Metagenome / Metatranscriptome Family F037279

Basic Information
Family ID	F037279
Family Type	Metagenome / Metatranscriptome
Number of Sequences	168
Average Sequence Length	39 residues
Representative Sequence	VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDDEALEDLK
Number of Associated Samples	116
Number of Associated Scaffolds	168

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	95.09 %
% of genes near scaffold ends (potentially truncated)	89.29 %
% of genes from short scaffolds (< 2000 bps)	91.07 %
Associated GOLD sequencing projects	106
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Bacteria (70.238 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (22.024 % of family members)
Environment Ontology (ENVO)	Unclassified (26.190 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.619 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 168 Family Scaffolds
PF02518	HATPase_c	2.38
PF02775	TPP_enzyme_C	1.79
PF01425	Amidase	1.79
PF04392	ABC_sub_bind	1.19
PF05016	ParE_toxin	1.19
PF00211	Guanylate_cyc	1.19
PF01850	PIN	1.19
PF00296	Bac_luciferase	1.19
PF11716	MDMPI_N	1.19
PF03972	MmgE_PrpD	1.19
PF08530	PepX_C	1.19
PF01408	GFO_IDH_MocA	0.60
PF13551	HTH_29	0.60
PF00239	Resolvase	0.60
PF12773	DZR	0.60
PF03869	Arc	0.60
PF08883	DOPA_dioxygen	0.60
PF14269	Arylsulfotran_2	0.60
PF01526	DDE_Tnp_Tn3	0.60
PF13424	TPR_12	0.60
PF01610	DDE_Tnp_ISL3	0.60
PF13649	Methyltransf_25	0.60
PF10728	DUF2520	0.60
PF08241	Methyltransf_11	0.60
PF12974	Phosphonate-bd	0.60
PF07690	MFS_1	0.60
PF03400	DDE_Tnp_IS1	0.60
PF13378	MR_MLE_C	0.60
PF05685	Uma2	0.60
PF10294	Methyltransf_16	0.60
PF03061	4HBT	0.60
PF13191	AAA_16	0.60
PF13561	adh_short_C2	0.60
PF13359	DDE_Tnp_4	0.60
PF00078	RVT_1	0.60
PF04879	Molybdop_Fe4S4	0.60
PF00383	dCMP_cyt_deam_1	0.60
PF13586	DDE_Tnp_1_2	0.60
PF03649	UPF0014	0.60
PF02036	SCP2	0.60
PF13565	HTH_32	0.60
PF01494	FAD_binding_3	0.60
PF02371	Transposase_20	0.60
PF09962	DUF2196	0.60
PF01717	Meth_synt_2	0.60
PF03476	MOSC_N	0.60
PF00589	Phage_integrase	0.60

COG ID	Name	Functional Category	% Frequency in 168 Family Scaffolds
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	1.79
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.19
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	1.19
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	1.19
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	1.19
COG2936	Predicted acyl esterase	General function prediction only [R]	1.19
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.19
COG0390	ABC-type iron transport system FetAB, permease component	Inorganic ion transport and metabolism [P]	0.60
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.60
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.60
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.60
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.60
COG1662	Transposase and inactivated derivatives, IS1 family	Mobilome: prophages, transposons [X]	0.60
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.60
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.60
COG3217	N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain	Defense mechanisms [V]	0.60
COG3464	Transposase	Mobilome: prophages, transposons [X]	0.60
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.60
COG3805	Aromatic ring-cleaving dioxygenase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.60
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	0.60
COG4644	Transposase and inactivated derivatives, TnpA family	Mobilome: prophages, transposons [X]	0.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.43 %
Unclassified	root	N/A	28.57 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	71.43 %
Unclassified	root	N/A	28.57 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.24 %
Unclassified	root	N/A	28.57 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.60 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	10.71 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	7.14 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	5.95 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	5.36 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.19 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.60 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.60 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	0.60 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.60 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	5.95 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.38 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.79 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.19 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1.19 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.19 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %
Armatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes	0.60 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.60 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.60 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	5.95 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	2.38 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.79 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.19 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	0.60 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.60 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	0.60 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.60 %
unclassified Armatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes	0.60 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.60 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.60 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	1.79 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.79 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	1.19 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1.19 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	0.60 %
Parcubacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group	0.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.60 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.60 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.60 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.60 %
Alphaproteobacteria bacterium MarineAlpha4_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2	0.60 %
Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	0.60 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	0.60 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.60 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	0.60 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	1.79 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.79 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1.19 %
Candidatus Nealsonbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nealsonbacteria	0.60 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.60 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.60 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.60 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.60 %
Oscillatoriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales	0.60 %
unclassified Planctomycetales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales	0.60 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.60 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	0.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.60 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.60 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.60 %
Alphaproteobacteria bacterium MarineAlpha4_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2	0.60 %
Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	1.79 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.79 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1.19 %
Planctomycetales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	0.60 %
Oscillatoriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae	0.60 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.60 %
Candidatus Nealsonbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nealsonbacteria	0.60 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.60 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.60 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.60 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.60 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	0.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.60 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.60 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.60 %
Alphaproteobacteria bacterium MarineAlpha4_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2	0.60 %
Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	1.79 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.79 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1.19 %
Moorena	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena	0.60 %
Planctomycetales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	0.60 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.60 %
Candidatus Nealsonbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nealsonbacteria	0.60 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.60 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.60 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.60 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.60 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	0.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.60 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.60 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.60 %
Alphaproteobacteria bacterium MarineAlpha4_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2	0.60 %
Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	10.71 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	1.79 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.79 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1.19 %
Moorena bouillonii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena → Moorena bouillonii	0.60 %
Planctomycetales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	0.60 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.60 %
Candidatus Nealsonbacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nealsonbacteria	0.60 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.60 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	0.60 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	0.60 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.60 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	0.60 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.60 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.60 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.60 %
Alphaproteobacteria bacterium MarineAlpha4_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2	0.60 %
Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
archaeon 13_1_20CM_2_51_12	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000033\|ICChiseqgaiiDRAFT_c0337908	Not Available	647	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_10493413	Not Available	647	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101994664	Not Available	547	Open in IMG/M
3300000550\|F24TB_10825672	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300000955\|JGI1027J12803_101982780	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300001431\|F14TB_102335280	Not Available	583	Open in IMG/M
3300005332\|Ga0066388_101051352	All Organisms → cellular organisms → Bacteria	1371	Open in IMG/M
3300005332\|Ga0066388_102167894	All Organisms → cellular organisms → Bacteria	1002	Open in IMG/M
3300005471\|Ga0070698_101779012	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	569	Open in IMG/M
3300005552\|Ga0066701_10677636	Not Available	621	Open in IMG/M
3300005554\|Ga0066661_10909407	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300005558\|Ga0066698_11054607	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300005713\|Ga0066905_101203423	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300005713\|Ga0066905_101580351	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300005719\|Ga0068861_100393576	All Organisms → cellular organisms → Bacteria	1228	Open in IMG/M
3300005764\|Ga0066903_100164558	All Organisms → cellular organisms → Bacteria	3226	Open in IMG/M
3300005764\|Ga0066903_104026181	All Organisms → cellular organisms → Bacteria	788	Open in IMG/M
3300005937\|Ga0081455_10546572	Not Available	767	Open in IMG/M
3300006049\|Ga0075417_10258043	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300006196\|Ga0075422_10265446	Not Available	726	Open in IMG/M
3300006844\|Ga0075428_100036254	All Organisms → cellular organisms → Bacteria	5433	Open in IMG/M
3300006844\|Ga0075428_101040934	All Organisms → cellular organisms → Bacteria	866	Open in IMG/M
3300006844\|Ga0075428_101165004	All Organisms → cellular organisms → Bacteria	813	Open in IMG/M
3300006844\|Ga0075428_102578711	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	520	Open in IMG/M
3300006845\|Ga0075421_100738918	All Organisms → cellular organisms → Bacteria	1139	Open in IMG/M
3300006846\|Ga0075430_100573159	All Organisms → cellular organisms → Bacteria	931	Open in IMG/M
3300006846\|Ga0075430_101293366	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300006846\|Ga0075430_101619600	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300006846\|Ga0075430_101670873	Not Available	523	Open in IMG/M
3300006847\|Ga0075431_101106434	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300006853\|Ga0075420_101114164	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300006871\|Ga0075434_100395050	All Organisms → cellular organisms → Bacteria	1404	Open in IMG/M
3300006880\|Ga0075429_100139893	All Organisms → cellular organisms → Bacteria	2119	Open in IMG/M
3300006880\|Ga0075429_100843036	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300006880\|Ga0075429_100986137	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300006880\|Ga0075429_101156078	Not Available	676	Open in IMG/M
3300006904\|Ga0075424_100553339	All Organisms → cellular organisms → Bacteria	1229	Open in IMG/M
3300007255\|Ga0099791_10647298	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	518	Open in IMG/M
3300007258\|Ga0099793_10651408	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	530	Open in IMG/M
3300009012\|Ga0066710_104112112	Not Available	544	Open in IMG/M
3300009038\|Ga0099829_11399966	All Organisms → cellular organisms → Bacteria	578	Open in IMG/M
3300009089\|Ga0099828_11189791	Not Available	676	Open in IMG/M
3300009090\|Ga0099827_11874167	Not Available	523	Open in IMG/M
3300009094\|Ga0111539_10028431	All Organisms → cellular organisms → Bacteria → Proteobacteria	6820	Open in IMG/M
3300009094\|Ga0111539_10061897	All Organisms → cellular organisms → Bacteria	4433	Open in IMG/M
3300009094\|Ga0111539_11460179	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	793	Open in IMG/M
3300009094\|Ga0111539_11591349	Not Available	758	Open in IMG/M
3300009100\|Ga0075418_10159734	All Organisms → cellular organisms → Bacteria	2399	Open in IMG/M
3300009100\|Ga0075418_11488504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	735	Open in IMG/M
3300009100\|Ga0075418_13160199	Not Available	501	Open in IMG/M
3300009143\|Ga0099792_10614586	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300009147\|Ga0114129_10036905	All Organisms → cellular organisms → Bacteria	6899	Open in IMG/M
3300009147\|Ga0114129_11151960	All Organisms → cellular organisms → Bacteria → Terrabacteria group	968	Open in IMG/M
3300009147\|Ga0114129_11402722	All Organisms → cellular organisms → Bacteria	862	Open in IMG/M
3300009147\|Ga0114129_11656112	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300009147\|Ga0114129_13422006	Not Available	510	Open in IMG/M
3300009156\|Ga0111538_10154365	Not Available	2916	Open in IMG/M
3300009173\|Ga0114996_10746797	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300009444\|Ga0114945_10478327	Not Available	748	Open in IMG/M
3300009553\|Ga0105249_11748235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	694	Open in IMG/M
3300009610\|Ga0105340_1305480	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300010041\|Ga0126312_10069464	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_20CM_2_51_12	2373	Open in IMG/M
3300010043\|Ga0126380_10310153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13	1128	Open in IMG/M
3300010043\|Ga0126380_10661867	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	833	Open in IMG/M
3300010043\|Ga0126380_10851004	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300010043\|Ga0126380_11916899	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	539	Open in IMG/M
3300010046\|Ga0126384_10544881	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300010047\|Ga0126382_10442468	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	1028	Open in IMG/M
3300010145\|Ga0126321_1068325	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1370	Open in IMG/M
3300010360\|Ga0126372_12552075	Not Available	562	Open in IMG/M
3300010360\|Ga0126372_12752101	Not Available	544	Open in IMG/M
3300010362\|Ga0126377_10183091	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1995	Open in IMG/M
3300010362\|Ga0126377_10968093	Not Available	916	Open in IMG/M
3300010362\|Ga0126377_12518381	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	590	Open in IMG/M
3300010362\|Ga0126377_13541072	Not Available	505	Open in IMG/M
3300010366\|Ga0126379_11699985	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	736	Open in IMG/M
3300010366\|Ga0126379_12358254	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nealsonbacteria	632	Open in IMG/M
3300010398\|Ga0126383_10243412	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Moorena → Moorena bouillonii	1759	Open in IMG/M
3300010398\|Ga0126383_11926033	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	679	Open in IMG/M
3300010398\|Ga0126383_12957872	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300010398\|Ga0126383_13632028	Not Available	504	Open in IMG/M
3300011270\|Ga0137391_10568774	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300012022\|Ga0120191_10122954	Not Available	564	Open in IMG/M
3300012199\|Ga0137383_10426054	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	972	Open in IMG/M
3300012206\|Ga0137380_10339974	All Organisms → cellular organisms → Bacteria → Proteobacteria	1340	Open in IMG/M
3300012206\|Ga0137380_10609840	All Organisms → cellular organisms → Bacteria	954	Open in IMG/M
3300012209\|Ga0137379_10441417	All Organisms → cellular organisms → Bacteria	1210	Open in IMG/M
3300012349\|Ga0137387_10493184	All Organisms → cellular organisms → Bacteria	889	Open in IMG/M
3300012359\|Ga0137385_10641716	All Organisms → cellular organisms → Bacteria	890	Open in IMG/M
3300012359\|Ga0137385_10827823	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	768	Open in IMG/M
3300012360\|Ga0137375_10796126	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	761	Open in IMG/M
3300012362\|Ga0137361_11387566	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	626	Open in IMG/M
3300012362\|Ga0137361_11943064	Not Available	505	Open in IMG/M
3300012363\|Ga0137390_10207062	Not Available	1949	Open in IMG/M
3300012363\|Ga0137390_10557000	Not Available	1117	Open in IMG/M
3300012685\|Ga0137397_10825924	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	687	Open in IMG/M
3300012923\|Ga0137359_11566660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	547	Open in IMG/M
3300012927\|Ga0137416_11379307	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	638	Open in IMG/M
3300012929\|Ga0137404_10182226	All Organisms → cellular organisms → Bacteria	1768	Open in IMG/M
3300012929\|Ga0137404_10597873	All Organisms → cellular organisms → Bacteria → Terrabacteria group	992	Open in IMG/M
3300012930\|Ga0137407_10234230	All Organisms → cellular organisms → Bacteria	1659	Open in IMG/M
3300012948\|Ga0126375_10391003	Not Available	1002	Open in IMG/M
3300012948\|Ga0126375_10491977	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300012948\|Ga0126375_11329473	Not Available	605	Open in IMG/M
3300012948\|Ga0126375_11808264	Not Available	533	Open in IMG/M
3300012971\|Ga0126369_10875290	All Organisms → cellular organisms → Bacteria	983	Open in IMG/M
3300012971\|Ga0126369_11295969	Not Available	818	Open in IMG/M
3300012971\|Ga0126369_12198798	Not Available	639	Open in IMG/M
3300013306\|Ga0163162_11131681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	887	Open in IMG/M
3300013306\|Ga0163162_13437798	Not Available	505	Open in IMG/M
3300015371\|Ga0132258_13670402	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	1048	Open in IMG/M
3300015372\|Ga0132256_102092764	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	671	Open in IMG/M
3300016270\|Ga0182036_11057398	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	671	Open in IMG/M
3300016270\|Ga0182036_11631849	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300016371\|Ga0182034_10419685	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20	1101	Open in IMG/M
3300016371\|Ga0182034_12088068	Not Available	500	Open in IMG/M
3300016445\|Ga0182038_11591535	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300016445\|Ga0182038_11691909	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	570	Open in IMG/M
3300018078\|Ga0184612_10445505	Not Available	645	Open in IMG/M
3300018079\|Ga0184627_10021842	All Organisms → cellular organisms → Bacteria	3153	Open in IMG/M
3300018433\|Ga0066667_11359492	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	622	Open in IMG/M
3300018468\|Ga0066662_11626530	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	674	Open in IMG/M
3300022563\|Ga0212128_10158109	All Organisms → cellular organisms → Bacteria	1457	Open in IMG/M
3300025157\|Ga0209399_10117877	All Organisms → cellular organisms → Bacteria	1075	Open in IMG/M
3300025910\|Ga0207684_10293070	All Organisms → cellular organisms → Bacteria → Proteobacteria	1403	Open in IMG/M
3300025910\|Ga0207684_11359751	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300025961\|Ga0207712_10310673	Not Available	1297	Open in IMG/M
3300026116\|Ga0207674_11049667	Not Available	784	Open in IMG/M
3300026310\|Ga0209239_1353988	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	514	Open in IMG/M
3300026358\|Ga0257166_1056019	Not Available	565	Open in IMG/M
3300026497\|Ga0257164_1058122	Not Available	629	Open in IMG/M
3300027748\|Ga0209689_1215346	Not Available	827	Open in IMG/M
3300027846\|Ga0209180_10631240	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	589	Open in IMG/M
3300027873\|Ga0209814_10574310	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300027874\|Ga0209465_10285217	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300027880\|Ga0209481_10343794	All Organisms → cellular organisms → Bacteria	760	Open in IMG/M
3300027882\|Ga0209590_10526167	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	763	Open in IMG/M
3300027882\|Ga0209590_10682555	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300027882\|Ga0209590_10749090	Not Available	623	Open in IMG/M
3300027907\|Ga0207428_10482721	All Organisms → cellular organisms → Bacteria	901	Open in IMG/M
3300027909\|Ga0209382_10627411	All Organisms → cellular organisms → Bacteria	1167	Open in IMG/M
3300030006\|Ga0299907_10964755	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300031740\|Ga0307468_101895409	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	568	Open in IMG/M
3300031820\|Ga0307473_10509660	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	814	Open in IMG/M
3300031908\|Ga0310900_11482615	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	572	Open in IMG/M
3300031942\|Ga0310916_10655389	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	890	Open in IMG/M
3300031942\|Ga0310916_11416265	Not Available	569	Open in IMG/M
3300031944\|Ga0310884_10378480	All Organisms → cellular organisms → Bacteria → Proteobacteria	809	Open in IMG/M
3300031954\|Ga0306926_11428430	All Organisms → cellular organisms → Bacteria	802	Open in IMG/M
3300032017\|Ga0310899_10726322	Not Available	506	Open in IMG/M
3300032025\|Ga0318507_10493772	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	533	Open in IMG/M
3300032055\|Ga0318575_10309842	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300032075\|Ga0310890_10939049	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300032091\|Ga0318577_10349343	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	707	Open in IMG/M
3300032122\|Ga0310895_10784159	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	501	Open in IMG/M
3300032126\|Ga0307415_101136007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin2	733	Open in IMG/M
3300033551\|Ga0247830_10173685	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	1592	Open in IMG/M
3300033551\|Ga0247830_10292277	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	1246	Open in IMG/M
3300033813\|Ga0364928_0017534	All Organisms → cellular organisms → Bacteria → Proteobacteria	1403	Open in IMG/M
3300034667\|Ga0314792_193581	All Organisms → cellular organisms → Bacteria → Proteobacteria	567	Open in IMG/M
3300034672\|Ga0314797_126971	Not Available	547	Open in IMG/M
3300034678\|Ga0314803_144198	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300034681\|Ga0370546_077321	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	553	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	70.24%
Host-Associated	Host-Associated	29.76%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	65.48%
Plants	Host-Associated → Plants	29.76%
Aquatic	Environmental → Aquatic	4.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	64.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.19%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.57%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.79%
Sediment	Environmental → Aquatic → Sediment	1.79%
Freshwater	Environmental → Aquatic → Freshwater	0.60%
Marine	Environmental → Aquatic → Marine	0.60%
Floodplain	Environmental → Terrestrial → Floodplain	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	57.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	25.00%
Loam	Environmental → Terrestrial → Soil → Loam	7.14%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.98%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.79%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.19%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.60%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.60%
Sand	Environmental → Terrestrial → Soil → Sand	0.60%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	25.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	9.52%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.14%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.95%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.98%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.79%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.79%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.19%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	0.60%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.60%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	22.02%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	17.26%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	14.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.17%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.38%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	1.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.79%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.19%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.19%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.19%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.19%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.60%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	0.60%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.60%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.60%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.60%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.60%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.60%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009173	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134	Environmental	Open in IMG/M
3300009444	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010145	Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300022563	OV2_combined assembly	Environmental	Open in IMG/M
3300025157	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental	Open in IMG/M
3300026497	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027949	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes)	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032025	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20	Environmental	Open in IMG/M
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300033813	Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17	Environmental	Open in IMG/M
3300034667	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034672	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034678	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034681	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F037279

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_03379081	3300000033	Soil	MDFVTVVDQAIALXRQRGRLTYRTLQLQFQLDEVSLEALKDELV
ICChiseqgaiiFebDRAFT_104934131	3300000363	Soil	MDFVTVVDQAIALXRQRGRLTYRTLQLQFQLDEVSLEALKDELVY
INPhiseqgaiiFebDRAFT_1019946642	3300000364	Soil	MDFVAVLDEVIALLRQRGRVAYRTLKVQFHLDAAALEALW*
F24TB_108256722	3300000550	Soil	VDFVAVLDQVIALLHQRGRLTYRTLKRQFELDDAALEDLK
JGI1027J12803_1019827802	3300000955	Soil	VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDDEALD
F14TB_1023352801	3300001431	Soil	MDFVALVDQVFALLRQRGRVTYRTLQRQFQLDADA
Ga0066388_1010513523	3300005332	Tropical Forest Soil	VDFVAVMDQVIVLLRQRGRLTYRTLQRQFQLDDAALDDLK
Ga0066388_1021678943	3300005332	Tropical Forest Soil	MDFVAVLDQVIALLRQRGRLTYSTLKRQFQLDDAALEDVK
Ga0070698_1017790121	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	VDFVAVLDQVIALLRQRGRLTYRTLQRQFQLDDAALDDLKDE
Ga0066701_106776361	3300005552	Soil	MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDA
Ga0066661_109094071	3300005554	Soil	VDFVAVVDQALALLRQRGRVTYRTLQIQFALDDPQ
Ga0066698_110546072	3300005558	Soil	VDFVAVVDQAIALLRQRGCLTYRTLQLQFQLDDAHL
Ga0066905_1012034232	3300005713	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALEDV
Ga0066905_1015803511	3300005713	Tropical Forest Soil	MDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDAHL
Ga0068861_1003935761	3300005719	Switchgrass Rhizosphere	MDFVAVVDQVITLLRQRGRVTYRTLQRQFQLDEEALADLLAELR
Ga0066903_1001645583	3300005764	Tropical Forest Soil	MDFVAVVDQVIALLRQRGRLTYRTLQRQFQLDEAALDDLKDELMYG
Ga0066903_1040261812	3300005764	Tropical Forest Soil	VDFIAVLDQAIALLRQRGRLTYSTLKRQFQLDDAALE
Ga0081455_105465721	3300005937	Tabebuia Heterophylla Rhizosphere	MDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDAEHLEALK
Ga0075417_102580432	3300006049	Populus Rhizosphere	VDFVTVVDQVSALLRQRGRVAYRTLKRQFQLDDEA
Ga0075422_102654461	3300006196	Populus Rhizosphere	MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDAHL
Ga0075428_1000362546	3300006844	Populus Rhizosphere	VNFVAVVDQVITLLRQRGRVAYRTLKRQFQLDDEAI
Ga0075428_1010409341	3300006844	Populus Rhizosphere	VDIVAVLDQAIALLRQRGRLTYRTLQRQFHLDDAALDDLKDELI
Ga0075428_1011650041	3300006844	Populus Rhizosphere	VDFVALVDQVTALLRQRGRVTYRTLQRQFQLDADALSDLLG
Ga0075428_1025787111	3300006844	Populus Rhizosphere	MDFVSIVDQVITLLRQRGRMTYRTLQRQFQLDDDALHDLTEEL
Ga0075421_1007389183	3300006845	Populus Rhizosphere	VDFVAVMDQVIALLRQRGRLTYRTLQRQFQLDAAAL
Ga0075430_1005731591	3300006846	Populus Rhizosphere	VDFVAVVDQVIVLLRQRGRIAYRTLKVQFSLDDNALEALKDELL
Ga0075430_1012933661	3300006846	Populus Rhizosphere	VDFVAVVDQALALLRQRGCVTYRTLQRQFQLDAEALADLLAELRYAY
Ga0075430_1016196002	3300006846	Populus Rhizosphere	VDFVAVVDQAMTLLRQRGRLTYGTLKRQFQLDDAAL
Ga0075430_1016708731	3300006846	Populus Rhizosphere	VAVVDQAIALLRQRGRLTYRTLQLQFQLDTEHLEALKTVRDACP*
Ga0075431_1011064341	3300006847	Populus Rhizosphere	VDFVALVDQVITLLRQRGRVTYRTLQRQFQLDAEA
Ga0075420_1011141641	3300006853	Populus Rhizosphere	VDFVAVVDQAITLLRQRGRLTYRTLQLQFQLDDAHLEALK
Ga0075420_1017499611	3300006853	Populus Rhizosphere	MDFDAILDQAIALLQRRGRLTYRTLKVQFALTEEQLDALREEL
Ga0075434_1003950501	3300006871	Populus Rhizosphere	VDFVTVVDQVIVLLRQRGRVTYRLLKRQFQLDDEA
Ga0075429_1001398931	3300006880	Populus Rhizosphere	VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDDAA
Ga0075429_1008430361	3300006880	Populus Rhizosphere	VDFVAVMDQVITLLRQRGRLTYRTLQRQFQLDDAAL
Ga0075429_1009861371	3300006880	Populus Rhizosphere	VDFVAVVDQVMALLRQRGRVAYRTLKRQFQLDDEA
Ga0075429_1011560782	3300006880	Populus Rhizosphere	VEFVGVVDQVIALLRQRGRVAYRTLKRQFQLDDEA
Ga0075424_1005533394	3300006904	Populus Rhizosphere	MDFVAVVDQVIALLCQRGRVAYRTLKRQFQLDDEALE
Ga0099791_106472981	3300007255	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRVTYRTLQLQFTLDDAQLAALK
Ga0099793_106514081	3300007258	Vadose Zone Soil	VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDAEHL
Ga0066710_1041121121	3300009012	Grasslands Soil	VDFVAVVDQVIALLRQRGRMTYRTLQRQFQLDDDA
Ga0099829_113999661	3300009038	Vadose Zone Soil	MDFVAVVDQVIALLRQRGRVTYRTLQRQFQLDENA
Ga0099828_111897912	3300009089	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRLTYRTLQLQFALDDEQLAVL
Ga0099827_118741671	3300009090	Vadose Zone Soil	VDFVAIVDQVIALVRQRGRVTYRTLQLQFTLDDEQL
Ga0111539_100284317	3300009094	Populus Rhizosphere	VDFVAVVDQVIALLRQRGRVTYRTLQLQFQLDDAHLEVLKDK
Ga0111539_100618971	3300009094	Populus Rhizosphere	VDFVAMVDQAIALLRQRGRVTYRTLQLQFTLDDAQLAALKDE
Ga0111539_114601793	3300009094	Populus Rhizosphere	VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDTHLEALRD
Ga0111539_115913493	3300009094	Populus Rhizosphere	VDFVAIVDQAIALLRQRGRLTYRTLQVQFQLDDAHLE
Ga0075418_101597341	3300009100	Populus Rhizosphere	VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDEAAL
Ga0075418_114885042	3300009100	Populus Rhizosphere	VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDDEAIE
Ga0075418_131601991	3300009100	Populus Rhizosphere	MDFVAVVDQVIVLLRQRGRVTYSTLKRQFQLDEAAL
Ga0099792_106145862	3300009143	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRLTYRTLQLQFALDDEQLAVLKDELLYS
Ga0114129_100369055	3300009147	Populus Rhizosphere	VDFVAVVDQAIALLRQRGRVAYRTLKRHFQLDDEALE
Ga0114129_111519602	3300009147	Populus Rhizosphere	VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDAHLEALK
Ga0114129_114027221	3300009147	Populus Rhizosphere	VDFVAVVDQVITLLRQRGRVAYRTLKRQFQLDDEALED
Ga0114129_116561121	3300009147	Populus Rhizosphere	MDFVAVLDQVSTLLRQRGRVAYRTLKVQFHLDDDA
Ga0114129_134220061	3300009147	Populus Rhizosphere	VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDAEHLEALKD
Ga0111538_101543651	3300009156	Populus Rhizosphere	VDFVTVVDQAIALLRQRGRLTYRTLQRQFHLDDAAL
Ga0114996_107467972	3300009173	Marine	MDFVAVIEQAKALLQSKGRLTYRTLQRQFALDDEALEDLKDELLFSD
Ga0114945_104783272	3300009444	Thermal Springs	VDFVAVVDQVIALLRQRGRVTYRTLQFQFTLDDEQLAVLKLANRASSRW*
Ga0105249_117482351	3300009553	Switchgrass Rhizosphere	VTFDEVLNQAIELLKKRGRLTYRTVKRQFHLDEAALEDL
Ga0105340_13054801	3300009610	Soil	MQGGDRVDFVAVVDQVIVLLRQRGRVTYRTLKRQFQLDDPA
Ga0126312_100694644	3300010041	Serpentine Soil	MDFVAVVDQVITLLRQQGRVTYCTLQRQFQLDDDALH
Ga0126380_103101532	3300010043	Tropical Forest Soil	MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDAHLEAL
Ga0126380_106618671	3300010043	Tropical Forest Soil	VDCVAVVDQVIALLRQRARLTYCTLQLQFQPDEAHLEAL
Ga0126380_108510041	3300010043	Tropical Forest Soil	VDFVAVLDQVIALLRQRGRITYRTLQRQSQLDEVALEDLK
Ga0126380_119168991	3300010043	Tropical Forest Soil	MAEAIAMLQRRGRVTYQTLRLQFQLDEEHLEALKDAIL
Ga0126384_105448811	3300010046	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDDEAI
Ga0126382_104424681	3300010047	Tropical Forest Soil	VDFVAVVDQAITLLRQRGRLTYRTLQLQYQLDDAHL
Ga0126321_10683253	3300010145	Soil	MDFVAVLDQVIALLQQRGRLTYSTLKRQFQLDDAALEDVKN*
Ga0126372_125520752	3300010360	Tropical Forest Soil	VDFVAVLEQVIALLRQRGRMTYSTLKRQFQLDDTALDDL
Ga0126372_127521012	3300010360	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALEDVKNELI
Ga0126377_101830914	3300010362	Tropical Forest Soil	VDFVAVVDQAIALLRQRGRLTYRTLQLQLQLDDAHLAALKDEL
Ga0126377_109680931	3300010362	Tropical Forest Soil	VDFVAVLDQVIALLRQRGRLTYRTLQVQFHLDEAHLEILKE
Ga0126377_125183811	3300010362	Tropical Forest Soil	MDFVAVLDQVIALLCQRGRLTYRTLQRQFQLDEATLDDLKD
Ga0126377_135410721	3300010362	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAAL
Ga0126379_116999851	3300010366	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVTYRTLQLQFTLDDAQLAALKDE
Ga0126379_123582541	3300010366	Tropical Forest Soil	VDFVAVLDQVIALLRQRGRLTYRTLRRQFQLDDTALEDLTVELIK
Ga0126383_102434123	3300010398	Tropical Forest Soil	VDFVAVVDQSIALLRQRGRLTYRTLQLQFQLDAEHLEALKD
Ga0126383_119260331	3300010398	Tropical Forest Soil	MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDALHDLT
Ga0126383_129578721	3300010398	Tropical Forest Soil	VDFVAVVDQAIALLRQRGRLTYGTLKRQFQLDDAVLDDLKD
Ga0126383_136320281	3300010398	Tropical Forest Soil	VDFVAVVDQVIVLLRQRGRLTYRTLPLQFQLDQAHLEALKAE
Ga0137391_105687741	3300011270	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRVTYRTLKRQFQLDDDVLEDLK
Ga0120191_101229542	3300012022	Terrestrial	VDFVALVDQVIALLRQRGRVTYRTLQRQFQLDADALTDLLGE
Ga0137383_104260541	3300012199	Vadose Zone Soil	MDFVAVVDQVLTLLRQRGRVTYRTLQIQFALDDTQ
Ga0137380_103399742	3300012206	Vadose Zone Soil	MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDAEHLEALVAYL*
Ga0137380_106098402	3300012206	Vadose Zone Soil	MDFVAVVDQVLTLLRQRGRVTYRTLQIQFALDDTQFAALKD
Ga0137379_104414173	3300012209	Vadose Zone Soil	MDFVAVVDQVIALLRQRGRVAYRTLKVQFTLDDDAL*
Ga0137387_104931841	3300012349	Vadose Zone Soil	VADFVAVLDQVIALLRQRGRLTYRTLQLQFQLDETQLEVLKDELI
Ga0137385_106417163	3300012359	Vadose Zone Soil	VDFVAVIDQVITLLRQRGRLTYSTLKRQFQLDEAALEDVKNELI
Ga0137385_108278231	3300012359	Vadose Zone Soil	VDFVAVLDQVIVLLRQRGRMTYRALQRQFQLDDDAL
Ga0137375_107961261	3300012360	Vadose Zone Soil	MDFVAVVDQVIALLRQRGRLTYRTLQRQFQLDDAALDDLKDE
Ga0137361_113875663	3300012362	Vadose Zone Soil	VDFVAVVDQAIALLRQRGRVTYRTLQLQFTLDDEQLAALK
Ga0137361_119430642	3300012362	Vadose Zone Soil	MDFVAVVDQVITLLRQRGRLTYRTLQLQFQLDETHLEVLKDELVYG
Ga0137390_102070624	3300012363	Vadose Zone Soil	MDFVAVVDQAIVLLRQRGRLTYRTLQLQFQLDDAHL
Ga0137390_105570002	3300012363	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALEDVKN
Ga0137397_108259242	3300012685	Vadose Zone Soil	VDFVAVLDQVITLLRQRGRVTYRTLKRQFQLDEAALEDLQQREPMAA*
Ga0137359_115666602	3300012923	Vadose Zone Soil	VDFVAVMEQVIALLRQWGRLTYRTLQRQFHLDDDTLT
Ga0137416_113793072	3300012927	Vadose Zone Soil	VDFVAVVDQAIALLRQRGRVTYSTLKRQFQLDDAAL
Ga0137404_101822263	3300012929	Vadose Zone Soil	VDFVAVVDQAIALLRQRGRVTYRTLQLQFQLDEAHLE
Ga0137404_105978732	3300012929	Vadose Zone Soil	MAIVDQVIALLRQRGRLTYRTLQLQFQLDETHLEVIKDELL
Ga0137407_102342301	3300012930	Vadose Zone Soil	MDFVAVVDQVIALLRQRGRVTYRTLQLQFQLDDAQLAALKD
Ga0126375_103910031	3300012948	Tropical Forest Soil	VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDAAHLDA
Ga0126375_104919772	3300012948	Tropical Forest Soil	MDFVAVVDQVITLLHQRGRVAYRTLKRQFQLDNEAIED
Ga0126375_113294731	3300012948	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDEAALED
Ga0126375_118082641	3300012948	Tropical Forest Soil	VDFVTIVDQAIALLRQRGRLTYRTLQVQFQLDDTHLE
Ga0126369_108752902	3300012971	Tropical Forest Soil	MDFVAIVDQVIALLRQRGRVTYRTLKRQFQLDDEALEDLK
Ga0126369_112959691	3300012971	Tropical Forest Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFHLDEAALEDVKN
Ga0126369_121987982	3300012971	Tropical Forest Soil	VDFVAVMEQAIALLRQRGRVTYRTLQIQFTLDDEQLAALK
Ga0157378_125190932	3300013297	Miscanthus Rhizosphere	VDFVTVVDQGLALLRQRGRTTYRTLQRQFPVDRLPRCH
Ga0163162_111316811	3300013306	Switchgrass Rhizosphere	VDFVAVLDQVIALLHQRGRLTYSTLKRQFQLDDATLEDVK
Ga0163162_134377981	3300013306	Switchgrass Rhizosphere	VDFVAVVDQVMTLLRQRGRVTYRLLKRQFQLDDEAL
Ga0132258_136704023	3300015371	Arabidopsis Rhizosphere	VDFVAVVDQAIALLRQRGRLTYRTLQRQFQLDDEALEDLK
Ga0132256_1020927642	3300015372	Arabidopsis Rhizosphere	MDFVAIVDQVLTLLRQRGRVTYRTLQRQFQLDEGALA
Ga0182036_110573982	3300016270	Soil	VDFVAVVDQAITLLRQRGRVTYRTLQRQFQLDDAALDDLKD
Ga0182036_116318491	3300016270	Soil	LDQAIAMLQRRGHLTYRTLQLQFQLDETYLEALKDELI
Ga0182034_104196853	3300016371	Soil	VDFVAILDQVMALLRQRGRVAYRTLKVQFHLDDDALEALK
Ga0182034_120880681	3300016371	Soil	VDFVAVVDQAIAHLRQRGRVTYRTLQLQFTLDNEQLAALKD
Ga0182038_115915351	3300016445	Soil	MDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDGVHLEALKDEL
Ga0182038_116919092	3300016445	Soil	VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDAHLEALKDEL
Ga0184612_104455051	3300018078	Groundwater Sediment	VDFVTVVDQAIALLRQRGRVTYRTLQIQFTLDDAQL
Ga0184627_100218421	3300018079	Groundwater Sediment	VDFVAVVDQVIALLRQRGRVTYHTLQLQFTLDDAQLA
Ga0066667_113594921	3300018433	Grasslands Soil	VDFVAVMEQAIALLRQRGRVTYRTLQIQFTLDDEQLAALKDELL
Ga0066662_116265301	3300018468	Grasslands Soil	MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDEALHDLTDE
Ga0212128_101581093	3300022563	Thermal Springs	VDFVAVVDQVIALLRQRGRVTYRTLQFQFTLDDEQLAALK
Ga0209399_101178773	3300025157	Thermal Springs	VDFVAVVDQVIALLRQRGRVTYRTLQFQFTLDDEQLAVLKLANRASSRW
Ga0207680_111706661	3300025903	Switchgrass Rhizosphere	VDFVTVVDQGLALLRQRGRTTYRTLQRQFPVDRLPRCHMIS
Ga0207684_102930703	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MDFVAVVDQVIALLRQRGRLAYRTLKRQFQLDDEALADL
Ga0207684_113597511	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	VDFVAVVDQAIALLRQRGRLTYRTLQLQLQLDDAHLAALKDE
Ga0207712_103106731	3300025961	Switchgrass Rhizosphere	VDFVAVLDQVIALLRQRGRVTYSTLKRQFQLDEAALEDVK
Ga0207674_110496671	3300026116	Corn Rhizosphere	MDFVAVLDQVIALLRQRGRLTYRTLQLQYQLDDAHLEALKD
Ga0209239_13539881	3300026310	Grasslands Soil	VDFVAVMDQVIALLRQRGRLTYRTLQRQFQLDDAALEDLT
Ga0257166_10560191	3300026358	Soil	VDFVAVIDQVITLLRQRGRLTYSTLKRQFQLDEAALEDVK
Ga0257164_10581222	3300026497	Soil	VDFVAVIDQVITLLRQRGRLTYSTLKRQFQLDEAALEDVKNE
Ga0209689_12153461	3300027748	Soil	VDFVAVLDQVIVLLRQRGRLTYSTIKRQFQLDEAALEDVKN
Ga0209180_106312401	3300027846	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRVTYSTLKRQFQLDDAV
Ga0209814_105743102	3300027873	Populus Rhizosphere	VDFVAVMDQVITLLRQRGRLTYRTLQRQFQLDAAALE
Ga0209465_102852171	3300027874	Tropical Forest Soil	MDFVAVLDQVIALLQQRGRLTYSTLKRQFQLDDTALEDVKNE
Ga0209481_103437941	3300027880	Populus Rhizosphere	VDFVAVVDQAIALLRQRGRLTYRTLQLQFQLDDTHLE
Ga0209590_105261671	3300027882	Vadose Zone Soil	MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDALHD
Ga0209590_106825551	3300027882	Vadose Zone Soil	VDFVAVVDQVIALLRQRGRVTYRTLKRQFQLDDDVL
Ga0209590_107490901	3300027882	Vadose Zone Soil	VDFVAVLDQVIVLLRQRGRVTYSTLKRQFQLDDAAL
Ga0207428_104827213	3300027907	Populus Rhizosphere	VDFVAVLDQVIALLRQRGRLTYRTLQRQFQLDEAALEDLKVEL
Ga0209382_106274113	3300027909	Populus Rhizosphere	VDFVAVMDQVIALLRQRGRLTYRTLQRQFQLDAAALDDLTVELIKG
Ga0209860_10453011	3300027949	Groundwater Sand	MQGGDGVDFVAVLDQVIALLRQRGRLTYSTLKRQFQD
Ga0299907_109647551	3300030006	Soil	VDFVTLVDQVLALLRQRGRVTYRTLQRQFQLEADALT
Ga0307468_1018954092	3300031740	Hardwood Forest Soil	VDFVAVLDQVIALLHQRGRLTYRTLKRQFELDDVA
Ga0307473_105096601	3300031820	Hardwood Forest Soil	MDFVAVVDQVITLLRQRGRVTYSTLKRQFQRDDAAVEDVKNELI
Ga0310900_114826153	3300031908	Soil	MDFVAVVDQVIALLRQRGRVTYRTLQLQFTLNDAQMVALKDE
Ga0310916_106553891	3300031942	Soil	MDFVAIVDQVITLLRQRGRMTYRTLQRQFQLDDDAVHDLTD
Ga0310916_114162652	3300031942	Soil	VDFVAVVDQVIALLRQRGRVAYRMLKVQFHLDDDA
Ga0310884_103784802	3300031944	Soil	GVDFVAVLDQVMLLRQRGRLTYRTLQRQFQLDDAALDDLFVWRHL
Ga0306926_114284301	3300031954	Soil	VDFLAIVDQVIALLRQRGRMTYRTLKRQFQLDEAALEDL
Ga0307414_110308702	3300032004	Rhizosphere	MDFYDMLDQVRDLLRQRGRVAYRVLKLQFKLDDET
Ga0310899_107263221	3300032017	Soil	VDFVAVVDQVIALLRQRGRVAYRTLKRQFQLDAEAIE
Ga0318507_104937722	3300032025	Soil	VDFVAVVDQAITLLRQRGRVTYRTLQRQFQLDDAALD
Ga0318575_103098421	3300032055	Soil	MDFVAVLDQVIALLRQRRRLTYSTLKRQFQLDDAALEE
Ga0310890_109390492	3300032075	Soil	VDFVAVLDQVIALLRQRGRLTYRTLKRQFQLDDEAL
Ga0318577_103493432	3300032091	Soil	VDFVAVVDQAIALLRQRGHLTYRTLQLQFQLDAEYLA
Ga0310895_107841592	3300032122	Soil	VDFVAVLDQVITLLRQRGRLTYRTLKRQFELDDAALED
Ga0307415_1011360071	3300032126	Rhizosphere	MDFVAVMDQVIALLRQRGRLTYRTLQLQFQLDETHLEVLKEEL
Ga0247830_101736851	3300033551	Soil	MDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDAEHL
Ga0247830_102922772	3300033551	Soil	VAVVDQAIALLRQRGRLTYRTLQLQFQLDTEHLEALKTVRDACP
Ga0364928_0017534_899_1015	3300033813	Sediment	VDFVAVLEQVIALLRQRGRLTYSTLKRQFQLDDAALED
Ga0314792_193581_423_560	3300034667	Soil	MDFVAVVDQAIALLRPRGRLTYRTLQRQFQLDDAALDDLFVWRHL
Ga0314797_126971_429_545	3300034672	Soil	VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDEHLQAL
Ga0314803_144198_375_500	3300034678	Soil	VDFVTVVDQAIALLRQRGRLTYRTLQLQFQLDDEHLQALTDE
Ga0370546_077321_394_528	3300034681	Soil	MDFVAVVDQVIALLQQRGRVTYRTLQRQFQLDEAALEDGTSSPA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign