NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037036

Metagenome / Metatranscriptome Family F037036

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037036
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 109 residues
Representative Sequence VNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVW
Number of Associated Samples 94
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 38.89 %
% of genes near scaffold ends (potentially truncated) 77.98 %
% of genes from short scaffolds (< 2000 bps) 95.83 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (91.667 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(75.595 % of family members)
Environment Ontology (ENVO) Unclassified
(90.476 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(77.381 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.11%    β-sheet: 25.20%    Coil/Unstructured: 56.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF03732Retrotrans_gag 1.79
PF00078RVT_1 1.19


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.43 %
UnclassifiedrootN/A3.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005347|Ga0070668_100761371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum858Open in IMG/M
3300005355|Ga0070671_101953050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Furfurilactobacillus → Furfurilactobacillus rossiae522Open in IMG/M
3300005365|Ga0070688_101242640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300005467|Ga0070706_102021959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Furfurilactobacillus → Furfurilactobacillus rossiae522Open in IMG/M
3300005468|Ga0070707_101230864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum715Open in IMG/M
3300005843|Ga0068860_101082875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum820Open in IMG/M
3300005843|Ga0068860_102272165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300009092|Ga0105250_10240076All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum772Open in IMG/M
3300009975|Ga0105129_110914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300009980|Ga0105135_105660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum836Open in IMG/M
3300009980|Ga0105135_122195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Furfurilactobacillus → Furfurilactobacillus rossiae566Open in IMG/M
3300009981|Ga0105133_113946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300009981|Ga0105133_131699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300009990|Ga0105132_106219All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida896Open in IMG/M
3300009990|Ga0105132_116070All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum695Open in IMG/M
3300009992|Ga0105120_1029938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300009992|Ga0105120_1031425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300009992|Ga0105120_1032345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Furfurilactobacillus → Furfurilactobacillus rossiae625Open in IMG/M
3300009992|Ga0105120_1035901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum601Open in IMG/M
3300009994|Ga0105126_1018898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum735Open in IMG/M
3300009994|Ga0105126_1041501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum567Open in IMG/M
3300010397|Ga0134124_11539905All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum694Open in IMG/M
3300010397|Ga0134124_12009181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Furfurilactobacillus → Furfurilactobacillus rossiae615Open in IMG/M
3300010403|Ga0134123_11806581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica665Open in IMG/M
3300014326|Ga0157380_11488995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum730Open in IMG/M
3300015270|Ga0182183_1092525All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015284|Ga0182101_1036648All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum704Open in IMG/M
3300015284|Ga0182101_1060927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300015290|Ga0182105_1081333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300015293|Ga0182103_1035790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum707Open in IMG/M
3300015297|Ga0182104_1072938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300015306|Ga0182180_1038347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300015306|Ga0182180_1050440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300015309|Ga0182098_1046081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum715Open in IMG/M
3300015310|Ga0182162_1073120All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300015310|Ga0182162_1106607All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300015310|Ga0182162_1109171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum537Open in IMG/M
3300015311|Ga0182182_1072037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum609Open in IMG/M
3300015312|Ga0182168_1101894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum566Open in IMG/M
3300015313|Ga0182164_1034661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum828Open in IMG/M
3300015315|Ga0182120_1041104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum789Open in IMG/M
3300015315|Ga0182120_1077635All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300015315|Ga0182120_1138929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica503Open in IMG/M
3300015316|Ga0182121_1058183All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum724Open in IMG/M
3300015316|Ga0182121_1112049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300015317|Ga0182136_1039364All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum801Open in IMG/M
3300015317|Ga0182136_1061246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300015325|Ga0182148_1080886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum630Open in IMG/M
3300015326|Ga0182166_1060045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum698Open in IMG/M
3300015326|Ga0182166_1117397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300015326|Ga0182166_1124047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300015328|Ga0182153_1058283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum722Open in IMG/M
3300015328|Ga0182153_1128964All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300015329|Ga0182135_1120334All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum557Open in IMG/M
3300015329|Ga0182135_1123702All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015329|Ga0182135_1123786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015330|Ga0182152_1068923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum690Open in IMG/M
3300015330|Ga0182152_1155141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015331|Ga0182131_1089142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum630Open in IMG/M
3300015331|Ga0182131_1117211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300015332|Ga0182117_1118845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum587Open in IMG/M
3300015332|Ga0182117_1140257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300015333|Ga0182147_1011737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1275Open in IMG/M
3300015333|Ga0182147_1033148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum931Open in IMG/M
3300015333|Ga0182147_1045847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum835Open in IMG/M
3300015333|Ga0182147_1045906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus834Open in IMG/M
3300015333|Ga0182147_1054190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum787Open in IMG/M
3300015333|Ga0182147_1091590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015333|Ga0182147_1140641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus544Open in IMG/M
3300015336|Ga0182150_1089292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300015336|Ga0182150_1136341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300015336|Ga0182150_1136720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum545Open in IMG/M
3300015337|Ga0182151_1025439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum993Open in IMG/M
3300015337|Ga0182151_1039568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum861Open in IMG/M
3300015337|Ga0182151_1084175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum660Open in IMG/M
3300015337|Ga0182151_1136339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300015338|Ga0182137_1021473All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1120Open in IMG/M
3300015338|Ga0182137_1112754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum615Open in IMG/M
3300015338|Ga0182137_1166994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300015339|Ga0182149_1151536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015340|Ga0182133_1148072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015348|Ga0182115_1096063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum927Open in IMG/M
3300015348|Ga0182115_1181113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300015349|Ga0182185_1119543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum769Open in IMG/M
3300015349|Ga0182185_1138650All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum719Open in IMG/M
3300015349|Ga0182185_1258557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300015350|Ga0182163_1162188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum697Open in IMG/M
3300015350|Ga0182163_1209304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum611Open in IMG/M
3300015350|Ga0182163_1221877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015350|Ga0182163_1299124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum503Open in IMG/M
3300015350|Ga0182163_1299168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum503Open in IMG/M
3300015352|Ga0182169_1100577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum925Open in IMG/M
3300015352|Ga0182169_1212643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300015353|Ga0182179_1217150All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum612Open in IMG/M
3300015354|Ga0182167_1156317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum841Open in IMG/M
3300015354|Ga0182167_1199897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300015354|Ga0182167_1294443All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum577Open in IMG/M
3300015354|Ga0182167_1316600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015354|Ga0182167_1319519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300015354|Ga0182167_1332428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum534Open in IMG/M
3300015354|Ga0182167_1357930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300017408|Ga0182197_1149391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300017412|Ga0182199_1190398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
3300017414|Ga0182195_1042340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum938Open in IMG/M
3300017421|Ga0182213_1140854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300017421|Ga0182213_1183144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus594Open in IMG/M
3300017421|Ga0182213_1199768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum569Open in IMG/M
3300017422|Ga0182201_1008299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1262Open in IMG/M
3300017422|Ga0182201_1046166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum741Open in IMG/M
3300017422|Ga0182201_1083976All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300017422|Ga0182201_1128049All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300017435|Ga0182194_1075018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300017435|Ga0182194_1148758All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300017445|Ga0182198_1034773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum958Open in IMG/M
3300017445|Ga0182198_1084566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum704Open in IMG/M
3300017445|Ga0182198_1087299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum696Open in IMG/M
3300017445|Ga0182198_1095144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum674Open in IMG/M
3300017445|Ga0182198_1204831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300017447|Ga0182215_1044995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum934Open in IMG/M
3300017692|Ga0182210_1113629All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum589Open in IMG/M
3300017693|Ga0182216_1019043All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1247Open in IMG/M
3300017693|Ga0182216_1068088All Organisms → cellular organisms → Eukaryota802Open in IMG/M
3300017693|Ga0182216_1094870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300017693|Ga0182216_1096683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum703Open in IMG/M
3300017694|Ga0182211_1040804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1055Open in IMG/M
3300025925|Ga0207650_11499765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300026088|Ga0207641_11246717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum744Open in IMG/M
3300026095|Ga0207676_11637123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum642Open in IMG/M
3300026118|Ga0207675_100724752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1004Open in IMG/M
3300028051|Ga0268344_1006320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum771Open in IMG/M
3300028053|Ga0268346_1018680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum663Open in IMG/M
3300028055|Ga0268338_1017523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum677Open in IMG/M
3300028056|Ga0268330_1051641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300028061|Ga0268314_1012981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum822Open in IMG/M
3300028140|Ga0268334_1003724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum859Open in IMG/M
3300028154|Ga0268341_1003940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum942Open in IMG/M
3300028262|Ga0268310_1017215All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300028468|Ga0268317_1010101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300028473|Ga0268319_1021249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300028477|Ga0268309_1002869All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum885Open in IMG/M
3300032467|Ga0214488_1027516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1200Open in IMG/M
3300032548|Ga0214483_1040188All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300032593|Ga0321338_1257873All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum627Open in IMG/M
3300032697|Ga0214499_1015764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1913Open in IMG/M
3300032699|Ga0214494_1056668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M
3300032699|Ga0214494_1085816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum595Open in IMG/M
3300032781|Ga0314742_1060943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300032791|Ga0314748_1081508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum686Open in IMG/M
3300032812|Ga0314745_1012590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1612Open in IMG/M
3300032812|Ga0314745_1060798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300032823|Ga0314723_1027466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1064Open in IMG/M
3300032825|Ga0314724_102975All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1569Open in IMG/M
3300032875|Ga0314737_1011688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1376Open in IMG/M
3300032875|Ga0314737_1017088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1191Open in IMG/M
3300032916|Ga0314734_1001181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum3001Open in IMG/M
3300032916|Ga0314734_1045289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum887Open in IMG/M
3300032934|Ga0314741_1051013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum957Open in IMG/M
3300032959|Ga0314738_1016161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1265Open in IMG/M
3300032966|Ga0314722_1008479All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1454Open in IMG/M
3300032976|Ga0314752_1042142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum872Open in IMG/M
3300033538|Ga0314755_1019652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1563Open in IMG/M
3300033542|Ga0314769_1047164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1336Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere75.60%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated8.33%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere6.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.19%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.60%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028140Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028154Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028477Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032812Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032825Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032916Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032966Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032976Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070668_10076137123300005347Switchgrass RhizosphereSNEPVHETKRQRKEYLRTISHVCEGKHFRTLWSHVPVTFSEANLRLHHYPHNDPLIIRANIGKNSVHFAGNDVGRILIDNGISADVLTWQCFVKMGFTEKNLHKS*
Ga0070671_10195305013300005355Switchgrass RhizosphereVNIINAISGGSNELVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSTDTLVWQCFVKMGFTETALHKSQYPLIGFGGKRIEALGKIELNVTFGEGAA
Ga0070688_10124264013300005365Switchgrass RhizosphereAISGGSNEPVLETKRQHKEYFRIVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVW*
Ga0070706_10202195913300005467Corn, Switchgrass And Miscanthus RhizosphereVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQSFVKMGFTEIALHKSQYPLIGFGGKRIEALGKIELNVTFGEGAAQ
Ga0070707_10123086413300005468Corn, Switchgrass And Miscanthus RhizosphereINAISGGSNEPVHETKKQRKEYFRTVSHISEGRCFRSTWSHVPISFTQADLRLQHYPHNDPLVITTNIGKNLVHFAGNDVG*
Ga0068860_10108287523300005843Switchgrass RhizosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWWHVPISFTQADLRLQYYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQ
Ga0068860_10227216523300005843Switchgrass RhizospherePKLEPGTVPERANDPVRGMVNVINVISGRSNEPIHETKRQRKEYLHTVLHICEGKHFRTPWSHVPITFSEADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVVRILIDNGSSADIITWQCFIKMGLTEQSLHKS*
Ga0105250_1024007613300009092Switchgrass RhizosphereVNIITAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEAALHKSPYPLI
Ga0105129_11091413300009975Switchgrass AssociatedRVNIINAISGGSNEPVHETKKQRKEYFRTVSHVSEGRCFRTTWSHVPITFTQADLRLQHYPHNDPLVIMANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEATLKKSQYPLIGFGGK*
Ga0105135_10566023300009980Switchgrass AssociatedMVNIINAIPGGSNEPVHETKRQRKEYFRTVSHISEGKHFRTPWSHVSISFTQADLRLQHYPHNDPLVIRANIGKNSVHFTGNDVG*
Ga0105135_12219513300009980Switchgrass AssociatedFRTVSHVSEGKCFRTLWSHVPISFTQADLLLQHYPHNDPLVIRANICKNSVHFVGNDVGRILVDNGSSADILVWQCFVKMGFTEKALQKSQYPLIGFGGKRIEALDKIELNSTFGEGATQRTEAITFDVVDISYPTTPSSAATH*
Ga0105133_11394623300009981Switchgrass AssociatedVNVINAISGGSNEPVHETKRQRKEYLRTVSHVCEGKHFHTPWSHVPITFSEADLRLQHYPHNDPLVIRTNIGRNSVHFAGNDVGRILVDNGNSADVLTWQCFVKMGLTEKNLHKSQYPLIGFGGSKSKPSAK*
Ga0105133_13169923300009981Switchgrass AssociatedMVNIINAISGGSNESVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFAQADLRLQHYPHNDPVIIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMEFTERALQKSQYPLLGFRGKRIEALGKIEL
Ga0105132_10621923300009990Switchgrass AssociatedVNIINAISGGSNEPVLETKRQRKEYFRTFSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVRRIFVDNGSSADILVWQCFVKMGFTETTLHKSPYPLIGFGGKRIEALGKIELNV
Ga0105132_11607013300009990Switchgrass AssociatedVHETKKQRKEYFRIVSHVSEGRCFRTTWSHVPISFKQADLRLQHYPHNDPLVIRANIGKNSVH
Ga0105120_102993813300009992Switchgrass AssociatedQSSSQDKIPERVSDPPSGGMVNIINAISGASNEPVDETKRQHKEYFRIVSHVSEGKHFRTPWSHVPISFTHADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILV*
Ga0105120_103142513300009992Switchgrass AssociatedMVNVINAISGGSNEPVHKTKKQRKEYLRTVSQVCEGKHFRTPWSHVQITFSGADLRLQHYSHNDPLVIQANISKNSVHFAGNDIGRILIDNGSSADIITWQCFVKMGLAEQNLHKS
Ga0105120_103234513300009992Switchgrass AssociatedMVNIINAISGGSNEPVLETKRQRKEYFRIVSHVSEGKCFRTTWSHVPISFTQVDLRLQHYPHNDPLIIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFSEKALQKSQYPLIGFGGKRI
Ga0105120_103590113300009992Switchgrass AssociatedVDIINAISGGSNEPVLETKRQCKEYFRTVSHVSEGKCFQTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSTDILIWQCFVKMGFIEIALHKSQYPL
Ga0105126_101889813300009994Switchgrass AssociatedISEGSNEPVHETKRQCKEYFRTVSHVSEGKCFRTPWLHIPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVRQCFMKMGFTEKALQKSQYPLIGFGGKRIEALGKIELNVTFGEDAA*
Ga0105126_104150113300009994Switchgrass AssociatedGQIPERERMVNVINVISRGSNESAHETKRQRKEYFRTVSHMCEGKHFHTPWSHVPISFTEEDLRLQHYPHNNPLIIRDNNRKNLVHFTGNDVDRILVDNGIKGP*
Ga0105139_104711813300009995Switchgrass AssociatedVNVINAIFGGSNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITLSQADLRLQHYPHNDPLVI
Ga0134124_1153990523300010397Terrestrial SoilMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVQITFTQADLRLQHYPHNDPLVIRANIGKNSVHFTGNDVGRILVDNGSSADILVWQCIVKIGFTEQALKKSQYPLIGFGGKRIEALGKIELNVTFGEGVT*
Ga0134124_1200918113300010397Terrestrial SoilVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNLVHFAGNDVGRILVDNGSSTDILVWQCFVKMGFTETALHKSPYPLIGFG
Ga0134123_1180658113300010403Terrestrial SoilVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIKANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKIGFTETALKKSQYLLIGFGGKRIKALGKIEL
Ga0157380_1148899523300014326Switchgrass RhizosphereMIPERANDPIGGAVNVINAISGGSNEPVHETKRQRKEYLRTVSHVCEGKHFCTPWSHVPITFSKADLRLQHYPHNDPLVIRANIGRNSVHFAGNNIGRILVDNGSYADVLTWQCFVKMGFS*
Ga0182183_104618723300015270Switchgrass PhyllosphereMVNIINAISGGSNKPVHETKRQHKEYFKTVSHVSEGKHFQTPWSHVPIYFTQEDLRLQH
Ga0182183_109252513300015270Switchgrass PhyllosphereQVPKRANDPIGGMINVINAISGGSNEPVHEAKKQRKEYLRTVSHVCEGKHFRTPWSHVPITFSETELRLQHYPHNDPLVICANIGRNSVHFAGNDVESLSTMEAPQMSSLDNAS*
Ga0182101_103664823300015284Switchgrass PhyllosphereMVNIINAISGGSNKPVHETKRQHKEYFRTMSHVSEGKQFCTPWSHVLISFTQADLQLQHYPHNDPLVIRANIGKYLVHFVGKDVGRILVDNGSSADILVWQCFVKMGLTEKAL*
Ga0182101_106092713300015284Switchgrass PhyllosphereMVNIINTISGGSNEPVHETKRQRKEYLRTVSQVCEGKHFSTPWSHVLITFSEADLRFQHCPHNDPLVIHANIGRNSVHFAGNDVGQILVYHGSSTYVLTWQCFVKMGFTKKNLHKLSTRLLAS
Ga0182105_108133323300015290Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKKQRKEYFRTVSHVSEGRCFRTTWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMWFTEAALKKSQYPLIGFGGK
Ga0182103_103579013300015293Switchgrass PhyllosphereMVNIINAISGGSNEPVHEMKRQRKEYFRTISHVSEGKCFQTPWSHVPISFTQADLRLQHYPYNDPLVIRANIGKNSVHFARNDVGRILVDNGSSADILIWQ
Ga0182104_107293813300015297Switchgrass PhyllosphereMQRKEYLRTISHVCEGKHFCTPWSHVPITFSEADLRLQHYPHNDPLVIHANIGKNSVHFAGNNVGRILVDNSSSTDIITWQCFVKMGLTKQNLHKSQYPLIGFGGKKIEALEKVELNVTFGEGNSQRTELITFDLVVITYPYNA
Ga0182180_103834713300015306Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLFIRANIGKNSVHFAGNDVGRILVDNGSSANILVWQCFVKMG
Ga0182180_105044013300015306Switchgrass PhyllosphereEPRQIPERAGDAPSGSMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFARNDVGRILIDNGSSADILVWQCFVKMGFTDHAL*
Ga0182098_104608113300015309Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTISHVSKGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHLAGNNVGRILVDNGSSAD
Ga0182162_107312013300015310Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGRSADILVWQCFVKMGFTETAL
Ga0182162_110660723300015310Switchgrass PhyllosphereGSNEPVHETKHQRKEYLRTISHVSQGKHFRTPWSHVPITFSEANLRLQHYPHNDPLVIRANIGRNSVHFAGNDVGRILVDNDSFADILTWQCFMKMGLS*
Ga0182162_110917113300015310Switchgrass PhyllospherePPKLEPGQIPETASDAPSGSRVNIINAISGGSNNPVHETKRQRKEYFRTVSHVSEGKYFRTTWSHVPISFIQVDLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSTDILVWQCFVKMGLTKKALQRS*
Ga0182182_107203723300015311Switchgrass PhyllosphereMVNIINAISGGSNEPGHETKRQRKEYFRTVFHVSEGKCFQTPWSHVPITFTQADLRLQHYPHNDPLVTRANIGKNSIHFVGNDVGRILVDNGSSADILVWQCFVKMGFIEQSLKKSQYPLIGFGGKRIEALGKIELNVMIRRRCSPENRSNNLRCGQH*
Ga0182168_110189423300015312Switchgrass PhyllosphereMLETKRQRKEYFRTASHVSEGRCFRTTWSHVPISFTQADLWLQHYPHNDPLVIRANIGKNSMHFARNDVGRILVDNGSSADILVWQ
Ga0182164_103466123300015313Switchgrass PhyllosphereMVNVINAMSGGSNELVHETKRQRKEYLGMVSHVCEGKHFRTLWSHLPVTFSEADLRLQHYPHNDPLVIIANIGKNSVHFAGNDVGWILVDNGSSANIITWQCFVKIGLTEQNLHKS*
Ga0182120_104110423300015315Switchgrass PhyllosphereMVNVINAISSGSNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPINFSEADLMLQHYPQNNPLIIRANIGKNSVHFARNDVGWILVDNGSSADNITWQCFVKIGLTEQNLHKS*
Ga0182120_107763513300015315Switchgrass PhyllospherePKLEPGQIPKRAADAPSGSMGNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFQTPWSHVPIYFTQADLRLQHHPHNDPLFIKANIGKISVHFAGNDVGRILVDNGSSTNILVWQCFVKMGFTEQAL*
Ga0182120_113892913300015315Switchgrass PhyllosphereVNVINTISDGSNEPVHEMKRQRKEYLCTVSHVCEGKHFRTPWSHFPITFSEADLRLQHYPHNDPLVIQANIGQNSVHFVGNHVGRILVDNRSSADIITWQCFVKMGLTEQSLHKSQYPLIGFGGKKIEALDKIELNMTFGEGNT*
Ga0182121_105818313300015316Switchgrass PhyllosphereINVISSGSNEPVHETKRQRKEYLRTVSHVCEGKHFHTPWYHVLISFTETDLRLQHYPYNDLLVIRANIGKNSEHFAGNYVGRILADNGSSADILT*
Ga0182121_111204913300015316Switchgrass PhyllosphereIPEIAGDGPSGSMVNIINAISGGSNEPVHETKRQRKACFRTMSHVSEGKQFRTLRSHVPISFTQADLRLQHYPHNDSLVIRANIGKNSVHFARNDVG*
Ga0182136_103936413300015317Switchgrass PhyllosphereMVNIINAIFRGSNEPVHETKRQQKEYFRTVSHVSKGKHFRTPWSHIPISFSQADLRQQHYPHNDPLVIRANISKNSVHFAGNDVGRILVDNGSSAYILVWQCFVKMGFT*
Ga0182136_106124613300015317Switchgrass PhyllosphereMVNFINAISGGSNELVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAENDVGRIL
Ga0182148_108088613300015325Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLLLQHYPHNDPLVIRANIGKNSVHFAGND
Ga0182166_106004523300015326Switchgrass PhyllosphereVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFA
Ga0182166_110115713300015326Switchgrass PhyllosphereMKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILV
Ga0182166_111739723300015326Switchgrass PhyllosphereMIPERANDLVGGMVNVINAISGGSNEPVHETKRQRKEYLCTVSHVCEGKHFRTPWSHVPITFSEADLRLQHYPHNDPLVIHANIGRNSVHFAGNDVGRILIDN
Ga0182166_112404723300015326Switchgrass PhyllosphereMVNIINAISRGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTLWSHVPITFTQADLRLQHYLHNDPFVIRANIGKNSIHFTGNDVGRILVDNGSSADILVWQCFIKMGFTEQALKKSQYPL
Ga0182153_105828323300015328Switchgrass PhyllosphereMVNVINAISGGSNEPVHETKRQRKEYLRTVSHVCEGKNFRTPWSHVPITFSETNLRLQHYTHNGPLIIRANIGKNSVHFAGNDIGRILVDNGSSTDIITWQCFVKMGLTEQNLHKS*
Ga0182153_112896423300015328Switchgrass PhyllosphereMVNVINTISGGSNEPVHEMKRQRKEYLRAVSHVCEGKHFGTPWSHVPISFTEADLRLQHYPHNNLLIIRANIGKNSVHFAGNDVGRILVDNDSSADVITWPCFVKMGLTEK
Ga0182135_112033413300015329Switchgrass PhyllosphereAISGGSNEQVHETKKQRKEYLRTISHVSEGKHFQTPWSHVPISFTQEDLRLQYYPHNDPLVIRANIGNNSVHFAGNDVGRILVDNGSSADILVW*
Ga0182135_112370213300015329Switchgrass PhyllosphereMVNFINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRAYIGKNLVHFTGNDVGRILVDNGSSADILVWQCF
Ga0182135_112378613300015329Switchgrass PhyllosphereVINAISGGSNEPVHETKRQRKEYLRTVLHVCEGKHFCTPWSHVPITFSETDLRLQHYSHNDPLVIRANIGRNSIHFVGNDVGRNLVDNGSSA
Ga0182152_106892313300015330Switchgrass PhyllosphereDAPSGSMVNIINATSRGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLIIRANIGKNPVHFTGNDVGRILVNNGSSADILVWQCFVKMGFTEKTLQKS*
Ga0182152_115514123300015330Switchgrass PhyllosphereMVNIINAISGGSNEQVHETKKQRKEYLRTISHVSEGKHFQTPWSHVPISFTQEDLRLQHYPHNDPLVIRANIGKNSVHFAGND
Ga0182131_108914213300015331Switchgrass PhyllosphereMVNFINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEKALQKSHYPLIGFGGKRIEAL
Ga0182131_109858313300015331Switchgrass PhyllosphereVNVINAISGGLNEPVHETKRQRKEYLRTVSHVCEGKHFSTPWSHVLITFSEADLRLQHYPHNDPLVIGANIGRNSVHFGETT*
Ga0182131_111721123300015331Switchgrass PhyllosphereVNIINAISGGSNELVLETKRQHKEYFRTVSHVSEGKCFRTTWSHVPISFTQVDLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSAHILIWQCFVKMGFIETTLHKSQYPLIGFGGKRIEALGKI
Ga0182117_111884523300015332Switchgrass PhyllosphereMVNIINAISGGSNEPVHEMKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKVGFTEKALQKS*
Ga0182117_114025723300015332Switchgrass PhyllosphereSRVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVW*
Ga0182147_101173733300015333Switchgrass PhyllosphereVLETKRQRKEYFRTVSHVGEGKCFRTTWSHVPISFTQADLRLQQYPHNDPLVIRANIGKNSVHFTGND
Ga0182147_103314813300015333Switchgrass PhyllosphereMVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQVDLRLQHYPHNDPLVIRANIGKNSVHFAGNDV
Ga0182147_104584723300015333Switchgrass PhyllosphereMVNVINAISGGSNEPVHKTKKQRKEYLRTVSQVCEGKHFRTPWSHVQITFSGADLRLQHYPHNDPLVIQANISKNSVHFARNDIGRILDVNGSSTDIITWQCFVKMGLIEQNLHKSQYPHIGFSGKKIEALGRIELNVTFDEGTPRE*
Ga0182147_104590613300015333Switchgrass PhyllosphereMVNIVNAISGGSNEPVHDTKRQRKACFRTMSHVSEGKQFRTLRSHVPISFTQADLRLQHYPHNDSLVIRANIEKNSVHFARNDVGRILVDNGSSTDILIWQCFNKMGLTEKALQKSQYPLIGVGAYQRHLAMTPADANLGRQYFMNHE*
Ga0182147_105419023300015333Switchgrass PhyllosphereMVNIINAIFGGSNEPVHETKRQCKKYFRTVSHMSKGKCFRTPWSHVLISFTQADLRLQYYSHNDPLMIRANIGKNYVHFAGNDVGRILVDNGSSADILVWQCFVKMDFTEKALQ
Ga0182147_109159023300015333Switchgrass PhyllosphereVNVINALSGGSNEPVHETKCQRKEYLPTVSHVCEGKHFRITWSHIPITFSEAELRLQHYPHNDPLVIHANIGRNSVHFVGNDVGRILVDNGSSTDVLTWQCFLKMGFTEKNLHKSKYLLIGFEGKRIEALGKIE
Ga0182147_114064113300015333Switchgrass PhyllosphereMVNVINAISGGSNEPVHETKKQRKEYLRTVSHVCEGKNFRTPWSHVPITFSETNLRLQHYTHNGPLIIRANIGKNYVHFAGNDIGRILIDNGSSADIITWQCFVNMGLTEQNLHKSQYPLIGFGGKKIEAL
Ga0182150_108929223300015336Switchgrass PhyllosphereVNVINAISGGSNEPVHETKRQRKEYLRTISHVYEGKHFRTPWSHVPITFSEADLRLQHYPHNDDLRFQHYSHNDPLVILANIGR
Ga0182150_113634113300015336Switchgrass PhyllosphereGGSNELVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDLLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEKALQKSQYPLIGFGGKRIEALGKIELNVTFGEGAT*
Ga0182150_113672013300015336Switchgrass PhyllospherePSTVPERANDPVGGMVNVISAISDASNEPVHETKQQRKEYLRIISHVCEGKHFHTPWSHVPITFSEADLRLQHYPHNDPLVIHANIGRNSVHFARNDMGRILVDNGSSADIITWQCFIKMGLTESN*
Ga0182151_102543913300015337Switchgrass PhyllospherePERACDGPFGSMVNIINAISGGSNEPMHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVRRILVDNGSSADILVW*
Ga0182151_103956823300015337Switchgrass PhyllosphereMVNIINTISGGSNEPVHETKRQRKEYLRTVSHVCEGKHFSTPWSHVLITFSEADLRFQHCPHNDPLVIHANIGRNSVHFAGNDVGQILVYHGSSTYVLTWQCFVKMGFTEKNLHKTQYL
Ga0182151_108417523300015337Switchgrass PhyllosphereWANESPKQRTSGGMVNIINAISGESNKPVHETKRQLKEYFRTISHVSEGKHFRTPWSHVLISFTLADLRLQHYPHNDPLIIRANIGKN*
Ga0182151_113633913300015337Switchgrass PhyllosphereIYLPPQLKLEPGQVLERANDPAGGMVNVINTIFGGSNEPVHETKRQRKEYLRIISHVCEGKHFHTPWSHVPITFSEADLRLQHYPHNDPLVIHANIGRNSVHFARNDVGRILVDNGSSADIITWQCFIKMGLTESN*
Ga0182137_102147333300015338Switchgrass PhyllosphereVHETKRQRKEYFRTISHVSEGKCFRTTWLHIPISFTQADLRLQHYPHNDPLVIKANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFT
Ga0182137_111275413300015338Switchgrass PhyllosphereMVNVINVISGESNKPVHETKRQLKEYFRTISHVSEGKHFRTPWSHVLISFTPADLRLQHYPHNDPLIIRANIGKN*
Ga0182137_116699423300015338Switchgrass PhyllosphereMVNVINAISGGLNEPVHETKRQRKEYLGTVSHVCEGKHFRTLWSHLPVTFSEADLRLQHYPHNDPLVIIANIGKNSVHFAGNDVGWILVDNGSSADIITWQCFVKIGLTEQNLHKS*
Ga0182149_115153613300015339Switchgrass PhyllospherePERAADAPSGSMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWLHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFTGNDVGRILVDNGSSADILVWQCFVKMGFTEQALKKS*
Ga0182133_114807223300015340Switchgrass PhyllosphereMVNVINAISGGSNEPVHETKRQHKEYFKTVSHVSEGKHFRTPWSHVPIYFTQEDLRLQHYPHNDPLIIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMCFTEKALQKSHYPLIGFGGKRIEALGKIELNVTFGEGAT*
Ga0182115_109606333300015348Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKHFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIDKNSVHFAGNDVGRILVDNGSSVDILVWQCFVTMGFTEKAL*
Ga0182115_118111323300015348Switchgrass PhyllosphereTKKQRKEYLRTVSQVCEGKHFRTPWSHVQITFSGADLRLQHYPHNDPLVIQANISKNSMHFARNDIGRILDVNGSSADIITWQCFVKMGLIEQNLHKSQYPHIGFSGKKIEALGKIELNVTFGEGTPRE*
Ga0182185_111860913300015349Switchgrass PhyllosphereMVNVINAISGESNKPVHETKRQLKEYFRTISHVSEGKHFRTPWSHVLISFTPADLRLQHYPHNDPL
Ga0182185_111954313300015349Switchgrass PhyllosphereGASNEPVHETKQQRKEYLRIISHVCEGKHFHTPWSHVPITFSEADLRLQHYPHNDPLVIHANIGRNSVHFARNDVGRILVDNGSSADIITWQCFIKMGLTESN*
Ga0182185_113865023300015349Switchgrass PhyllosphereMVNIINAIFGGSNEPVHETKRQQKEYFRTVSQVSKGKHFRTSWSHVPISFSQADLRQQHYPHNDPLVIRANISKNSVHFAGNDVGRILVDNGSSTDILIWQYFVKMGVTEKDLQKS*
Ga0182185_125855713300015349Switchgrass PhyllosphereGQIPERATDAPSGSMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKHFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVW*
Ga0182163_116218813300015350Switchgrass PhyllosphereMWKTPSSSQPTLGDDPTAISGESNEPVHETKRQRKEYFRTVSHVSEGKHFRTLWSHIPISFTQTDLRLKHYPHNDPLVIRANIGKNYVHFAGNVVGRILVDNGSSTDILVWQCFVKMGFTEKALQKS*
Ga0182163_120930423300015350Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDIGRILVDNGSSTDILVWQCFDKMGFTEQSLKKSQYPLIGFGGKRIEALGKIEL
Ga0182163_122187713300015350Switchgrass PhyllosphereMVNIINAISRGSNEPVHETKRQQKEYFRTISHVSEGKHFRTPWSHVPISFTQAELRLQHYPHNDPIIIRENIGKNSVHFVGNDVGRILVDNGSSADILVWQCFIKMGFTEKALQKSQYPLIGCWHFLSRYQVLVTSATASKMLVGFP*
Ga0182163_129912413300015350Switchgrass PhyllosphereMVNIINAISGGSNNPVHETKRQCKEYFRTVSHVSEGKCFRTPWSHIPISFTQADLRLQHYPHNDPLVIRVNIGKNSVHFAGNDVGRILLDNMSSADIL
Ga0182163_129916823300015350Switchgrass PhyllosphereMVNVISAISGASNEPVHETKQQRKEYLRIISHVCEGKHFHTPWSHVPITFSEADLRLQHYPRNDPLVIHANIGRNLVHFARNDVGRILVDNDSSTYIITYQCFVKMRLTE*
Ga0182169_110057713300015352Switchgrass PhyllosphereAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFARNDVGRILIDNGSSADILVWQCFVKMGFTEHAL*
Ga0182169_121264313300015352Switchgrass PhyllosphereMVNIINAISGESNKPIHETKRQLKEYFRTISHVSEGKHFRTPWSHVMISFTPADLRLQHYPHNDPLIIRANIGKN*
Ga0182179_121715013300015353Switchgrass PhyllosphereFRTVSHVSEGRCFRTTWSHVPITFTQANLRLQHYPHNDPLIIRANIGKNSVNFAENDVGRILVDNGSSADILVWQCFVKMGFTEAALKKSQYPLIGFGGKRIEALGKIELNVTFGEGAA*
Ga0182167_115631713300015354Switchgrass PhyllosphereGSNEPVHETRRQCKKYFRTVSHMSKGKCFRTPWSHVLISFTLADLRLQYYSHNDPLMIRANIGKNYVHFAGNDVGRILVDNGSSADILVWQCFIKMDFTEKALQKS*
Ga0182167_119989723300015354Switchgrass PhyllosphereMVNIINTISGGSNEPVHEMKRQRKEYFRSVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVVRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMEFTERALQKSQYPLIGFGGKRIEALGKIELNVTFG*
Ga0182167_129444313300015354Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQAYLRLQHYPHNDPLVMRANIGKKSVHFVGNDVG
Ga0182167_131241013300015354Switchgrass PhyllosphereVNVINAISGGSNEPVHETKRQRKEYLYTISHVCEGKHFRTPWSHIPITLSEADLRLQHYPHKDPFV
Ga0182167_131660013300015354Switchgrass PhyllosphereMINVINAISGGSNEPVHEAKKQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADLRLQHYPHNVPLIIRANIGKNSVHFTRSNVGHILIDNGSSPDIITW*
Ga0182167_131951923300015354Switchgrass PhyllosphereVNVINAISGGSNEPVHETKRQRKEYLRTVSHVYEGKHFRTPWSHVPITFSEANLRLQHYPHNDPLIIRANNGKNSVQFTGNDVGRILVDNGSSADVVGAP*
Ga0182167_133242823300015354Switchgrass PhyllosphereMVNIINAISGRSNEPLHETKMQCKEYFRTVSHVSEGKLFRIPWSHIPISFTQADLRLQHYPHNNPLVIRANIGKNSV
Ga0182167_135793023300015354Switchgrass PhyllosphereMVNVINAISGGSNEPVHKTKKQRKEYLRTVSQVCEGKHFRTPWSHVQITFSGADLRLQHYPHNDPLVIQANISKNSVHFARNDIGRILDVNGSSADIITWQWFVKMGLIEQNLHKSQYPHIGFSGKKIEALGRIELNVTFGEGTP*
Ga0182197_114939113300017408Switchgrass PhyllosphereVNVINAISGGSNEPVHETKCQRKEYLRTVSHVCKGKYFRTPWSHVPITFSEADLRLQHYPHNDPLVIRANIGRNSVHFAGNDVGRILVDNGSSADALTWQCFLKMGFTEKNLHKSKYPLIGFWGKRIEALGKIELNVTFGEG
Ga0182199_119039813300017412Switchgrass PhyllosphereRKEYLGMVSHVCEGKHFRTLWSHLPVTFFEADLRLQHYPHNDSLVIIANIGKNSVHFAGNDVGWILVDNGSSADIITWQCFVKIGLTEQNLHES
Ga0182195_104234023300017414Switchgrass PhyllosphereVHETKRQRKEYFRTISHVSEGKCFRTPWPHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGQILVDNGSSADILLWQCFVKIGFTEKALQKS
Ga0182213_114085423300017421Switchgrass PhyllospherePPPKLELGTIPERANDPVGGTVNVINAISGGSNEPVHETKRQRKKYLRTVSHVCEGKHFRTPWSHVPVTFSEADLRLQHYLHIDPLVIRANIGRNSMHFAGNDVGRILVDNGSSANVLTW
Ga0182213_118314413300017421Switchgrass PhyllosphereIDAPSGSRVNIINTISGGSNEPMLETKRQHKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLQLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKLSFIETTLHKSPYPLIGFGGKRI
Ga0182213_119976813300017421Switchgrass PhyllosphereVNIINAISGGSNELVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLWLQHYPYNDPLIIRANIGKNSVH
Ga0182201_100829913300017422Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVW
Ga0182201_104616623300017422Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLLHYPHNDPLVIRANFGKTSVHFAGNDVGRILVDNGSSVDILVWECFVKMGFTEKALQKSQYPLIGF
Ga0182201_108397613300017422Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQHKEYFRTISHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFTGNDVERILVDNGSSADILVWQCFIKMGFT
Ga0182201_112804913300017422Switchgrass PhyllosphereVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPITFTQADLRMQHYPHNDPIVIRANIGKNSVHFAGNDVGR
Ga0182194_107501823300017435Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFTGNDVGRILVDNGSSADILVWQYFVKMGFTEQALKKSQYPLIGFGGKRI
Ga0182194_114875823300017435Switchgrass PhyllospherePPPKLEPGTIPERANDPIGGTVNVINAISGGSNEPVHETKHQRKEYLCTISHVCEGKHFRTPWSLVPITFSEADLRLQHYPHNDPLVIRANIGRNSKHFMGNDVGPILVDHGSSADVLT
Ga0182198_103477323300017445Switchgrass PhyllosphereMVNVISAISGASNEPVHETKQQRKEYLRIISHVCEGKHFHTPWSHVPITFSEADLRLQHYPHNDPLVIHANIGRNSVHFARNDVGRILVDNGSSADIITWQCFIKMGLTESN
Ga0182198_108456623300017445Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFQTPWSHVPISFTQADLRLQHYPHNDPLAIRANIGKNSIHFAGNDVGRILIDNGSSADILVWQCFVKMGFTEKALQKSQYPLIGFGGKRTEALGK
Ga0182198_108729923300017445Switchgrass PhyllosphereSGSMVNIINVISGGSNEPVHETKRQHKEYFRTVSHVSEGKCFRTLWSHVPISFTQADLQLQHYPHNDPLVIRTNIGKNSVHFAGNDVGRILVDNGSYADILVWQCFVKMGFTEQALQKSQYPLIGFGGKRIEALGKIELNVTFGEGAK
Ga0182198_109514413300017445Switchgrass PhyllosphereMVNIINAIFKGSNEPVHETRRQCKKYFRTVSHMSKGKCFRTPWSHVLISFTQADLRLQYYSHNDPLMIRANIGKNYVHFAGNDVGRILVDNGSSADILVWQCFVKMDFT
Ga0182198_120483123300017445Switchgrass PhyllosphereMVNIINAISGGSNELVHETKRQRKEYFRTVSHVSKGKCFRTPWSHVPVSFTQAHLRLQHYPHNDPLVIRANIGKNLVHFAGNDVGPILVDNRSSADILVWQCFVKMGFTEKALQKSQYPLIGFGGKRTEALGK
Ga0182215_104499523300017447Switchgrass PhyllosphereVNVINAISGGSNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADLRLQHYPHNDPLVIRANIGKNSVYFAGNDVGQILVDNGNSTDVLAW
Ga0182210_111362933300017692Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNRSSADILV
Ga0182216_101904333300017693Switchgrass PhyllosphereVNVINAISGGSNELVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSDANLRLQHYPHNDPLVIRANIGRNFVHFTGNNIGRILVDNGSYADVLTWQCFVKMGFSEKNLHKSQYPL
Ga0182216_106808823300017693Switchgrass PhyllospherePKIEPGQISERAGDGPSGSMVNIINAISGGSNELVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQVDLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGSQSKL
Ga0182216_109487013300017693Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQHKEYFRTVSHVSEGKHFRTQWSHILISFTQAYLRLQYYPHNDPLVIRPNVGKNSIHFTRNDVGRIIVDNGSSADFLVWQCFIKMGLTEKSLQKSHYPLIGFGGK
Ga0182216_109668323300017693Switchgrass PhyllosphereVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQTDLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTET
Ga0182211_104080433300017694Switchgrass PhyllosphereVNVINAISGRSNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADLRLQHYPHNDPLIIRANIGKNSVQFVGNDVGRILVDNG
Ga0207650_1149976523300025925Switchgrass RhizosphereMVNIINAISRGSNEPVHEMKRKRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEQSLKKSQYPLIGFRGKRIEALGKIELNVTFGEGV
Ga0207641_1124671713300026088Switchgrass RhizosphereMNAIYGGSNEPVHEMKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGND
Ga0207676_1163712323300026095Switchgrass RhizosphereVNVINAISGGSNEPVQETKCQRKEYLRIVLHVCKSKYFRTPWSHVPITFSEADLRLQHYPHNDPLVIRANIVRNSVHFARNDVGQILINNGSSADVLTWQCFLKMGFTEKNLHKSKYPLI
Ga0207675_10072475213300026118Switchgrass RhizosphereMNAIYGGSNEPVHEMKRQRKEYFRTVAHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEQSLKKSQYPLIGFGGKIIEALGKIELNVTFGEGVMQR
Ga0268344_100632023300028051PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSEGKCFRTTCSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVG
Ga0268346_101868013300028053PhyllosphereSGGSNKPVHEMKKQRKEYFRTVSHVSGGRCFQTTWSRVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTETALKKS
Ga0268338_101752313300028055PhyllosphereMKKQRKEYFRTVSHISEGICFRSTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGN
Ga0268330_105164123300028056PhyllosphereMVNFINAISGGSNEPVHETKRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGS
Ga0268314_101298123300028061PhyllosphereVLETKRQRKEYFRIISHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTETALHKSQYPLIGFGGKRIEALGKIELNVIFGEGAAQRTE
Ga0268334_100372413300028140PhyllosphereMNAVYGGSNEPVHEMKRQRKEYFRTVAHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMG
Ga0268341_100394013300028154PhyllosphereVNVINAISGGSNEPVHETKHQRKEYLRTVSHVCEGKHFSTPWSHVLITFSEADLRFQHCPHNDPLVIHANIGRNS
Ga0268310_101721523300028262PhyllosphereVLETKRQRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRI
Ga0268317_101010113300028468PhyllosphereVIIINAISGGSNEPVLETKRRRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEAAL
Ga0268319_102124923300028473PhyllosphereKEYFRTVSHISEGRYFRTTWSHVPISFTQADLRLQHYPHNDPLIIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTETALKKSQYPLIGFGG
Ga0268309_100286913300028477PhyllosphereMVNIINAISGGSNEPVHEMKRQRKEYFRTVSHVSEGKCFRTPWSHVPITFTQADLRLQHYPHNDPLVIRANIGKNSVHFTGNDVGRI
Ga0214488_102751623300032467Switchgrass PhyllosphereVNVINAISGGSNEPVHEMKRQRKEYLRTVSHVCEGKHFRTPWSHIPITFSEANFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSADVLT
Ga0214483_104018813300032548Switchgrass PhyllosphereAISGGLNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSADVLT
Ga0321338_125787323300032593Switchgrass PhyllosphereNVINAISGGSNELVLETKRQRKEYFQSASHVSEVRCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILI
Ga0214499_101576423300032697Switchgrass PhyllosphereMVSIINAISGGSNEPVHETKRQHKEYFRTVSHVSEGKHFRTQWSHILISFTQADLRLQYYPHNDPLVIRPNVGKNSIHF
Ga0214494_105666823300032699Switchgrass PhyllosphereVLETKRRRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGF
Ga0214494_108581613300032699Switchgrass PhyllosphereVLETKRQRKEYFKIVSHVSKGKCFRKTWLHVSISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDN
Ga0314742_106094313300032781Switchgrass PhyllosphereSKRRALWQQVNIIDAISGGSNEPVLEKKRQRKEYFRTVSHVSESRCFRTTWLHVPISFMQANLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTEIALHKS
Ga0314748_108150823300032791Switchgrass PhyllosphereVNVINAISGRSNEPVHETKRQRKEYLRTVSHVCEEKHFRTPWSHVPITFSEADLRLQHYPHNDPLVVGANIGRNSVHFAGNDVGRILVDNSSSADVLTWQCFVKMGFTEKNLHKSQYPLIGFGGKRIEALGKMS
Ga0314745_101259013300032812Switchgrass PhyllosphereERASDPPPSSMVNIINAISGGSNEPVHETKRQHKEYFRTVSHVSEGKHFRTQWSHILISFTQADLRLQYYPHNDPLVIRPNVGKNSIHFTRNDVGRIIVDNGSSADFLVWQCFIKMGLTEKSLQK
Ga0314745_106079813300032812Switchgrass PhyllosphereERANDLVGGKVNVINAISGGLNEPVHEMKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSVDVLT
Ga0314723_102746613300032823Switchgrass PhyllosphereMVNIINAISGGSNEPVHETKRQHKEYFRTVSHVSEGKHFRTQWSHILISFTQADLRLQYYPHNDPLVIRPNVGMNS
Ga0314724_10297513300032825Switchgrass PhyllosphereVLETKRRRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFARNDVGRTLV
Ga0314737_101168833300032875Switchgrass PhyllosphereVLETKRRRKEYFRTVSHVSEGKCFRTTWSHVPISFTQVDLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDN
Ga0314737_101708813300032875Switchgrass PhyllosphereMVNIINVISGGSNEPGHETMRQRKEYFRTVSHVSEGKCFRTPWSHVPISFTQADLRLQHYPHNDPLVIKANIGKNSVHFAGNDVERILVDNGSSVDIVVWQCFVKMGFTEAALHKSPYPLIGFGGKRIEALGKIELNVTFGEGAAQ
Ga0314734_100118163300032916Switchgrass PhyllosphereVNVINAISGGLNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNAPLVIRANIGRNSVHFAGNDVSRILVDNGSSADVLT
Ga0314734_104528913300032916Switchgrass PhyllosphereMVNVINAISGGSNEPVHETKKQRKAYLQIVLHVCEGMHFRTPWSHVPISFTEADLRPQHYAHNDPLIIRANSGKNSVHFARNDLGRILVDNGSSIDILIWQCFVRWQTSHSFYI
Ga0314741_105101313300032934Switchgrass PhyllosphereRANDPVGGTVNVINAISGGLNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSADVLT
Ga0314738_101616133300032959Switchgrass PhyllosphereVNVINAISGGLNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSADVLT
Ga0314722_100847933300032966Switchgrass PhyllosphereVNIINAISGGSNEPVLETKRQRKEYFRTVSHVSKGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNNVGRILVDNGSSADILVWQCFVKMGFTE
Ga0314752_104214213300032976Switchgrass PhyllosphereGGLNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSADVLT
Ga0314755_101965223300033538Switchgrass PhyllosphereVNVINAISGGLNEPVHETKRQRKEYLRTVSHVCEGKHFRTPWSHVPITFSEADFRLQHYPHNDPLVIRANIGRNSVHFAGNDVSRILVDNGSSVDVLT
Ga0314769_104716413300033542Switchgrass PhyllosphereVLETKRRRKEYFRTVSHVSEGKCFRTTWSHVPISFTQADLRLQHYPHNDPLVIRANIGKNSVHFAGNDVGRILVDNGSSADILVWQCFVKMGFTETALHKSPYPLIGFGGKRIEALGKIELNVTFG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.