NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F037174

Metagenome / Metatranscriptome Family F037174

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F037174
Family Type Metagenome / Metatranscriptome
Number of Sequences 168
Average Sequence Length 44 residues
Representative Sequence MDITRKYEFVDEAEANAAIDLLRDEEGNLTQSVVKLGYLTTTP
Number of Associated Samples 95
Number of Associated Scaffolds 168

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 11.24 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 91.07 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (72.024 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(60.714 % of family members)
Environment Ontology (ENVO) Unclassified
(83.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.310 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.08%    β-sheet: 2.82%    Coil/Unstructured: 83.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 168 Family Scaffolds
PF13385Laminin_G_3 16.07
PF09206ArabFuran-catal 3.57
PF13392HNH_3 0.60
PF02018CBM_4_9 0.60
PF00166Cpn10 0.60

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 168 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.60


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A72.02 %
All OrganismsrootAll Organisms27.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10004842Not Available7520Open in IMG/M
3300000116|DelMOSpr2010_c10027505All Organisms → Viruses → Predicted Viral2690Open in IMG/M
3300000116|DelMOSpr2010_c10085047Not Available1239Open in IMG/M
3300000116|DelMOSpr2010_c10099035Not Available1104Open in IMG/M
3300000116|DelMOSpr2010_c10158043Not Available768Open in IMG/M
3300000117|DelMOWin2010_c10052975Not Available1774Open in IMG/M
3300000117|DelMOWin2010_c10099003Not Available1074Open in IMG/M
3300001938|GOS2221_1008583All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium5221Open in IMG/M
3300006027|Ga0075462_10084140Not Available996Open in IMG/M
3300006027|Ga0075462_10167201Not Available669Open in IMG/M
3300006027|Ga0075462_10260427Not Available512Open in IMG/M
3300006752|Ga0098048_1230965Not Available543Open in IMG/M
3300006802|Ga0070749_10036881All Organisms → Viruses → Predicted Viral3019Open in IMG/M
3300006802|Ga0070749_10164347Not Available1285Open in IMG/M
3300006802|Ga0070749_10219604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus1084Open in IMG/M
3300006802|Ga0070749_10349262Not Available822Open in IMG/M
3300006802|Ga0070749_10621116Not Available582Open in IMG/M
3300006802|Ga0070749_10659785Not Available561Open in IMG/M
3300006802|Ga0070749_10685587Not Available548Open in IMG/M
3300006810|Ga0070754_10112856Not Available1331Open in IMG/M
3300006810|Ga0070754_10123705Not Available1258Open in IMG/M
3300006810|Ga0070754_10125146All Organisms → Viruses → Predicted Viral1249Open in IMG/M
3300006810|Ga0070754_10130088Not Available1219Open in IMG/M
3300006810|Ga0070754_10238388Not Available834Open in IMG/M
3300006810|Ga0070754_10346211Not Available658Open in IMG/M
3300006810|Ga0070754_10386870Not Available614Open in IMG/M
3300006810|Ga0070754_10394023Not Available607Open in IMG/M
3300006810|Ga0070754_10424005Not Available580Open in IMG/M
3300006869|Ga0075477_10259414Not Available698Open in IMG/M
3300006870|Ga0075479_10052322All Organisms → Viruses → Predicted Viral1741Open in IMG/M
3300006874|Ga0075475_10126355Not Available1137Open in IMG/M
3300006916|Ga0070750_10040651Not Available2283Open in IMG/M
3300006916|Ga0070750_10208338Not Available862Open in IMG/M
3300006916|Ga0070750_10356356Not Available616Open in IMG/M
3300006919|Ga0070746_10311549Not Available720Open in IMG/M
3300006919|Ga0070746_10317293Not Available712Open in IMG/M
3300006919|Ga0070746_10373066Not Available643Open in IMG/M
3300006919|Ga0070746_10476952Not Available551Open in IMG/M
3300006920|Ga0070748_1169271All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium807Open in IMG/M
3300007229|Ga0075468_10024680All Organisms → Viruses → Predicted Viral2186Open in IMG/M
3300007229|Ga0075468_10186975Not Available610Open in IMG/M
3300007234|Ga0075460_10187355Not Available708Open in IMG/M
3300007236|Ga0075463_10120456Not Available847Open in IMG/M
3300007236|Ga0075463_10171980Not Available698Open in IMG/M
3300007276|Ga0070747_1183343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage743Open in IMG/M
3300007276|Ga0070747_1193674Not Available718Open in IMG/M
3300007276|Ga0070747_1199090Not Available706Open in IMG/M
3300007276|Ga0070747_1325691Not Available526Open in IMG/M
3300007344|Ga0070745_1077060Not Available1329Open in IMG/M
3300007344|Ga0070745_1341211Not Available527Open in IMG/M
3300007345|Ga0070752_1220265Not Available749Open in IMG/M
3300007345|Ga0070752_1244543Not Available700Open in IMG/M
3300007345|Ga0070752_1317685Not Available590Open in IMG/M
3300007345|Ga0070752_1338905Not Available566Open in IMG/M
3300007346|Ga0070753_1071830Not Available1383Open in IMG/M
3300007346|Ga0070753_1077448All Organisms → Viruses → Predicted Viral1321Open in IMG/M
3300007346|Ga0070753_1149217Not Available886Open in IMG/M
3300007539|Ga0099849_1234547Not Available679Open in IMG/M
3300007542|Ga0099846_1255872Not Available607Open in IMG/M
3300007640|Ga0070751_1210109Not Available753Open in IMG/M
3300007640|Ga0070751_1215291Not Available741Open in IMG/M
3300007640|Ga0070751_1380765Not Available511Open in IMG/M
3300009074|Ga0115549_1238589Not Available577Open in IMG/M
3300009435|Ga0115546_1241578Not Available620Open in IMG/M
3300010149|Ga0098049_1133452Not Available770Open in IMG/M
3300010297|Ga0129345_1170130Not Available781Open in IMG/M
3300010297|Ga0129345_1229805Not Available652Open in IMG/M
3300010299|Ga0129342_1099745Not Available1090Open in IMG/M
3300010300|Ga0129351_1129588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1003Open in IMG/M
3300010316|Ga0136655_1078831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus1006Open in IMG/M
3300010316|Ga0136655_1083814All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus971Open in IMG/M
3300013010|Ga0129327_10298708Not Available833Open in IMG/M
3300017697|Ga0180120_10320854Not Available617Open in IMG/M
3300017697|Ga0180120_10352848Not Available582Open in IMG/M
3300017697|Ga0180120_10438741Not Available510Open in IMG/M
3300017706|Ga0181377_1016109All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium TMED671694Open in IMG/M
3300017725|Ga0181398_1069025Not Available848Open in IMG/M
3300017991|Ga0180434_10810213Not Available707Open in IMG/M
3300018041|Ga0181601_10544460Not Available600Open in IMG/M
3300018416|Ga0181553_10046520All Organisms → Viruses → Predicted Viral2914Open in IMG/M
3300018421|Ga0181592_10050834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_46_133309Open in IMG/M
3300019266|Ga0182061_1174931Not Available540Open in IMG/M
3300019765|Ga0194024_1030997All Organisms → Viruses → Predicted Viral1160Open in IMG/M
3300020185|Ga0206131_10364134Not Available618Open in IMG/M
3300020187|Ga0206130_10158076All Organisms → Viruses → Predicted Viral1168Open in IMG/M
3300020187|Ga0206130_10260999Not Available777Open in IMG/M
3300021373|Ga0213865_10133970Not Available1286Open in IMG/M
3300021375|Ga0213869_10196194All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300021378|Ga0213861_10108501All Organisms → Viruses → Predicted Viral1641Open in IMG/M
3300021389|Ga0213868_10114816All Organisms → Viruses → Predicted Viral1714Open in IMG/M
3300021389|Ga0213868_10187855All Organisms → Viruses → Predicted Viral1248Open in IMG/M
3300021389|Ga0213868_10212761All Organisms → Viruses → Predicted Viral1151Open in IMG/M
3300021425|Ga0213866_10135785Not Available1314Open in IMG/M
3300021957|Ga0222717_10375843Not Available792Open in IMG/M
3300021958|Ga0222718_10119323Not Available1528Open in IMG/M
3300022053|Ga0212030_1035765Not Available696Open in IMG/M
3300022065|Ga0212024_1065730Not Available642Open in IMG/M
3300022069|Ga0212026_1056946Not Available591Open in IMG/M
3300022071|Ga0212028_1016095All Organisms → Viruses → Predicted Viral1265Open in IMG/M
3300022072|Ga0196889_1085384Not Available585Open in IMG/M
3300022159|Ga0196893_1019424Not Available624Open in IMG/M
3300022169|Ga0196903_1004816All Organisms → Viruses → Predicted Viral1764Open in IMG/M
3300022169|Ga0196903_1021631Not Available775Open in IMG/M
3300022183|Ga0196891_1019970Not Available1283Open in IMG/M
3300022183|Ga0196891_1059752Not Available685Open in IMG/M
3300022200|Ga0196901_1210151Not Available620Open in IMG/M
3300022925|Ga0255773_10091823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Neritesvirus → Neritesvirus scam81628Open in IMG/M
3300023105|Ga0255782_10075296Not Available1830Open in IMG/M
(restricted) 3300024062|Ga0255039_10557438Not Available502Open in IMG/M
3300024281|Ga0228610_1040609Not Available628Open in IMG/M
3300024291|Ga0228660_1020570Not Available1247Open in IMG/M
3300024329|Ga0228631_1136863Not Available547Open in IMG/M
(restricted) 3300024518|Ga0255048_10019124All Organisms → Viruses → Predicted Viral3530Open in IMG/M
(restricted) 3300024518|Ga0255048_10046447All Organisms → Viruses → Predicted Viral2185Open in IMG/M
(restricted) 3300024518|Ga0255048_10058569Not Available1924Open in IMG/M
(restricted) 3300024518|Ga0255048_10323434Not Available747Open in IMG/M
(restricted) 3300024520|Ga0255047_10038963Not Available2490Open in IMG/M
(restricted) 3300024520|Ga0255047_10047622All Organisms → Viruses → Predicted Viral2236Open in IMG/M
(restricted) 3300024520|Ga0255047_10062966Not Available1918Open in IMG/M
(restricted) 3300024520|Ga0255047_10109113All Organisms → Viruses → Predicted Viral1420Open in IMG/M
3300025508|Ga0208148_1115637Not Available559Open in IMG/M
3300025543|Ga0208303_1038093Not Available1234Open in IMG/M
3300025543|Ga0208303_1040944Not Available1174Open in IMG/M
3300025543|Ga0208303_1089333Not Available669Open in IMG/M
3300025577|Ga0209304_1105393All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium633Open in IMG/M
3300025630|Ga0208004_1025498Not Available1787Open in IMG/M
3300025647|Ga0208160_1068575Not Available971Open in IMG/M
3300025652|Ga0208134_1090847Not Available863Open in IMG/M
3300025671|Ga0208898_1090330Not Available959Open in IMG/M
3300025671|Ga0208898_1106436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage840Open in IMG/M
3300025674|Ga0208162_1131071Not Available708Open in IMG/M
3300025674|Ga0208162_1138287Not Available680Open in IMG/M
3300025751|Ga0208150_1081841All Organisms → cellular organisms → Bacteria → Proteobacteria1069Open in IMG/M
3300025759|Ga0208899_1041194All Organisms → Viruses → Predicted Viral2059Open in IMG/M
3300025759|Ga0208899_1058325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1612Open in IMG/M
3300025759|Ga0208899_1090709All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300025759|Ga0208899_1159512Not Available761Open in IMG/M
3300025769|Ga0208767_1196772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage681Open in IMG/M
3300025771|Ga0208427_1006460All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium SW_4_49_114714Open in IMG/M
3300025771|Ga0208427_1042366Not Available1705Open in IMG/M
3300025771|Ga0208427_1194437Not Available647Open in IMG/M
3300025806|Ga0208545_1034334Not Available1606Open in IMG/M
3300025815|Ga0208785_1075316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage879Open in IMG/M
3300025818|Ga0208542_1136337Not Available677Open in IMG/M
3300025818|Ga0208542_1184382Not Available548Open in IMG/M
3300025828|Ga0208547_1054760All Organisms → Viruses → Predicted Viral1364Open in IMG/M
3300025840|Ga0208917_1196211Not Available675Open in IMG/M
3300025853|Ga0208645_1057877Not Available1806Open in IMG/M
3300025889|Ga0208644_1120219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus1255Open in IMG/M
3300025889|Ga0208644_1259740Not Available713Open in IMG/M
3300025889|Ga0208644_1387067Not Available519Open in IMG/M
3300026503|Ga0247605_1067737Not Available883Open in IMG/M
3300028109|Ga0247582_1200244Not Available505Open in IMG/M
3300028127|Ga0233401_1037034All Organisms → Viruses → Predicted Viral1227Open in IMG/M
3300028131|Ga0228642_1095570Not Available752Open in IMG/M
3300029308|Ga0135226_1022629Not Available601Open in IMG/M
3300032136|Ga0316201_11211832Not Available630Open in IMG/M
3300032277|Ga0316202_10527967Not Available555Open in IMG/M
3300032373|Ga0316204_10571917Not Available833Open in IMG/M
3300032373|Ga0316204_11277109Not Available510Open in IMG/M
3300034374|Ga0348335_020967All Organisms → Viruses → Predicted Viral3144Open in IMG/M
3300034374|Ga0348335_066454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1288Open in IMG/M
3300034374|Ga0348335_135799Not Available699Open in IMG/M
3300034375|Ga0348336_099950Not Available987Open in IMG/M
3300034375|Ga0348336_120633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage839Open in IMG/M
3300034375|Ga0348336_123992All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon820Open in IMG/M
3300034375|Ga0348336_144027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage720Open in IMG/M
3300034375|Ga0348336_188096Not Available566Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous60.71%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.33%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.95%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater4.76%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.17%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.57%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.79%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.79%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.19%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.19%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.60%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow0.60%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.60%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.60%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.60%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001938Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024281Seawater microbial communities from Monterey Bay, California, United States - 11DEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024329Seawater microbial communities from Monterey Bay, California, United States - 39DEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_10004842123300000116MarineMKIIRKYEFVDKAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDE
DelMOSpr2010_1002750553300000116MarineMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPAT
DelMOSpr2010_1008504723300000116MarineMRKLRKYEFVDEAAANTAIDLLRDKEGNLTQSVVKLGFIVKTAGTYD
DelMOSpr2010_1009903513300000116MarineMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEEGNEV
DelMOSpr2010_1015804313300000116MarineMRITRKYEFVDEAEANKAIDLLRDEEGNLTQSVVKLGY
DelMOWin2010_1005297513300000117MarineMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDE
DelMOWin2010_1009900323300000117MarineMDITRKYEFVDEAEANASIDLLRDEEGNLTESVVKLGYLTITPAQ
GOS2221_100858313300001938MarineMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKT
Ga0075462_1008414013300006027AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLG
Ga0075462_1016720123300006027AqueousMDITRKYEFVDEVEANEAIDLLRDEEGNLTESVVKLGYL
Ga0075462_1026042723300006027AqueousMDITRKYEFVDEAEANASIDLLRNEEGNLTQSVVKLGYLTTTPAQYDEEGNTI
Ga0098048_123096513300006752MarineMKLTRKYEFVDEAEANAAIDLLRNEEANLTQSVVKLGFIVKKTG
Ga0070749_1003688113300006802AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGF
Ga0070749_1016434713300006802AqueousMKLTRKYEFVDEAEANAAVDLLRDKEGNLTQSVVKLGY
Ga0070749_1021960413300006802AqueousMTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATY
Ga0070749_1034926223300006802AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGN
Ga0070749_1062111613300006802AqueousMRITRKYEFVDEAEANASIDLLRDEEGNLTQSVVK
Ga0070749_1065978513300006802AqueousMRLTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATY
Ga0070749_1068558713300006802AqueousMGITRKYEFVDEAAVNESIDLLRDNEGNLTQSVVK
Ga0070754_1011285613300006810AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKL
Ga0070754_1012370523300006810AqueousMKLTRKYEFVDEAAANASIDLLRNEEGNLTQSVVKLGYLTITPPQYDEEGNTIKEAV
Ga0070754_1012514633300006810AqueousMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYL
Ga0070754_1013008823300006810AqueousMDITRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGYLTTTPAQYD
Ga0070754_1023838813300006810AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATY
Ga0070754_1034621113300006810AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATY
Ga0070754_1038687013300006810AqueousMDITRKYEFVDEAEANAAIDLLRNEEGNLTQSVVKLGY
Ga0070754_1039402323300006810AqueousMRITRKYEFVDEAAADAAIDLLRNKEGSLTQSVVKLGYL
Ga0070754_1042400523300006810AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGEYDEEGNEVTAPV
Ga0075477_1025941413300006869AqueousMKLTRKYEFVDEAKADASIDLLRNEEGNLTESVVKLGYL
Ga0075479_1005232223300006870AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAG
Ga0075475_1012635523300006874AqueousMKLTRKYEFVDEAKADASIDLLRNEEGNLTESVVKLGYLTI
Ga0070750_1004065113300006916AqueousMRITRKYEFVDEAEANEAIDLLRNEEGNLTQSVVKLGYLTIEPPVIDEEG
Ga0070750_1020833813300006916AqueousMRITRKYEFVDEAEANEAIDLLRDKEGNLTQSVVKLGYLTITPPVID
Ga0070750_1035635613300006916AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTKTPATY
Ga0070746_1031154923300006919AqueousMDVTRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGHIVKV
Ga0070746_1031729313300006919AqueousMDITRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGHI
Ga0070746_1037306623300006919AqueousMDITRKYEFVDEAEANASIDLLRNEEGNLTESVVKLGYL
Ga0070746_1047695223300006919AqueousMGITRKYEFVDEAEANAAIDLLRNEEGNLTQSVVKLGYLTI
Ga0070748_116927113300006920AqueousMTRLTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELTP
Ga0075468_1002468053300007229AqueousMITRKYEYVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDE
Ga0075468_1018697513300007229AqueousMTRLTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELT
Ga0075460_1018735523300007234AqueousMDITRKYEFVDEVEANEAIDLLRDEEGNLTQSVVKLG
Ga0075463_1012045623300007236AqueousMRITRKYEFIDEAEANEAIDLLRDKEGNLTQSVVKLGYLTIT
Ga0075463_1017198023300007236AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGY
Ga0070747_118334313300007276AqueousMITRKYEFTNEAAVDAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELTP
Ga0070747_119367433300007276AqueousMITRKYEYVDEAAADAAIDLLRDEEGNLTEAVVKLGYL
Ga0070747_119909013300007276AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKKAGEYDEEGNEVTAPVLSKKY
Ga0070747_132569113300007276AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELTP
Ga0070745_107706013300007344AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVK
Ga0070745_134121133300007344AqueousMRLTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYL
Ga0070752_122026523300007345AqueousMTRLTRKYEFVDEAAANKAIDLLRDEEGNLTQSVVKLGYLTITPAVIDEEGN
Ga0070752_124454323300007345AqueousMKLTRKYEFVDEAAVNEVIDLLRDKEGNLTQSVVKLGHIVKVKGVYDEQGNEITAPVF
Ga0070752_131768523300007345AqueousMDITRKYEFVDEAEANASIDLLRDEEGNLTQSVVKLGYLTIEPPVIDEEGNTIKEA
Ga0070752_133890513300007345AqueousMKIIRKYEFVDEAAANAAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEEGNEVTAPVL
Ga0070753_107183013300007346AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEDG
Ga0070753_107744813300007346AqueousMKVTRKYEFVDEAEANEAIDLLRNEEGNLTQSVVKL
Ga0070753_114921723300007346AqueousMTRLTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTT
Ga0099849_123454723300007539AqueousMKIIRKYEFVDEAAANTAIDLLRDKEGNLTQSVVKLGFIVKTAGEYDEEGNEVTAPVL
Ga0099846_125587223300007542AqueousMDITRKYEFADEAEADASIDLLRDEEGNLTQSVVKLGYL
Ga0070751_121010913300007640AqueousMDITRKYEFVDEAEANAAIDLLRNEEGNLTQSVVK
Ga0070751_121529123300007640AqueousMGITRKYEFVDEAAVNESIDLLRDNEGNLTQSVVKLGYLTITP
Ga0070751_138076533300007640AqueousMRLTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPA
Ga0115549_123858913300009074Pelagic MarineMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGN
Ga0115546_124157813300009435Pelagic MarineMRITRKYEFVDEEEADASIDLLRDEEGNLTQSVVKL
Ga0098049_113345213300010149MarineMDITRKYEFLDEAEANKAIDLLRNKQGNLTESVVKLGYLTITPAVIDEE
Ga0129345_117013023300010297Freshwater To Marine Saline GradientMDITRKYEFVDEAEANKAIDLLRDEEGNLTESVVKLGYLTITPAQYDEEGN
Ga0129345_122980523300010297Freshwater To Marine Saline GradientMKLTRKYEFVDEAEANASIDLLRNEEGNLTQSVVKLGYLTTTPA
Ga0129342_109974533300010299Freshwater To Marine Saline GradientMTLLTRKYEFVDEAEANASIDLLRNEEGNLTQSVVKLGYLTITPPQY
Ga0129351_112958813300010300Freshwater To Marine Saline GradientMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYD
Ga0136655_107883113300010316Freshwater To Marine Saline GradientMITRKYEYVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEE
Ga0136655_108381433300010316Freshwater To Marine Saline GradientMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLG
Ga0129327_1029870823300013010Freshwater To Marine Saline GradientMITRKYEFVDEAAADAAIDILRDEEGNLTENVVKLGYLVTTPAQYEGDVEIS
Ga0180120_1032085423300017697Freshwater To Marine Saline GradientMRITRKYEFVDEAEANASIDLLRNEEGNLTESVVKLGYLIIEPPVIDEE
Ga0180120_1035284813300017697Freshwater To Marine Saline GradientMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEG
Ga0180120_1043874113300017697Freshwater To Marine Saline GradientMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATY
Ga0181377_101610913300017706MarineMITRKYEFVDEAAADVAIDILRDEEGNLTEAVVKLG
Ga0181398_106902523300017725SeawaterMKLTRKYEFLDEAEANEAIDLLRDEEGNLTQSVVKLGYLTITPP
Ga0180434_1081021323300017991Hypersaline Lake SedimentMKLTRKYEFVDEAEANASIDLLRDEEGNLTESVVKLGYLTITPAQYDEEGN
Ga0181601_1054446023300018041Salt MarshMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTKTPATYD
Ga0181553_1004652033300018416Salt MarshMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGEYDE
Ga0181592_1005083413300018421Salt MarshMKVTRKYEFTDEAAADAAIDLLKDSEGNLTQSVVKLGY
Ga0182061_117493133300019266Salt MarshMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTKTPATYDEEGNE
Ga0194024_103099723300019765FreshwaterMRITRKYEFVDEAEANEAIDLLRDEEGSLTESVVKLGYLTITPPQYDEEGN
Ga0206131_1036413413300020185SeawaterMKRLTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLT
Ga0206130_1015807613300020187SeawaterMKRLTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGY
Ga0206130_1026099923300020187SeawaterMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEE
Ga0213865_1013397023300021373SeawaterMDITRKYEFVDEVEANAAIDLLRDEEGNLTQSVVTL
Ga0213869_1019619433300021375SeawaterMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLT
Ga0213861_1010850143300021378SeawaterMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKL
Ga0213868_1011481643300021389SeawaterMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELT
Ga0213868_1018785513300021389SeawaterMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGY
Ga0213868_1021276133300021389SeawaterMITRKYEYVDEAAADAAIDLLRDEEGNLTEAVVKLG
Ga0213866_1013578513300021425SeawaterMKLTRKYEFVDEAEANASIDLLRDEEGNLTQSVVK
Ga0222717_1037584313300021957Estuarine WaterMITRKYEFVDEAAADVAIDILRDEEGNLTEAVVKLGY
Ga0222718_1011932323300021958Estuarine WaterMDVTRKYEFVDEAAADAAIDLLRDEEGNLTQSVVKLGYLTIE
Ga0212030_103576513300022053AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYD
Ga0212024_106573033300022065AqueousMITRKYEFVDEAEANASIDLLRDEEGNLTQSVVKLGYLTITPPQYDEE
Ga0212026_105694613300022069AqueousMDITRKYEFVDEAEANASIDLLRDEEGNLTQSVVKLGYLTIEPPVIDEEGN
Ga0212028_101609513300022071AqueousMKIIRKYEFVDEAAANTAIDLLRDKEGNLTQSVVKLGFIVKT
Ga0196889_108538413300022072AqueousMDVTRKYEFVDEAEANEAIDLLRDEEGNLTESVVKLGYLTIT
Ga0196893_101942413300022159AqueousMDVTRKYEFVDEAEANASIDLLRDEEGNLTQSVVKLGYLTITPAVK
Ga0196903_100481613300022169AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPA
Ga0196903_102163113300022169AqueousMITRKYEYVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGN
Ga0196891_101997013300022183AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEEGNE
Ga0196891_105975213300022183AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLT
Ga0196901_121015113300022200AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPAT
Ga0255773_1009182313300022925Salt MarshMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIV
Ga0255782_1007529643300023105Salt MarshMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELTPAIVS
(restricted) Ga0255039_1055743813300024062SeawaterMKLTRKYEFTNEAAADVAIDILRDEEGNLTEAVVKLGYLVTTPAT
Ga0228610_104060913300024281SeawaterMKLTRKYEFVYEAEANEAIDLLRDEEGNLTQSVVKLGYLTIEPPVIDEEGNT
Ga0228660_102057023300024291SeawaterMYITRKYEFVDEAEANKAIDLLRDEEGNLTQSIVKLGYIVKVAGEYDEEGNEVTAPVLSEKYAVDVSWSG
Ga0228631_113686323300024329SeawaterMDITRKYEFVDEAEANEAIDLLRDDEGNLTESVVKLGYLTITPAQYDEEGNT
(restricted) Ga0255048_1001912413300024518SeawaterMITRKYEFVDEAAADVAIDILRDEEGNLTEAVVKLGYLVTTPATYDEEGNELTPAIVS
(restricted) Ga0255048_1004644713300024518SeawaterMITRKYEFVDEAAADAAIDILRDEEGNLTEAVVKLGYLVTTPATYDEEGNELTPAIVS
(restricted) Ga0255048_1005856933300024518SeawaterMITRKYEFVDEAAADVAIDILRDEEGNLTEAVVKL
(restricted) Ga0255048_1032343423300024518SeawaterMKLTRKYEFTNEAAADVAIDILRDEEGNLTEAVVKLGYLVTTPATYDEEGNE
(restricted) Ga0255047_1003896343300024520SeawaterMIRKYEFIDEAAADAAIDLLRDEEGNLTQSVVKLGYL
(restricted) Ga0255047_1004762213300024520SeawaterMITRKYEFVDEAAADAAIDILRDEEGNLTEAVVKLGYLVTTPATYDEE
(restricted) Ga0255047_1006296623300024520SeawaterMITRKYEFVDEAAADVAIDILRDEEGNLTEAVVKLGYLVTTPATYDEE
(restricted) Ga0255047_1010911333300024520SeawaterMIRKYEFVDEAAADAAIDLLRDEEGNITQSVVKLGYLVTTPATYDEE
Ga0208148_111563723300025508AqueousMDITRKYEFVDEAEANAAIDLLRNEEGDLTQSVVKL
Ga0208303_103809333300025543AqueousMITRKYEYVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELT
Ga0208303_104094413300025543AqueousMTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLG
Ga0208303_108933323300025543AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYDEEGNELT
Ga0209304_110539313300025577Pelagic MarineMITRKYEFLDEAAADTAIDLLRDEEGNLTEAVVKLGYLTTTP
Ga0208004_102549823300025630AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKL
Ga0208160_106857513300025647AqueousMITRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTKTPATYDEEGN
Ga0208134_109084713300025652AqueousMTRLTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPAT
Ga0208898_109033013300025671AqueousMDITRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGYLTTTPAQ
Ga0208898_110643613300025671AqueousMTLLTRKYEFVDEAEANASIDLLRDEEGNLTQSVVK
Ga0208162_113107113300025674AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFI
Ga0208162_113828723300025674AqueousMRITRKYEFVDEAEANEAIDLLRNEEGNLTQSVVKLGYLTTTPAQ
Ga0208150_108184113300025751AqueousMDITRKYEFVDEAEANASIDLLRDEEGNLTESVVKLGYLTTTPAQYD
Ga0208899_104119413300025759AqueousMKLTRKYEFVDEAEANKAIDLLRDEEGNLTQSVVKLGYLTIEP
Ga0208899_105832523300025759AqueousMKLTRKYEFVDEAEANKAIDLLRDEEGNLTQSVVKLGYLTIEPPVI
Ga0208899_109070923300025759AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVV
Ga0208899_115951223300025759AqueousMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLG
Ga0208767_119677213300025769AqueousMITRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKL
Ga0208427_100646043300025771AqueousMKLTRKYEFVDEAKADASIDLLRNEEGNLTESVVKLGYLTIEPP
Ga0208427_104236623300025771AqueousMDITRKYEFVDEAEANASIDLLRNEEGNLTESVVK
Ga0208427_119443713300025771AqueousMTLLTRKYEFVDEAAADAAIDLLRDEEGNLTQSVV
Ga0208545_103433413300025806AqueousMDVTRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGYLTIE
Ga0208785_107531633300025815AqueousMTLLTRKYEFIDEAEANEAIDLLRDEEGNLTQSVVKL
Ga0208542_113633723300025818AqueousMKLTRKYEFVDEAEANKAIDLLRDEEGNLTQDVVK
Ga0208542_118438213300025818AqueousMDITRKYEFVDEAEANAAIDLLRDEEGNLTQSVVKLGYLTTTP
Ga0208547_105476013300025828AqueousMKIIRKYEFVDEAAANTAIDLLRDKEGNLTQSVVKLGFIVKTAGEYDEDGNE
Ga0208917_119621123300025840AqueousMKLTRKYEFVDEAEANAAIDLLRNEEGNLTQSVVKL
Ga0208645_105787713300025853AqueousMTLLTRKYEFVDEAEANASIDLLRDEEGNLTQSVV
Ga0208644_112021943300025889AqueousMTRKYEFVDEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPATYD
Ga0208644_125974013300025889AqueousMTRKTRKYEFTNEAAADAAIDLLRDEEGNLTEAVVKLGYLTTTPA
Ga0208644_138706713300025889AqueousMDITRKYEFVDEAEANEAIDLLRDEEGNLTQSVVK
Ga0247605_106773713300026503SeawaterMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEEGNEVT
Ga0247582_120024423300028109SeawaterMDITRKYEFVDEAEADASIDLLRDEEGNLTQSVVKLGYLTITTAQYDEEGNTIK
Ga0233401_103703413300028127SeawaterMDITRKYEFVDEAEANEAIDLLRDDEGNLTESVVKLGYL
Ga0228642_109557023300028131SeawaterMDITRKYEFVYEAEADASIDLLRDEEGNLTQSVVKLGYLTITPAQ
Ga0135226_102262923300029308Marine HarborMIRKYEFIDEAAADAAIDILRDEEGNLTENVVKLGYLVTTPATYDEEGNELTSAIVSE
Ga0316201_1121183213300032136Worm BurrowMITRKYEFVDEAEANAAIDLLRDEEGNLTESVVKLGYLTITPPQY
Ga0316202_1052796723300032277Microbial MatMDITRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGYLTT
Ga0316204_1057191713300032373Microbial MatMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKKAGTYDEEGNEVTAPALS
Ga0316204_1127710913300032373Microbial MatMKIIRKYEFVDEAAANTAIDLLRDEEGNLTQSVVKLGFIVKTAGTY
Ga0348335_020967_3_1703300034374AqueousMKVTRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEEGNEVTAP
Ga0348335_066454_2_1093300034374AqueousMTLLTRKYEFVDEAEANASIDLLRNEEGNLTQSVVK
Ga0348335_135799_572_6973300034374AqueousMDVTRKYEFVDEAKADASIDLLRNEEGNLTESVVKLGYLTIE
Ga0348336_099950_876_9863300034375AqueousMITRKYEFVDEAAVNESIDLLRDNEGNLTQSVVKLGY
Ga0348336_120633_3_1283300034375AqueousMTLLTRKYEFVDEAEANASIDLLRDEEGNLTQSVVKLGYQTI
Ga0348336_123992_674_8203300034375AqueousMTRLTRKYEFVDEAAANKAIDLLRDEEGNLTQSVVKLGYLTITPAVIDE
Ga0348336_144027_2_1123300034375AqueousMDITRKYEFVDEAEANEAIDLLRDEEGNLTQSVVKLG
Ga0348336_188096_381_5663300034375AqueousMKIIRKYEFVDEAAANAAIDLLRDEEGNLTQSVVKLGFIVKTAGTYDEEGNEVTAPVLSEKY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.