrass Phyllosphere	GPFLVLNAADHRAITLQHNDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0182098_10461861	3300015309	Switchgrass Phyllosphere	PFLVLNTADHDAITLQDDDGNVFKANGQRLKIFLEPEIPEFEEVDVYELTETE*
Ga0182098_10725842	3300015309	Switchgrass Phyllosphere	VLNAADHGAITLQDDDRNVFKANGQRLKIFLEAKISELKVDVYELTEIE*
Ga0182098_11126861	3300015309	Switchgrass Phyllosphere	VLDAVDHGAVTLQDDDGNTFKVNGQRFKVFLEQEMPELDEVDVFELSEI*
Ga0182162_10833671	3300015310	Switchgrass Phyllosphere	VLDATNHSTVTLQDDDGNTFKVNGQRLKVFLEQEMPELEEVDVFQLSEI*
Ga0182168_10503541	3300015312	Switchgrass Phyllosphere	LVLNTADHGVVTLEDDDGNIFKANGQRLKVFLEPEMPELEEVDVFKLSEI*
Ga0182168_10774892	3300015312	Switchgrass Phyllosphere	HDTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0182120_10393092	3300015315	Switchgrass Phyllosphere	VNRVLHAVTLQDDDGNNFKANGQRLKVFLELKMPELEEVDVFELFEM*
Ga0182120_10609532	3300015315	Switchgrass Phyllosphere	LNATNHGAITLQDDDRNVFKANCQRFKIFLEPEIPELEEVDVYELTEVE*
Ga0182120_11181181	3300015315	Switchgrass Phyllosphere	VLDAADHGTVTLQDDDRNTFKVNGRRLKVFLEQEMAELEEVDVFELTEI*
Ga0182120_11378031	3300015315	Switchgrass Phyllosphere	VLNAADHSAITLQDDDGNVFKANGQRLKIFLEPEIPDLKEVDVYELSELE*
Ga0182120_11397481	3300015315	Switchgrass Phyllosphere	QDDDGNTFKVNGQRFKVFLEQEMPELDEVDVFKLSEI*
Ga0182121_10970022	3300015316	Switchgrass Phyllosphere	LQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIE*
Ga0182121_11181991	3300015316	Switchgrass Phyllosphere	QDDDENTFKVNGQRLEVSLEQEMPELKEVDVFELSEI*
Ga0182136_10595382	3300015317	Switchgrass Phyllosphere	LNAADHGTITLQDNDGNIFKANDQRLKIFLEFEIPGLEEVDVYELSELEHASTVVAVP*
Ga0182181_10530811	3300015318	Switchgrass Phyllosphere	ITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0182130_10847392	3300015319	Switchgrass Phyllosphere	VLNVADHGAVTLQDDDGNMFKANGQRLKVFVEPEMPKLEEVDVFELSEI*
Ga0182165_10249222	3300015320	Switchgrass Phyllosphere	VLDAADHVAVTLQDDDGNTFKVNGQRLKVFLEQEMSELKKVDVFELSEI*
Ga0182165_10490582	3300015320	Switchgrass Phyllosphere	DDENTFKANGQRLKVFLEQEMPELEEVDIFELSKI*
Ga0182165_10551251	3300015320	Switchgrass Phyllosphere	TLQDDDRNIFKANGQRLKIFLEPEIPKLEEVDVYELSELEHATTVAAVP*
Ga0182165_10800822	3300015320	Switchgrass Phyllosphere	VLDATDHGAVTLQDDDENIFKVNGQRLKVLLEQEMPELEEVDVFELSEI*
Ga0182134_10625502	3300015324	Switchgrass Phyllosphere	PFLVLNAADHGAIALQDDDENVFKANGQRLKIFLEPEIPELEEVDVYELSEME*
Ga0182134_11052171	3300015324	Switchgrass Phyllosphere	DHGAVTLQDDDRNTFKVNGQRLKVFLEQEMSELEEVDVFDLSEI*
Ga0182148_11377312	3300015325	Switchgrass Phyllosphere	VLNAADHGAETLQNDDGSIFKANAQRLKVFLEPEMPELKEVDVFELIEI*
Ga0182166_10984112	3300015326	Switchgrass Phyllosphere	DDDENIFKANGQRLKIFLEPKILELEEVDVYELFELEHTSTVVAVP*
Ga0182166_11183141	3300015326	Switchgrass Phyllosphere	TLQDDDRNTFKVNGQRLKVFLEQEMPELEEVDIFELSEI*
Ga0182166_11251401	3300015326	Switchgrass Phyllosphere	VLNAADHGAITLQDDDGNVVKANGQRLKISLKPEIPELEKIDVYELTELEYASM
Ga0182114_10731732	3300015327	Switchgrass Phyllosphere	VLNAADHGATTLQNDDGNVFKANGQRLKIFLKPEIPELEEVDVYELSELE*
Ga0182114_10761631	3300015327	Switchgrass Phyllosphere	ADHVVVTLQDYDRNVFKANGQKLKIFLMPEIPKLEEVDVYELT*
Ga0182114_11016931	3300015327	Switchgrass Phyllosphere	GTVTLQDDDGNIFKANGQRLKVFLEPEMPELEEVDVFELSEI*
Ga0182153_10550241	3300015328	Switchgrass Phyllosphere	LNAADHSAITLQDDDVNVFKANGQRLKIFLEPEIPDLEEVDVYELSELELTSTVVAVP*
Ga0182153_10896581	3300015328	Switchgrass Phyllosphere	DHGTITLQDDDGNLFKANGQRLKIFLKPEISELEEVDVYELSELE*
Ga0182153_11263461	3300015328	Switchgrass Phyllosphere	LVLNAADHSAITLQDDDENVFKANGQRLKIFLEPEIPELEEVEVYELTVIE*
Ga0182135_10464672	3300015329	Switchgrass Phyllosphere	TLQDDDGNIFKANGQRLKIFLELEIPELEEIDVYELSELEHTSTVVVVP*
Ga0182135_11184162	3300015329	Switchgrass Phyllosphere	LQDNDENIFKANGQRLKIFLEPEIPELEGVDVYELSELEHASTIIAVP*
Ga0182135_11217921	3300015329	Switchgrass Phyllosphere	AIILQDDDVNVFKANGQRLKIFLEPEIPELKEVDVYELSELE*
Ga0182135_11289592	3300015329	Switchgrass Phyllosphere	LNAADHRAITLQHNDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEVE*
Ga0182135_11402181	3300015329	Switchgrass Phyllosphere	VEGPYLVLDATDHGAVTLQDDDRNTFKVNDQRLKVFLEQEMPELEEVDIFELSEI*
Ga0182131_10552922	3300015331	Switchgrass Phyllosphere	VLNAADHGTVTHQDDDGNIFKANGQRLKVFLEPEMPELEEVGVFELSEI*
Ga0182131_11053381	3300015331	Switchgrass Phyllosphere	VLDAADHGAVTLQDDDGNTFMVNGQRLKVFLEQEMPELEEVDVFELSEI*
Ga0182131_11167142	3300015331	Switchgrass Phyllosphere	DDGNIFKANGQRFKIFLEPKIPELEEVDVYELSELEHTSTVIVVP*
Ga0182117_10277841	3300015332	Switchgrass Phyllosphere	TLQDDDGNVFMANGQRLKIFLEPEIPELEEVDVYELIEIE*
Ga0182117_11137171	3300015332	Switchgrass Phyllosphere	VLNAADHGAITLQDDDGNIFKANVQRLKICLEPEIPEFEEVDVYELTETE*
Ga0182117_11334442	3300015332	Switchgrass Phyllosphere	MLNTADHSAITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELSELE*
Ga0182147_10513202	3300015333	Switchgrass Phyllosphere	QDNDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIE*
Ga0182132_11042052	3300015334	Switchgrass Phyllosphere	VLNATDHGTVTLQDDDGNIFKANGQRLKVFLEPEMPELEEVDVFELSEI*
Ga0182132_11273911	3300015334	Switchgrass Phyllosphere	NAADHGVITFQDDDRNVFNANGPRLKILLEPKISELEEVDVYDLSELYLSPTVVAVPTTCLILG*
Ga0182132_11330052	3300015334	Switchgrass Phyllosphere	VRLNAVDHGAITLQDDDENIFKANGQRLNVFLEREMTELEEV
Ga0182116_10676011	3300015335	Switchgrass Phyllosphere	DGNVFKANGQRLKIFLEPEIPELEEVDVYEFTEIE*
Ga0182116_10850972	3300015335	Switchgrass Phyllosphere	VLNAADQCAITLQYDDRNIFKANCQRLKIFLEPEIPELEEVDVYELSELE
Ga0182116_11160091	3300015335	Switchgrass Phyllosphere	ITLQDDDGNVFKANGQRLKIFLEPKIPELEEVDVYELSEIE*
Ga0182150_10454662	3300015336	Switchgrass Phyllosphere	VLNAAEHGTITLQDDDGNIFKANGQRWKIFLEPEIPELEEVDVYELSELEHASTVVAVP*
Ga0182151_10480172	3300015337	Switchgrass Phyllosphere	DDGNVFKANGQRLKIFLEPEIPELEEVDVYELSELEHSSTVIAVP*
Ga0182151_11158021	3300015337	Switchgrass Phyllosphere	LNAADHSAITLQDDGGNVFKANGQGLKIFLEPEILELEEVDVYELIEIE*
Ga0182137_10291892	3300015338	Switchgrass Phyllosphere	LNAADHSAITLQDDNGNVFKANGQRLKTFLEPEIPELEEVDVYELTEIE*
Ga0182137_11714121	3300015338	Switchgrass Phyllosphere	EGPYLELNATNHSAITVQDDDGNIFKDNGQRLKVFLEPDMPELEEIDVFELIEI*
Ga0182149_10627352	3300015339	Switchgrass Phyllosphere	QDDDVNVSKANGQRLKTFLEPKNPKIKEVDVYELSMIE*
Ga0182149_11434041	3300015339	Switchgrass Phyllosphere	IFKANGQRLKIFLELEIPELEEIDVYELSELEHTSTVVVVP*
Ga0182133_11079242	3300015340	Switchgrass Phyllosphere	QDDDGNIFKANGQRLKIFLEPEIPKLKEVDVYELSKLEHASTVVAVP*
Ga0182115_10953173	3300015348	Switchgrass Phyllosphere	DAADHSAVTLQDDDRNIFKANGQRLKVFLEPEMPELEEVDVFELTEI*
Ga0182115_11606961	3300015348	Switchgrass Phyllosphere	LNAADHGAIILQADDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0182115_11647872	3300015348	Switchgrass Phyllosphere	GNVFKSNGQRLKIFIEPKIPELEEIDVYELTELEHSSMVIAVP*
Ga0182115_11879081	3300015348	Switchgrass Phyllosphere	HGAITLQDNDRNIFKANGQRLKIFLEPEIPELEEVDIYELSELEHASTVIAVP*
Ga0182115_12128482	3300015348	Switchgrass Phyllosphere	VLNAADHGAVTLQDDDGNIFKANGQRLKVFLEPEMPELEEVDIFELSEI*
Ga0182115_12840021	3300015348	Switchgrass Phyllosphere	AITLQDDDGNIFKANGQILKIFLEPEIPELEEVDVYELSELEHTSTVVSVP*
Ga0182115_12927411	3300015348	Switchgrass Phyllosphere	DENIFKANGQRLKIFLEPEIPELEGVDVYELSELEHASTVVAVS*
Ga0182185_10818741	3300015349	Switchgrass Phyllosphere	VLDATDHGVVTLQDDDGNTFKVNGQRLKVFLEQEMPELKEVDVFELSEI*
Ga0182185_12043631	3300015349	Switchgrass Phyllosphere	VTLQDDDGNIFKVNGQSLKVFLEQEMLELEEVDVFELSEI*
Ga0182185_12430951	3300015349	Switchgrass Phyllosphere	LNTADHGAITLQDNDGNVFKANGQRLKIFLELEIFELEEVDVYELTKIE*
Ga0182185_12453072	3300015349	Switchgrass Phyllosphere	LDAADHGAVTLQDDDGNTFKVSGQRLKVFLEQEMPELEEVDVFEISEL*
Ga0182163_10553961	3300015350	Switchgrass Phyllosphere	DGNIFKANGQRLKIFLEPKILELEEVVVYEFSELEHASTIVVVP*
Ga0182163_11360861	3300015350	Switchgrass Phyllosphere	ITLQDDDGNIFKANGQRLKIFLEPEIPELEEVDVYKLSELEHASTVVAVP*
Ga0182163_11497741	3300015350	Switchgrass Phyllosphere	QDDDGNVFKANGQRLKIFLEPEIPELEEVDVFELSEIE*
Ga0182163_12022961	3300015350	Switchgrass Phyllosphere	PQDDDGNIFKANGQRLKLFLEPEMLELEEVDVFELTKI*
Ga0182163_12846051	3300015350	Switchgrass Phyllosphere	LNAADHRAITLQHNDGNVFKANGQRLKIFLEPEIPELEEVDVYELTKVE*
Ga0182163_12947821	3300015350	Switchgrass Phyllosphere	LNAADHGTITLQDDDGIVFKANGQRLKIFLEPEIPELEEVNVYELTEIE*
Ga0182169_11959551	3300015352	Switchgrass Phyllosphere	DDDGNIFKANGQQLKIFLKPEIPELEEVDVYELSELEHTSTVIAVP*
Ga0182169_12120641	3300015352	Switchgrass Phyllosphere	GNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE*
Ga0182169_12727471	3300015352	Switchgrass Phyllosphere	VTLQDDDRNTFKVNGRRLKVFLEQEMAELEEVDVFELSEI*
Ga0182169_12813911	3300015352	Switchgrass Phyllosphere	VLNTADHSAITLQDDDGKIFKANGQRLKIFLEPEIPELEEVDVYELSELEHTYTVVAVP*
Ga0182169_13056261	3300015352	Switchgrass Phyllosphere	VLDAADHGAVTLQDDDGNIFKANDQRFKVFLEPEMPELEEVGIFELSEI*
Ga0182179_10859102	3300015353	Switchgrass Phyllosphere	TVTLQDDDRNIFKANGQRLKVFLEPEMPKLEEVDVFELSEI*
Ga0182179_11127522	3300015353	Switchgrass Phyllosphere	VLNVADHGTITLQDNDGNIFKANGQRLKIFLEPEIPELEEVDVYELSELEHTSTVVAVP*
Ga0182179_11754351	3300015353	Switchgrass Phyllosphere	AAEHGAITIQDDDGNVFKANGQRLKIFLQAEISELEEVDVYELTEIE*
Ga0182179_12706681	3300015353	Switchgrass Phyllosphere	DHGAVTLQDDGGNTFKVNGQRIKVFLEQEMPELEEVDVFELSEI*
Ga0182179_13001481	3300015353	Switchgrass Phyllosphere	ADHGAVTLQDDDGNIFKANDQRFKVFLEPEMPELEEVGIFELSEI*
Ga0182167_10435371	3300015354	Switchgrass Phyllosphere	LNAAHHSAITLQDDDSNIFKANGQRLKMFLEPDMPELEEVDVIKLTEI*
Ga0182167_10961553	3300015354	Switchgrass Phyllosphere	FKANGQRLKIFLEPEIPELEEIDVYELSELEHTSTVVVVP*
Ga0182167_11841041	3300015354	Switchgrass Phyllosphere	VLNAADHGTITLQDDDGNVFKANGQRLKIFLEPKIPELEEVDVYQLCEIE*
Ga0182167_12014572	3300015354	Switchgrass Phyllosphere	VLDAADHGAVTFQDDDGNIDKVNGQRLKVFLEQEMSELEEVDVFELSEI*
Ga0182167_12297191	3300015354	Switchgrass Phyllosphere	VLNVADHGAVTLQDDDGNIYKTNGHRLKVFLEPEMPELEEVDVFKLPEI*
Ga0182167_12301741	3300015354	Switchgrass Phyllosphere	LNATDHSAIALQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIK*
Ga0182167_12797981	3300015354	Switchgrass Phyllosphere	DHGTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIE*
Ga0182167_13356181	3300015354	Switchgrass Phyllosphere	LNAADHDAITLQDDDGNVFKANGQRLKIFLEPEFPELEEVDVYELSEIE*
Ga0182167_13410691	3300015354	Switchgrass Phyllosphere	VLDAADHGAVTLQDDDGNTFKVSGQRLKVFLEQEMPELEEVDVFEISEL*
Ga0182167_13608961	3300015354	Switchgrass Phyllosphere	PYLELNAADHSAITLQDDDRNIFKANGQRLKVFLKPEMPDLEEVDVFELTEIQN*
Ga0182199_10551711	3300017412	Switchgrass Phyllosphere	VLNAADHGAVTLQDDDGNTFKDNGQRLKVFLEQEMPELKEVDVFELSEI
Ga0182199_11174521	3300017412	Switchgrass Phyllosphere	TLQDDDGNIFKANGQRLKIFLEPEIPELEEVDVYELSELEHASTIIVVP
Ga0182195_11718961	3300017414	Switchgrass Phyllosphere	VTLQDDDGNTFKVNGQRLKVFLEQEMPKLEEVDVFELSEI
Ga0182213_10875601	3300017421	Switchgrass Phyllosphere	VLNATDHDTITLQDDNGNVFKANDQRLKIFLKLEIPELEEVDVYKLAELEYASTVIAVP
Ga0182201_10692721	3300017422	Switchgrass Phyllosphere	VLNAADHGVVTLQDDDGNIFKTNGRRLKVFLEPEMLELKEVDVFELSEI
Ga0182214_11124221	3300017440	Switchgrass Phyllosphere	VLDATNHSTVTLQDDDRNTFKVNGQRLKVFLEQEMPELEEVDVFELSKI
Ga0182198_10288702	3300017445	Switchgrass Phyllosphere	VLDAADHGVVTLQDDDGNIFKTNGRRLKVFLEPEMLELKEVDVFELSEI
Ga0182198_10343772	3300017445	Switchgrass Phyllosphere	GHGKLRSNWEGPYLVLKAADHGAETLQNDDGSIFKANAQRLKVFLEPEMPELKEVDVFELIEI
Ga0182212_10571012	3300017691	Switchgrass Phyllosphere	VLNTTDHGATTLQEDDGNVFKANGQRLKIFLEPEIPELEEVDVYKLSEIE
Ga0182216_10092073	3300017693	Switchgrass Phyllosphere	VLNAADHCAITLQDNDGNIFKANGQRLKIFLRPEIQELEEVDVYELSELDHASTVVAIP
Ga0182216_10261854	3300017693	Switchgrass Phyllosphere	DDGNIFKANGQRLKIFLEPEIPKLEEVDVYELFELEHTSRAVVVP
Ga0182216_10274012	3300017693	Switchgrass Phyllosphere	VLNTADHGATTLQEDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE
Ga0182216_10594451	3300017693	Switchgrass Phyllosphere	VLDAADHGVVTLQDDVGNTFKVNGQRLKVFLEQEMPELEEIDVFELSEI
Ga0182216_11823201	3300017693	Switchgrass Phyllosphere	DDGNVFKANGQRLKIFLEPEIPELEEVDVYELSEIE
Ga0182216_12042251	3300017693	Switchgrass Phyllosphere	QDDDGNIFKANGQRLKIFLEPEILELEEVDVYELSELEHTSTVVVVP
Ga0182211_10439522	3300017694	Switchgrass Phyllosphere	DAADHGAVTLQDDDRNTFKVNGQRLKVFLEQEMPLLEEVDIFELSEI
Ga0182211_11155361	3300017694	Switchgrass Phyllosphere	VTLQDDDGNICKANGQRLKVFLEPEMPELKEVDIFELSEI
Ga0182211_11736931	3300017694	Switchgrass Phyllosphere	NAADHGAITLQDDDGNIFKANSQRLKIFLQPEIPKVEEEDVYELSELEHTSMVVVVH
Ga0182178_10175901	3300020023	Switchgrass Phyllosphere	VLDAADHGAVTLQDDDGNTFKINGQRLKVFLEQEMPELEEVDIF
Ga0182118_1129441	3300020223	Switchgrass Phyllosphere	VLDAADHGAVTLQDDDGNTFKINGQRLKVFLEQEMPELEEVDIFELSEI
Ga0207641_113986721	3300026088	Switchgrass Rhizosphere	VLNDVDHGTITLQDDEGNVFKANGQRLKIFLEPKIPELEEVDVYELTEIE
Ga0268328_10480071	3300028050	Phyllosphere	VLDAADHGAVTLQDDDGNTFKVSGQRLKVFLEQEMPELEEVDVFEISEL
Ga0268332_10143382	3300028058	Phyllosphere	VLNAADHGTVTHQDDDGNIFKANGQRLKVFLEPEMPELEEVGVFELSEI
Ga0268314_10319861	3300028061	Phyllosphere	ADHSAVTLQDDDGNTFKVNGQRLKVYLEQEMPELEEVDIFELSEI
Ga0268340_10046374	3300028064	Phyllosphere	VLNAADHGAITLQDNDRNIFKANGQRLRIFFEPEIPELEEVDIYELSELEHASTVIAVP
Ga0268320_10054021	3300028153	Phyllosphere	VLNAADHDTITLQDDDGNVFKANGQRLKIFLEPEIPELEEVDVYELTEIE
Ga0268312_10240442	3300028248	Phyllosphere	VLNAADHGAETLQNDDGSIFKANAQRLKVFLEPEMPELKEVDVFELIEI
Ga0268324_10095412	3300028251	Phyllosphere	QDDDGNIFKANGQRLKIFVKPDIPKLEEVDVYELSELEHATTVAAVP
Ga0268316_10119801	3300028253	Phyllosphere	VLNTADHDAITLQDDDGNVFKANGQRLKIFLEPEIPELEEIDVYELSELEHASTVVAIP
Ga0268327_10108502	3300028475	Phyllosphere	VLDATDHGVVTLQDDDRNTFKVNDQRLKVFLEQEMPELEEVDVFELSEV
Ga0214493_10852731	3300032465	Switchgrass Phyllosphere	VGRPYLVLDAADHGAVTFQDDDGNIDKVNGQRLKVFLEQEMSELEEVDVFELSEI
Ga0214494_11137311	3300032699	Switchgrass Phyllosphere	VLNAADHDAITLQDDDGNVFKANGQRLKILLEPEIPELEEVDVYELTEIE

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.29
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.29
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F037035

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009977	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300013023	Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM1	Host-Associated	Open in IMG/M
3300013025	Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM2	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign