Basic Information | |
---|---|
Family ID | F037521 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 167 |
Average Sequence Length | 46 residues |
Representative Sequence | MARTFVLIAPVHAVLHRVSCSYETIPNAPKHYATHQNMSLGSNGV |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 8.15 % |
% of genes near scaffold ends (potentially truncated) | 77.84 % |
% of genes from short scaffolds (< 2000 bps) | 80.24 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.401 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (41.317 % of family members) |
Environment Ontology (ENVO) | Unclassified (75.449 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (73.054 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 30.14% β-sheet: 0.00% Coil/Unstructured: 69.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.40 % |
All Organisms | root | All Organisms | 0.60 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 41.32% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 24.55% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 8.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009977 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028052 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028147 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028157 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028465 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028469 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070690_1007968081 | 3300005330 | Switchgrass Rhizosphere | DFMARTFVLIAPAHPVLHRVSCSYETIPNAPKHYATHQNMSSGSNGVD* |
Ga0070668_1021581021 | 3300005347 | Switchgrass Rhizosphere | VARTFALIAPVHTVLHRLSCSYETITDEHKHNETYQNMSLGSNGVDWVHSLRKI |
Ga0070669_1012804421 | 3300005353 | Switchgrass Rhizosphere | MARTFVLIAPAHPVFHRVSCSYEMIPNAPKHYAMHQNMSLGSNG |
Ga0070669_1013472171 | 3300005353 | Switchgrass Rhizosphere | MAQTFVLIAPAHLVLHQVSCSYETIPNAPKHYATHQNMSLGSNGV |
Ga0070669_1017594581 | 3300005353 | Switchgrass Rhizosphere | FVLIAPAHPVLHRVSCSYETIPNAPKHYATHQNMNLGSNGVDYVLS* |
Ga0070671_1004947383 | 3300005355 | Switchgrass Rhizosphere | VARAFALIALIHPVLHRVSCVYEMIPNAPKHYATHQNMSL |
Ga0070688_1007079551 | 3300005365 | Switchgrass Rhizosphere | VAPTFALIAPIHTILHRVSCSYETIPNAPKHYATHQNMSSGSNG |
Ga0070667_1002740582 | 3300005367 | Switchgrass Rhizosphere | ALIALVHPVLHRVSCGYEMIPNAPKHCATHQNLSLGSNGVD* |
Ga0070667_1021351501 | 3300005367 | Switchgrass Rhizosphere | MARTFALIAQVHPVLHRVSCSYEMNPNAHKHYEMHQNMSLGSNGVD |
Ga0070701_106026761 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MARTFVLIAPVHAVLHRVSCSYETIPNAPKHYATHQNMSLGSNGV |
Ga0070708_1013611121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARTFVLIAPVHAVLHRVSCSYETIPNAPKHYATHQNMSLGSNGVDWV |
Ga0070708_1013611122 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TFVLIAPVHAVLHRVSCSYETIPNAPKHYATHQNMNLGSNVVDWVRSLRNVPT* |
Ga0070685_109304632 | 3300005466 | Switchgrass Rhizosphere | LIALVHPILHRVSCGYEMIPNAPKHCATHQNLSLGSNGVD* |
Ga0070706_1016092191 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPTFALIAPIHTVLHRVSCSYETIPNAPKHYATHQNMSSGSNGVDWV |
Ga0070707_1016727701 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MARTFVLIAPVHAVLHRVSCSYETIPNAPKHYATHQNMSLRSNGADWVR |
Ga0070686_1013609041 | 3300005544 | Switchgrass Rhizosphere | MARTFVLIAPVHAVLHRVLCSYETIPKAPKHYPTHQNMSLGSNGVDWV |
Ga0070665_1016455721 | 3300005548 | Switchgrass Rhizosphere | VARAFALIALIHPVLHRVSCVYEMIPNVPKHYATHQNMSLGSNGVDWVRSVQK |
Ga0070702_1011303431 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQTFVLIAPVHPVLHRVSCSYETIPNAPKHYATHQNMSLGSNG |
Ga0068864_1013002172 | 3300005618 | Switchgrass Rhizosphere | VARTFALIAPVHPVLHRV*CSYETITDEPKHYETYQNMSLR |
Ga0068861_1015755281 | 3300005719 | Switchgrass Rhizosphere | APVHTVLHRVSCSYEMIPNAPKHYTTHQNLSLGSNGADWVLSL* |
Ga0068863_1010548461 | 3300005841 | Switchgrass Rhizosphere | MARTFVLIAPAHPVLHRVSRSYETILNAPKHYATEQNMSLGSNGVD* |
Ga0068863_1014709331 | 3300005841 | Switchgrass Rhizosphere | ARTLALIAPIHPILHRVSCSYEMIPNAPKHYETHQNMSLGSNGVD* |
Ga0068863_1019358742 | 3300005841 | Switchgrass Rhizosphere | MARTFTLIAPVHPVLHRVSWSYEMIPNAPKHYATHQN |
Ga0068863_1020614961 | 3300005841 | Switchgrass Rhizosphere | AFALIALVHPVLHRVSCGYEMIPNAPKHYATHQNLSLGSYGVD* |
Ga0068863_1026369092 | 3300005841 | Switchgrass Rhizosphere | MAQTFALIAPLHPVLHRVSCSYEKIPNAPEHYEMHQNMSLG |
Ga0068858_1010805361 | 3300005842 | Switchgrass Rhizosphere | MARTFVLIAPAHPVVHRVSCSYETMPNAPKHYAMHQNMSLGSNGVD |
Ga0068860_1003673622 | 3300005843 | Switchgrass Rhizosphere | VARTFALIAPIHPVSPQVCSYEMIPNAPKHYETHQNMSL |
Ga0068862_1011826041 | 3300005844 | Switchgrass Rhizosphere | VAPTFALIAPVHTILH*VSCSYETITNAPKHYETYENKSL |
Ga0105136_1072762 | 3300009973 | Switchgrass Associated | VARTFALIAPVRPVLHRVSCNYETIPNAPKHYETLKNMSVGSDG |
Ga0105129_1138681 | 3300009975 | Switchgrass Associated | MARTFVLIAPAHPVLHRVSCSYEMIPNAPKHYATHQNMSLGSNGVD |
Ga0105128_1025932 | 3300009976 | Switchgrass Associated | VARTFALIAPVHTVLH*VSCSYETIPNAPKHYAAHQNMSLGSNVV |
Ga0105128_1041951 | 3300009976 | Switchgrass Associated | VAQTFALIGPVHPILHQVSCNYETIPNAPKHYETHQNMSLGSN |
Ga0105128_1053521 | 3300009976 | Switchgrass Associated | TFTLIAPVQYVLQQVSSSYETIPNATKHYETHQNMSLGSNGVDQVRSL* |
Ga0105128_1187001 | 3300009976 | Switchgrass Associated | MARTLALIALVHPVLHRVSCSYEMIPNAPKHYETHQNMSLGSNGVDWVRSL |
Ga0105141_1047071 | 3300009977 | Switchgrass Associated | VPRTFALIAPLHPVLHRVSCCYEKIPNAPEHYEMHQNMSLGSNGVDQV |
Ga0105141_1222771 | 3300009977 | Switchgrass Associated | MARTFVLIALVQAVLHRVSCSYETIPNAPKHYATHQNMSLGSNGVDWVR |
Ga0105135_1095022 | 3300009980 | Switchgrass Associated | VAGTFALIAPVHTILHRVSCSYETIQYAPEHYAKHQNMSLG |
Ga0105135_1148881 | 3300009980 | Switchgrass Associated | MARTFVLIAPVHPVLHRVSCSYETIPNEPKHYATHQNKSLGSNGVDLV |
Ga0105133_1045361 | 3300009981 | Switchgrass Associated | RTFALIAPVHTVLHRVLCSYETIIDEPKHYETYQNMTLGSNGVDWVRSLRKIPT* |
Ga0105133_1169611 | 3300009981 | Switchgrass Associated | MARTFALIAQVDPILHRVSCSFEMIPNAPKHYTTHQNMSLGSNGAYWVR |
Ga0105131_1439011 | 3300009989 | Switchgrass Associated | VA*TFALIAPVDPVLHRVSGSYETIPNAAKHYATHQNMSLGSNGVDSV |
Ga0105120_10196871 | 3300009992 | Switchgrass Associated | MARTFVFIAPVHPVLHQVSCSYETIQNAPKHYATHQNMSLVSNGVDW |
Ga0105120_10312641 | 3300009992 | Switchgrass Associated | VARAFALIALVHTVLQRVSCSYETILNAPKHYATHQNMSLGSNVV |
Ga0134125_110927873 | 3300010371 | Terrestrial Soil | VARTFALIAPVHPILHLVSCSYEMIPNTPKHYETHKNMSLGSNGA |
Ga0134124_112679422 | 3300010397 | Terrestrial Soil | MNFALIALVHPVLHRVSCSDETIPNASKHYATHQNMSLGSNGVDWE |
Ga0134122_116162671 | 3300010400 | Terrestrial Soil | VAQTFALIAPIQSILLRISCSHEMVPNATKHYEMQQNMSLG |
Ga0134123_101498931 | 3300010403 | Terrestrial Soil | MALNFALIAPVQPVLHRVSFSKEIIPNAPKHYETYQNMSLESNGLDRV |
Ga0134123_106451891 | 3300010403 | Terrestrial Soil | MARTFLLIAPVHPVLHRVSWSYETIPNAHKHYATHQNMSLGSNGVDFV |
Ga0134123_110884451 | 3300010403 | Terrestrial Soil | SFALIALIHPVLHRVSCSYEMIPNATKHYEMHQNMSLGSNGVD* |
Ga0163163_124839241 | 3300014325 | Switchgrass Rhizosphere | VPRTFALIAPLHTVLHRVSCSYEKIPNAPEHYEMHQNMSLESNGL |
Ga0157379_104951383 | 3300014968 | Switchgrass Rhizosphere | DFAAPTFALIAPVLHRVS*SYEMIPNAPKHYETHQNMSLGSNGVD* |
Ga0182183_10097661 | 3300015270 | Switchgrass Phyllosphere | MRDIVARAFALIALIHPVLYRVSCVYEIIPNAPKHYATHQNMSLGSNGVDWVRSV |
Ga0182100_10791391 | 3300015280 | Switchgrass Phyllosphere | VAQTFALIAPVHPVSH*ISCSYETIPNAPKHYEMHQNMSLG |
Ga0182101_10772611 | 3300015284 | Switchgrass Phyllosphere | MARTFALIAPVHTVLHRVSCSYETIPNAPKHYATHQNMSLGSNVVDW |
Ga0182138_10615181 | 3300015289 | Miscanthus Phyllosphere | VAQTFALIAPIHPVLHRVSCSYEMIPNAPKHYEIHQNMSLGS |
Ga0182103_10219092 | 3300015293 | Switchgrass Phyllosphere | VARTFALIAPIHTILHRVSCRYETIPNAPKHYATHQNMSSGSNGVDWVRSLQK |
Ga0182104_10352891 | 3300015297 | Switchgrass Phyllosphere | MARTFVLIAPIHLVLHRVSCSYETITDEHKHYETYQNMSLGS |
Ga0182104_10732701 | 3300015297 | Switchgrass Phyllosphere | MARTFVLIALAHPVFHRVSCSYEMIPNAPKHYAMHQNMSLGSNGVDYVH |
Ga0182098_10025771 | 3300015309 | Switchgrass Phyllosphere | MAQTFALIAPVHPVSH*ISCSYETIPNAPKDYEMHKNMSVGANGVDRVRS |
Ga0182098_10768961 | 3300015309 | Switchgrass Phyllosphere | MARTFVLIAPAHPVLHRVSCSYETIPNAPKHYATHQNMSLGSNGVDY |
Ga0182098_10841481 | 3300015309 | Switchgrass Phyllosphere | MARTFVLIAPVHPVLHQVSSSYETIPNAPKHYATNQNMSLGSNGV |
Ga0182162_11102631 | 3300015310 | Switchgrass Phyllosphere | VARTFALIALVHPISHQVSCSYVTIPNAPKHYETHQNMNLGSNGMD* |
Ga0182182_10770991 | 3300015311 | Switchgrass Phyllosphere | VKNNCDFVARTFALIALVHPVLHRVSSSYETIPNAHKHYETHQNIRLGSNGVDQ |
Ga0182168_10135321 | 3300015312 | Switchgrass Phyllosphere | MAQTFVLIAPAHLVLHQVSCSYETIPNAPKHYATHQNMSLGSNGVD* |
Ga0182168_11382791 | 3300015312 | Switchgrass Phyllosphere | VAQTFALIELVHPVSH*ISCSYETIPNAPKHYETHKNMSVGSNGVDRVRSL |
Ga0182120_10204681 | 3300015315 | Switchgrass Phyllosphere | LIAPVHPVLHRVSCSYETIPNAPKHYATLRNMSLRSNGADWVRSL* |
Ga0182120_11308491 | 3300015315 | Switchgrass Phyllosphere | MARTFTLIAPVHHVLHRVLWSYEMIPNAPKHYATHQNMSLGSNGVDWVRSLRKIP |
Ga0182136_10097723 | 3300015317 | Switchgrass Phyllosphere | VEQTFALIAPIHPVLYRVSCSYEMIPNAPKHYETHQNMSLGSNGVD* |
Ga0182136_10127781 | 3300015317 | Switchgrass Phyllosphere | MARTTALIAPVQAVLHRVSCSYEILPNAHKYYKKRQNKSLGSNGVGRVDLL* |
Ga0182136_10682461 | 3300015317 | Switchgrass Phyllosphere | MARTFALIAPVRTVLNRVSCSYETITDEPKHYETYQNMSLGSNGV |
Ga0182136_11243481 | 3300015317 | Switchgrass Phyllosphere | VARTFALIAPVHTILHLVSCSYETIPNAPKHYATHQNMSLGSNGVDWV |
Ga0182136_11421241 | 3300015317 | Switchgrass Phyllosphere | MARTFALIAPVHTVLHRVSCSYETITDEPKHYETYQNMSLG |
Ga0182181_10151291 | 3300015318 | Switchgrass Phyllosphere | EKSQGDFAAPTFALIAPVLHRVS*SYEMIPNAPKHYETHQNMSLGSNGVD* |
Ga0182181_11011841 | 3300015318 | Switchgrass Phyllosphere | MARTFTLIAPVHPVLHRVSWSYEMIPNAPKHYATHQNMSLGSNGVDWVH |
Ga0182134_10118861 | 3300015324 | Switchgrass Phyllosphere | VA*TFALIAPVDPVLHRVSGSYETIPNAAKHYATHQNMSLGSNGVDS |
Ga0182148_10243841 | 3300015325 | Switchgrass Phyllosphere | MARTFVLIASAHPVLHRVSCSYETIPNAPKHYATHQNMS |
Ga0182166_10122793 | 3300015326 | Switchgrass Phyllosphere | DFVEQTFALIAPIHPVLYRVSCSYEMIPNAPKHYETHQNMSLGSNGVD* |
Ga0182114_10413842 | 3300015327 | Switchgrass Phyllosphere | MAPIHPVLHRVSCSYETIPNAPKHYATHQNMSLGSNGVDWVRSLRKI |
Ga0182114_11392581 | 3300015327 | Switchgrass Phyllosphere | MARTFALIALAHTILHRVSCSYERITDELKHYETYQNMSLGSNGVDWVHSF |
Ga0182131_10161841 | 3300015331 | Switchgrass Phyllosphere | MARTFVLIAPVHPVLHRVSCSYETITDEHKHYETYQNMS |
Ga0182131_10827391 | 3300015331 | Switchgrass Phyllosphere | MARTFALIAPVQSVLHRVYSHNETIPNALEHYEMHQNMSLGSNGV |
Ga0182131_11459071 | 3300015331 | Switchgrass Phyllosphere | VAQTFALIAPIQFILHRVSCSHEIVPNAPKLYETQQNMSLGSNGV |
Ga0182147_10201221 | 3300015333 | Switchgrass Phyllosphere | MARTFVLIAPVHPILHRVSCSYETIPNAHKHYAMHQNMSLGSNGVDFVR |
Ga0182151_11420211 | 3300015337 | Switchgrass Phyllosphere | PVLHQVSLGYEMIPNAPKHYATHQNMSLGSNGVD* |
Ga0182149_10341042 | 3300015339 | Switchgrass Phyllosphere | DFVEQTFALIALIHPVLHRVSCSYEMIPNATKHYETHQNMSLGSNGVD* |
Ga0182149_10843861 | 3300015339 | Switchgrass Phyllosphere | MARTFVLIAPVHAVLHRVSSSYETIPNAPKHYATHQNMSLGSNG |
Ga0182149_11316392 | 3300015339 | Switchgrass Phyllosphere | MARTFVLIAPAHPVFHRVSCSYEMIPNAPKHYAMHQNMSLGSNGVDYV |
Ga0182115_11802741 | 3300015348 | Switchgrass Phyllosphere | MARTFALIAPVRTVLHRVSCSYETITDEPKHYETYQNMSLGSNGVD |
Ga0182115_11852591 | 3300015348 | Switchgrass Phyllosphere | MALTYASIAQVQSVLHRVYCRNKTIPNAPEHYEMRQNIS |
Ga0182115_12429781 | 3300015348 | Switchgrass Phyllosphere | MARTFALIAPVLTVLCRVSCIYEMIPNAPKHYTTHQNMSFGSNGADW |
Ga0182115_13015571 | 3300015348 | Switchgrass Phyllosphere | MARAFVLIAPAQPVLLRVSCSYETILNAPKHYATHQNMSLGSNG |
Ga0182185_12645361 | 3300015349 | Switchgrass Phyllosphere | MARTFVLIAPAHPILHRVSCSYETIRNALKHYAMHQNMSLESNRVD* |
Ga0182163_11099231 | 3300015350 | Switchgrass Phyllosphere | MARTFVLIAPIQYVLHQVSCSYETIPNAPKHYETHQNMSLG |
Ga0182169_10710141 | 3300015352 | Switchgrass Phyllosphere | FVARIFALIAPVLTILHRVLCSYETIPNAPKHYATHQNMSLGSNGVGWVRSL* |
Ga0182169_13009521 | 3300015352 | Switchgrass Phyllosphere | MACTFALIAPVHTVLHRVSCSYETIPNAPKHYATHQNMSLGSNGVDWVRSL*KIP |
Ga0182169_13018342 | 3300015352 | Switchgrass Phyllosphere | RRNFVARSFALITPVQPVLHRVSCSKEMIRNAPKRDETHQNMSLESNG* |
Ga0182179_12044451 | 3300015353 | Switchgrass Phyllosphere | MARTFALIAPVHTVLHRVSCSYETITDEPKHYETYQNMS |
Ga0182167_10406371 | 3300015354 | Switchgrass Phyllosphere | MARTFTLIAPVWHVLHQVSGSSEMVTNAPKRNEMHQNMSL |
Ga0182167_12473761 | 3300015354 | Switchgrass Phyllosphere | DFMARTFVLIAPVHPVLHQVSSSYETIPNAPKHYATHQNMSLGSNGAD* |
Ga0182167_12493381 | 3300015354 | Switchgrass Phyllosphere | FALIALVHPVLHRVSCGYEMIQNAPKHCATHQNLSLGSNGVD* |
Ga0182195_11863871 | 3300017414 | Switchgrass Phyllosphere | MARTFALIVPAHTILHRVSCSYERITDELEHYETYQNMSLGSNGVDWVHS |
Ga0182213_11279321 | 3300017421 | Switchgrass Phyllosphere | MARTFALIAPVHTVLHRVLCSYEKIPNAPKHYATHQNMNLGSNVVDWVRSLRKVPTXL |
Ga0182213_12153741 | 3300017421 | Switchgrass Phyllosphere | ARSFALIAPVHTVLHRVSCSYETITDEPKHNETYENMS |
Ga0182201_10761131 | 3300017422 | Switchgrass Phyllosphere | MAXTFILIAPTHPVLHRVSCSYETIRNAPKHYAMHQNMSLES |
Ga0182196_10221871 | 3300017432 | Switchgrass Phyllosphere | MARTFTLIAPVHHVLHRVLWSYEMIPNAPKHYATHQNMSLGSN |
Ga0182194_11232191 | 3300017435 | Switchgrass Phyllosphere | VEQTFVLISLIHPVLHRVSCSYEMIPNAPKHYEMHQNMSLGSNGV |
Ga0182200_10828301 | 3300017439 | Switchgrass Phyllosphere | VAPTFALIEPIHTVLHRVSCSYETIPNAPKHYATHQNMSSGSNGVDWVR |
Ga0182200_11432321 | 3300017439 | Switchgrass Phyllosphere | VEQTFALIAPIHPVLHRVSCSYEMIPNAPKHYETHQNMSLGSNGV |
Ga0182214_11196801 | 3300017440 | Switchgrass Phyllosphere | MARTFVLIAPAHHVLHRVSCSYEMNPNAPKHYATHQNMSLGSNGVDYVRSLRK |
Ga0182214_11372571 | 3300017440 | Switchgrass Phyllosphere | MARTFALIAPVHTVLHRVSCSYEMIPNAPKHYATHQNMNLGSNVVDWVRSLR |
Ga0182198_11456561 | 3300017445 | Switchgrass Phyllosphere | VAXTFALIAPVDPVLHRVSGSYETIPNAAKHYATHQNMSLGSNG |
Ga0182198_11568841 | 3300017445 | Switchgrass Phyllosphere | MARTFALIAHVQSVLHRVYSHNETIPNALEHYEMHQNMSLGSNGVDQ |
Ga0182210_11208771 | 3300017692 | Switchgrass Phyllosphere | MARTFVLIAPVHPVLHRVSCSYETIPNAHKHYATHQNMSLGSNGVDFVR |
Ga0182216_12035821 | 3300017693 | Switchgrass Phyllosphere | MARTFALIAPVHTVLHRVSCSYETIPNAPKHYATHQNMNLGSNVVDW |
Ga0182211_10977361 | 3300017694 | Switchgrass Phyllosphere | ARTLALIAPIHRILHRVSCSYEMIPNAPEHYATHQNMSLGSNGVDWERS |
Ga0182178_10097951 | 3300020023 | Switchgrass Phyllosphere | MARTFALIAPVHPFFHQVSCNYETIPNAPKHYEMHQNMSLGSNG |
Ga0182118_1034062 | 3300020223 | Switchgrass Phyllosphere | VPRTFALIAPLHTVLHRVSCSYEKIPNAPEHYEMHQNMSLGSNGVD |
Ga0207680_109649311 | 3300025903 | Switchgrass Rhizosphere | VARTFVLIAPVHAILHRVSCSYEMIPNAPKHYATHQNMSLGSNGVDWVR |
Ga0207668_110326221 | 3300025972 | Switchgrass Rhizosphere | LIAPVHPILHRVSCSYETIPNAHKHYAMHQNMSLGSNGVDFVRS |
Ga0207658_105407991 | 3300025986 | Switchgrass Rhizosphere | VARTFALIAPVHTVLHRVLCSYETIPKAPKHYPTHQNMSLGSDGVDW |
Ga0207641_110624781 | 3300026088 | Switchgrass Rhizosphere | TFALIAQVHRILHLVSCSYEMIPNAPKHYATHQNLSLGSNGVDWVHS |
Ga0268322_10512241 | 3300028049 | Phyllosphere | MARTFTLIAPVHPVLHRVLWSYEMIPNAPKHYATHQNMSL |
Ga0268328_10274981 | 3300028050 | Phyllosphere | MARTTALIAPVQAVLHRVSCSYEILPNAHKYYKKRQNKSLGSNGVGRVHLL |
Ga0268300_10109941 | 3300028052 | Phyllosphere | VARTFALIAPVHTILHLVSCSYETIPNAPKHYTMHQNMSLGSRLGG |
Ga0268346_10103291 | 3300028053 | Phyllosphere | VARTFALIALVHPVLPRVSYSYDTIPNAPKHYETHENMILGSN |
Ga0268346_10136481 | 3300028053 | Phyllosphere | MARTFALIAPVHTVLHRVSCSYETITNAPKHNETYENMSLGSNG |
Ga0268306_10011702 | 3300028054 | Phyllosphere | DFMARTFVLIAPVRPVLHQVSCSYETITDEHKHYETYQNMSLGSNGVECVRS |
Ga0268330_10013671 | 3300028056 | Phyllosphere | MAQTFVLIAPAHLVLHQVSCSYETIPNAPKHYATHQNMSLGSNGVD |
Ga0268330_10013673 | 3300028056 | Phyllosphere | MAQTFVLIAPGHLVLHQVSCSYETIPNAPKHYATHQNMSLGYNGVD |
Ga0268330_10509741 | 3300028056 | Phyllosphere | MAQTFALIAPVHTVLNRVSCSYETIIDEPKHYETYQNMCLG |
Ga0268332_10368951 | 3300028058 | Phyllosphere | MARTFVLIAPVHPILHRVSCSYETIPNAHKHYAMHQNMNLGSNGVDFVCS |
Ga0268332_10776281 | 3300028058 | Phyllosphere | VARTFALIAPVHPILHQVSCNYETIPNAPKHYETHQNMSLGSN |
Ga0268314_10165341 | 3300028061 | Phyllosphere | VPRTFALIAPLHTVLHRVSCSYEKIPKAPEHYEMHQNMSLGSNGVDQ |
Ga0268314_10372761 | 3300028061 | Phyllosphere | MARTSELIAPVQHVLHRVSCSNETLPNAHKYYKMHQNMSLGSNGVDRV |
Ga0268342_10163621 | 3300028062 | Phyllosphere | IARAFALIALVHPVLHQVSLGYEMIPNAPKHYATHQNMSLGSNGVDWVRSLQKIPT |
Ga0268342_10188781 | 3300028062 | Phyllosphere | MAHTFALIAPVHPVLHRVSCSYEIIPNAPKHYETHQNM |
Ga0268340_10120932 | 3300028064 | Phyllosphere | VPRTFALILPLQPVLHRVSCSYEKIPNAPEHYEMHQNMSLGSNGVDLVRWLQKLT |
Ga0268340_10397581 | 3300028064 | Phyllosphere | MARTFVLIAPVHPVLHQVSSSYETIPNAPKHYATHQNMSLGSNGA |
Ga0268340_10397582 | 3300028064 | Phyllosphere | DFMARTFVLIAPVHPVLHQVSSSYETIPNAPKHYATHQNMSLGSNGVD |
Ga0268340_10777221 | 3300028064 | Phyllosphere | DFMAQTFVLIAPAHPVLHRVSCSYETIRNAPKHYAMHQNMSLESNGVD |
Ga0268355_10066461 | 3300028139 | Phyllosphere | VARTLALSAPIHPVLHQVCSYEMIPNAPKHCETHENMS |
Ga0268347_10127621 | 3300028142 | Phyllosphere | MARTFALIAPVHTVLHRVSCSYETITDEPKHYETYQNMSLGSNGV |
Ga0268348_10097582 | 3300028143 | Phyllosphere | VARNFALIAPVHPILHQVSCSYEMIPNAPKHYETNQNMSLGSNGADWVC |
Ga0268303_1017901 | 3300028147 | Phyllosphere | MARSFVLIAPVHPVLHRVSCSYETIPNAPKHYTMHQNMSLGSNGVDFVC |
Ga0268308_10203141 | 3300028151 | Phyllosphere | MEQTIALIALIHPVLHRVSCSYEMIPNAPEQYEMHQNISLGPNGVD |
Ga0268308_10307401 | 3300028151 | Phyllosphere | FVARTFALIAPVHPVLHRVSCSYEMIPNAPKHYTMHQNMSLGSNGADWVRS |
Ga0268308_10319581 | 3300028151 | Phyllosphere | MARTFVLIAPVHPILHRVSCSYETIPNAPKHYATHQNMSLGSNGVDW |
Ga0268318_1015721 | 3300028157 | Phyllosphere | MARTTALIAPVQAVLHRVSCSYEILPNAHKYYKKRQNKSLGSNGVG |
Ga0268312_10306571 | 3300028248 | Phyllosphere | MARTFALIAPVHTVLHRVSCSYEMIPNAPKHYATHQNMNLGSNVVDWVRSLRKVP |
Ga0268316_10108711 | 3300028253 | Phyllosphere | MARTFTLIAPVHHVLHRVLWSYEMIPNAPKHYATHQNMSLGSNGVDWEHSL |
Ga0268304_10001243 | 3300028256 | Phyllosphere | MARTFVLIAPALPVLHRVSCSYETIPNAPKHYATHQNMSLGP |
Ga0268264_111442592 | 3300028381 | Switchgrass Rhizosphere | VPRTFALIAPLHTVLHRVSCSYEKIPNAPEHYEMHQNMSLGSNGVDQ |
Ga0268301_1012251 | 3300028465 | Phyllosphere | MARIFALIALVHTILHRVXCSYEMIPNATKHYATQQNMSLVS |
Ga0268333_10120181 | 3300028467 | Phyllosphere | VARTFALIAPIHTILHRVSCRYETIPNAPKHYATHQNMSSGSNGVDWVRSLQKNPDVTSW |
Ga0268337_10038821 | 3300028469 | Phyllosphere | VPRTIALILPLQPVLHRVSCSYEKIPNAPEHYEMRQNMSLGSNEVDLVRWL |
Ga0268337_10138161 | 3300028469 | Phyllosphere | MARTFVLIAPVHPVLHQVSCSYEMIPNAPKHYETYENM |
Ga0268323_10002771 | 3300028471 | Phyllosphere | MARTFVLIAPVHAVLHRVSCSYETIPNAPKHYATLQNMSL |
Ga0268331_10003121 | 3300028474 | Phyllosphere | KSWRDFVARAVTLIALIHPVLHRVSCVYEMIPNAPKHYASHQNMSLGSNGVDWVRSVQKILM |
Ga0268327_10174471 | 3300028475 | Phyllosphere | MARTFTLIAPVHHVLHRVLWSYEMIPNAPKHYATHQNMSLGSNGVDWVHSLREI |
Ga0268329_10293211 | 3300028476 | Phyllosphere | MAQTFALIAPVHPVSHXISGSYETIPNAPKHYETHKNMSVGSNGEDR |
Ga0268339_10079461 | 3300028526 | Phyllosphere | VAXTFALIAPVHPVLHQVSCSYEMIPNAPKHYETHQNMSLGSN |
Ga0268339_10085132 | 3300028526 | Phyllosphere | VARTFALIAPVHTVLHRVSYSYETIPNAPKRYATHQNMSLGSNEL |
Ga0268311_10194841 | 3300028529 | Phyllosphere | MARTFALIAPVHTVLHRVSCSYETIPNDPKHYATHQNMNLGSNVVDWVRS |
Ga0214503_12596381 | 3300032466 | Switchgrass Phyllosphere | RDFMAQTFVLIAPAHLVLHQVSCSYETIPSAPKHYAAHQNMSLGSNGVDFVRS |
Ga0214490_11370301 | 3300032502 | Switchgrass Phyllosphere | VAXTFALIAPVHPVLHRVSCSYETIPKEHKHYETNENMRFGSNGEDQ |
Ga0314757_11241021 | 3300033534 | Switchgrass Phyllosphere | RTSALIAPAHPVLHRDSCSYETIPNAPKHNETHQNMSLGSNGVD |
Ga0314757_11666461 | 3300033534 | Switchgrass Phyllosphere | VAQTFALIAPVWRVLQQVSCSNETVQNAPQRKEIHQNMSLGSNWVEP |
⦗Top⦘ |