Metagenome Family F037544

Basic Information
Family ID	F037544
Family Type	Metagenome
Number of Sequences	167
Average Sequence Length	43 residues
Representative Sequence	MHVENKLAEIVTIGDHEFEEVIEEYEEEILVQEEVPEPPLTD
Number of Associated Samples	69
Number of Associated Scaffolds	167

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	7.36 %
% of genes near scaffold ends (potentially truncated)	19.16 %
% of genes from short scaffolds (< 2000 bps)	97.60 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Most Common Taxonomy
Group	Unclassified (100.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.210 % of family members)
Environment Ontology (ENVO)	Unclassified (95.808 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.808 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	100.00 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005333\|Ga0070677_10801080	Not Available	538	Open in IMG/M
3300005334\|Ga0068869_101401023	Not Available	619	Open in IMG/M
3300009148\|Ga0105243_11385086	Not Available	723	Open in IMG/M
3300011119\|Ga0105246_12056629	Not Available	552	Open in IMG/M
3300013296\|Ga0157374_12099199	Not Available	592	Open in IMG/M
3300013297\|Ga0157378_12297446	Not Available	591	Open in IMG/M
3300015267\|Ga0182122_1034902	Not Available	617	Open in IMG/M
3300015267\|Ga0182122_1070539	Not Available	506	Open in IMG/M
3300015268\|Ga0182154_1044339	Not Available	582	Open in IMG/M
3300015268\|Ga0182154_1070654	Not Available	509	Open in IMG/M
3300015268\|Ga0182154_1071053	Not Available	508	Open in IMG/M
3300015274\|Ga0182188_1055111	Not Available	520	Open in IMG/M
3300015275\|Ga0182172_1012038	Not Available	836	Open in IMG/M
3300015275\|Ga0182172_1040854	Not Available	605	Open in IMG/M
3300015275\|Ga0182172_1043683	Not Available	594	Open in IMG/M
3300015276\|Ga0182170_1029878	Not Available	661	Open in IMG/M
3300015276\|Ga0182170_1037943	Not Available	619	Open in IMG/M
3300015276\|Ga0182170_1073061	Not Available	512	Open in IMG/M
3300015277\|Ga0182128_1056353	Not Available	557	Open in IMG/M
3300015279\|Ga0182174_1003200	Not Available	1258	Open in IMG/M
3300015279\|Ga0182174_1007667	Not Available	986	Open in IMG/M
3300015281\|Ga0182160_1022803	Not Available	726	Open in IMG/M
3300015281\|Ga0182160_1025129	Not Available	707	Open in IMG/M
3300015281\|Ga0182160_1053235	Not Available	576	Open in IMG/M
3300015281\|Ga0182160_1059140	Not Available	558	Open in IMG/M
3300015282\|Ga0182124_1034427	Not Available	646	Open in IMG/M
3300015282\|Ga0182124_1058048	Not Available	558	Open in IMG/M
3300015282\|Ga0182124_1063047	Not Available	545	Open in IMG/M
3300015282\|Ga0182124_1069203	Not Available	530	Open in IMG/M
3300015282\|Ga0182124_1072805	Not Available	522	Open in IMG/M
3300015282\|Ga0182124_1073431	Not Available	521	Open in IMG/M
3300015283\|Ga0182156_1018470	Not Available	786	Open in IMG/M
3300015283\|Ga0182156_1022790	Not Available	742	Open in IMG/M
3300015283\|Ga0182156_1024251	Not Available	729	Open in IMG/M
3300015283\|Ga0182156_1039946	Not Available	634	Open in IMG/M
3300015283\|Ga0182156_1073133	Not Available	532	Open in IMG/M
3300015285\|Ga0182186_1026597	Not Available	699	Open in IMG/M
3300015285\|Ga0182186_1050925	Not Available	582	Open in IMG/M
3300015285\|Ga0182186_1061130	Not Available	551	Open in IMG/M
3300015285\|Ga0182186_1082442	Not Available	504	Open in IMG/M
3300015286\|Ga0182176_1027361	Not Available	718	Open in IMG/M
3300015286\|Ga0182176_1032410	Not Available	682	Open in IMG/M
3300015286\|Ga0182176_1055423	Not Available	578	Open in IMG/M
3300015286\|Ga0182176_1063230	Not Available	554	Open in IMG/M
3300015288\|Ga0182173_1041555	Not Available	623	Open in IMG/M
3300015288\|Ga0182173_1079800	Not Available	515	Open in IMG/M
3300015289\|Ga0182138_1028419	Not Available	698	Open in IMG/M
3300015289\|Ga0182138_1061633	Not Available	562	Open in IMG/M
3300015289\|Ga0182138_1064235	Not Available	555	Open in IMG/M
3300015289\|Ga0182138_1068813	Not Available	544	Open in IMG/M
3300015291\|Ga0182125_1013173	Not Available	880	Open in IMG/M
3300015291\|Ga0182125_1019057	Not Available	796	Open in IMG/M
3300015291\|Ga0182125_1069398	Not Available	553	Open in IMG/M
3300015292\|Ga0182141_1034376	Not Available	676	Open in IMG/M
3300015292\|Ga0182141_1079960	Not Available	529	Open in IMG/M
3300015294\|Ga0182126_1066181	Not Available	563	Open in IMG/M
3300015295\|Ga0182175_1042017	Not Available	649	Open in IMG/M
3300015295\|Ga0182175_1042078	Not Available	648	Open in IMG/M
3300015295\|Ga0182175_1055200	Not Available	600	Open in IMG/M
3300015295\|Ga0182175_1067367	Not Available	566	Open in IMG/M
3300015295\|Ga0182175_1094914	Not Available	508	Open in IMG/M
3300015296\|Ga0182157_1030513	Not Available	720	Open in IMG/M
3300015296\|Ga0182157_1047721	Not Available	635	Open in IMG/M
3300015296\|Ga0182157_1101832	Not Available	504	Open in IMG/M
3300015296\|Ga0182157_1103004	Not Available	502	Open in IMG/M
3300015298\|Ga0182106_1036278	Not Available	687	Open in IMG/M
3300015298\|Ga0182106_1076865	Not Available	551	Open in IMG/M
3300015299\|Ga0182107_1012737	Not Available	926	Open in IMG/M
3300015299\|Ga0182107_1038133	Not Available	681	Open in IMG/M
3300015299\|Ga0182107_1082012	Not Available	543	Open in IMG/M
3300015300\|Ga0182108_1077039	Not Available	557	Open in IMG/M
3300015300\|Ga0182108_1090416	Not Available	530	Open in IMG/M
3300015302\|Ga0182143_1014880	Not Available	882	Open in IMG/M
3300015302\|Ga0182143_1031281	Not Available	718	Open in IMG/M
3300015302\|Ga0182143_1058735	Not Available	600	Open in IMG/M
3300015302\|Ga0182143_1075345	Not Available	557	Open in IMG/M
3300015303\|Ga0182123_1045861	Not Available	628	Open in IMG/M
3300015303\|Ga0182123_1045977	Not Available	628	Open in IMG/M
3300015304\|Ga0182112_1056732	Not Available	608	Open in IMG/M
3300015304\|Ga0182112_1056900	Not Available	607	Open in IMG/M
3300015304\|Ga0182112_1089527	Not Available	530	Open in IMG/M
3300015305\|Ga0182158_1022268	Not Available	788	Open in IMG/M
3300015305\|Ga0182158_1034898	Not Available	695	Open in IMG/M
3300015305\|Ga0182158_1050638	Not Available	626	Open in IMG/M
3300015305\|Ga0182158_1050990	Not Available	625	Open in IMG/M
3300015305\|Ga0182158_1057561	Not Available	603	Open in IMG/M
3300015305\|Ga0182158_1058614	Not Available	600	Open in IMG/M
3300015307\|Ga0182144_1082186	Not Available	549	Open in IMG/M
3300015308\|Ga0182142_1082752	Not Available	558	Open in IMG/M
3300015314\|Ga0182140_1033620	Not Available	729	Open in IMG/M
3300015314\|Ga0182140_1043227	Not Available	679	Open in IMG/M
3300015321\|Ga0182127_1035133	Not Available	742	Open in IMG/M
3300015321\|Ga0182127_1061293	Not Available	630	Open in IMG/M
3300015321\|Ga0182127_1118167	Not Available	511	Open in IMG/M
3300015322\|Ga0182110_1026155	Not Available	806	Open in IMG/M
3300015322\|Ga0182110_1064180	Not Available	619	Open in IMG/M
3300015322\|Ga0182110_1085915	Not Available	566	Open in IMG/M
3300015322\|Ga0182110_1088403	Not Available	561	Open in IMG/M
3300015341\|Ga0182187_1067357	Not Available	740	Open in IMG/M
3300015341\|Ga0182187_1123199	Not Available	600	Open in IMG/M
3300015341\|Ga0182187_1180426	Not Available	522	Open in IMG/M
3300015342\|Ga0182109_1128525	Not Available	621	Open in IMG/M
3300015342\|Ga0182109_1137510	Not Available	605	Open in IMG/M
3300015342\|Ga0182109_1209174	Not Available	515	Open in IMG/M
3300015343\|Ga0182155_1134792	Not Available	608	Open in IMG/M
3300015343\|Ga0182155_1219000	Not Available	507	Open in IMG/M
3300015344\|Ga0182189_1087628	Not Available	718	Open in IMG/M
3300015344\|Ga0182189_1190557	Not Available	540	Open in IMG/M
3300015344\|Ga0182189_1221518	Not Available	508	Open in IMG/M
3300015345\|Ga0182111_1025687	Not Available	1142	Open in IMG/M
3300015345\|Ga0182111_1188268	Not Available	557	Open in IMG/M
3300015346\|Ga0182139_1095796	Not Available	720	Open in IMG/M
3300015346\|Ga0182139_1108319	Not Available	688	Open in IMG/M
3300015346\|Ga0182139_1145200	Not Available	617	Open in IMG/M
3300015346\|Ga0182139_1155996	Not Available	600	Open in IMG/M
3300015346\|Ga0182139_1186413	Not Available	560	Open in IMG/M
3300015346\|Ga0182139_1215300	Not Available	529	Open in IMG/M
3300015347\|Ga0182177_1226124	Not Available	522	Open in IMG/M
3300015351\|Ga0182161_1123021	Not Available	684	Open in IMG/M
3300015351\|Ga0182161_1153789	Not Available	628	Open in IMG/M
3300015355\|Ga0182159_1326667	Not Available	519	Open in IMG/M
3300015355\|Ga0182159_1341400	Not Available	508	Open in IMG/M
3300015361\|Ga0182145_1062998	Not Available	733	Open in IMG/M
3300017404\|Ga0182203_1074651	Not Available	649	Open in IMG/M
3300017409\|Ga0182204_1117506	Not Available	505	Open in IMG/M
3300017410\|Ga0182207_1046905	Not Available	778	Open in IMG/M
3300017410\|Ga0182207_1109643	Not Available	592	Open in IMG/M
3300017410\|Ga0182207_1177500	Not Available	501	Open in IMG/M
3300017411\|Ga0182208_1086469	Not Available	571	Open in IMG/M
3300017411\|Ga0182208_1110950	Not Available	528	Open in IMG/M
3300017413\|Ga0182222_1051917	Not Available	610	Open in IMG/M
3300017413\|Ga0182222_1057556	Not Available	593	Open in IMG/M
3300017413\|Ga0182222_1109172	Not Available	500	Open in IMG/M
3300017415\|Ga0182202_1110752	Not Available	542	Open in IMG/M
3300017417\|Ga0182230_1090248	Not Available	560	Open in IMG/M
3300017420\|Ga0182228_1046528	Not Available	734	Open in IMG/M
3300017420\|Ga0182228_1099141	Not Available	554	Open in IMG/M
3300017420\|Ga0182228_1103689	Not Available	545	Open in IMG/M
3300017425\|Ga0182224_1074807	Not Available	649	Open in IMG/M
3300017425\|Ga0182224_1117118	Not Available	563	Open in IMG/M
3300017425\|Ga0182224_1141018	Not Available	530	Open in IMG/M
3300017427\|Ga0182190_1089969	Not Available	620	Open in IMG/M
3300017427\|Ga0182190_1126415	Not Available	552	Open in IMG/M
3300017433\|Ga0182206_1101771	Not Available	581	Open in IMG/M
3300017433\|Ga0182206_1108428	Not Available	569	Open in IMG/M
3300017433\|Ga0182206_1113867	Not Available	560	Open in IMG/M
3300017436\|Ga0182209_1076754	Not Available	655	Open in IMG/M
3300017436\|Ga0182209_1091649	Not Available	619	Open in IMG/M
3300017438\|Ga0182191_1099609	Not Available	617	Open in IMG/M
3300017442\|Ga0182221_1058962	Not Available	699	Open in IMG/M
3300017442\|Ga0182221_1168709	Not Available	504	Open in IMG/M
3300017443\|Ga0182193_1119418	Not Available	599	Open in IMG/M
3300017682\|Ga0182229_1056323	Not Available	668	Open in IMG/M
3300017682\|Ga0182229_1089384	Not Available	540	Open in IMG/M
3300017682\|Ga0182229_1093524	Not Available	530	Open in IMG/M
3300017683\|Ga0182218_1032899	Not Available	802	Open in IMG/M
3300017684\|Ga0182225_1019811	Not Available	936	Open in IMG/M
3300017684\|Ga0182225_1063963	Not Available	647	Open in IMG/M
3300017684\|Ga0182225_1094800	Not Available	574	Open in IMG/M
3300017685\|Ga0182227_1116515	Not Available	533	Open in IMG/M
3300017690\|Ga0182223_1039411	Not Available	689	Open in IMG/M
3300021060\|Ga0182232_1028992	Not Available	949	Open in IMG/M
3300025926\|Ga0207659_11844485	Not Available	513	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.81%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.59%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.40%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.20%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.20%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.21%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.60%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070677_108010801	3300005333	Miscanthus Rhizosphere	MHVENELAEIMTTGDHEFKEIVEEYEEEILMQEEVLEPPLT
Ga0068869_1014010232	3300005334	Miscanthus Rhizosphere	MHLENESAKIVTTDDHEFEEIIEEYEEEILVREEVLEPPMTDSVDTMPT
Ga0105243_113850861	3300009148	Miscanthus Rhizosphere	MHVENELAEIMTVGDHEFEEVIEEYEEEILMQEEVLEPLLTD*
Ga0105246_120566291	3300011119	Miscanthus Rhizosphere	VLHHHHTHVENELAEIMTIGDHELKEVIEEYEEEILVQEEVPEPPLTD*
Ga0157374_120991991	3300013296	Miscanthus Rhizosphere	MHVENELAEIMTIGDHEFEEVIEEYEEEILVQEEVPKPPLID*
Ga0157378_122974461	3300013297	Miscanthus Rhizosphere	MHIENELAEIVTIGDHEFEKVIEEYEEEILVQEEVLEPSLTD*
Ga0182122_10349021	3300015267	Miscanthus Phyllosphere	MHIKNELAEIVTIGDHEFEEVIEEYEEEILVQKEVLEPPLTN*
Ga0182122_10705391	3300015267	Miscanthus Phyllosphere	MHIENELTEIMTIGDHEFEEVIEKYEEEILVQEEVLEPPLTD*
Ga0182154_10443391	3300015268	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEILVQEEVLEAPLTD*
Ga0182154_10706541	3300015268	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIKEYVEEILMQEEVLEPPLTS*
Ga0182154_10710531	3300015268	Miscanthus Phyllosphere	MHVENELVEIVTIGDHEFEVVIKEYEEEILIQEEVLEPPLTD*
Ga0182188_10551111	3300015274	Miscanthus Phyllosphere	MHVENELVEFMTAGEHGYEEVIEEYEEEVLVQEVVLELPLTD*
Ga0182172_10120381	3300015275	Miscanthus Phyllosphere	MHVENELAKIVTIRDHEFEEMIEEYEQEIFMQEEVLEPPLTD*
Ga0182172_10408541	3300015275	Miscanthus Phyllosphere	MHVENELTEIVTIRDHEFKEVTEEYEEEILMQEEVIEPPLTD*
Ga0182172_10436831	3300015275	Miscanthus Phyllosphere	MHVENELVEIVTIRHHKFEEVIEEYEEEILVQEEVPEPSLTD*
Ga0182170_10298782	3300015276	Miscanthus Phyllosphere	LAEIVTTGDHEFEEIVEGYEEEILVQEEVPKPPLTDLADTTPA*
Ga0182170_10379431	3300015276	Miscanthus Phyllosphere	VIENELAEIMTIGDHEFEEVIEEYEEEILVQEEVLELPLTN*
Ga0182170_10730611	3300015276	Miscanthus Phyllosphere	MHVEDELVEIVTIGDHEFKEVIEEYEEEILVQDKVSEPPLTD*
Ga0182128_10563531	3300015277	Miscanthus Phyllosphere	VLHHHRKHVENELAKIVTIGDHEFEAMIEEYEEEILMQEEIPEPPLTD*
Ga0182128_10742211	3300015277	Miscanthus Phyllosphere	VLHHHRMHIENELTEIVTTGDHEFKEIIEEYEEEILVQKESWSRH*
Ga0182174_10032002	3300015279	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIKEYEEEILVQEEVLEPPLTD*
Ga0182174_10076671	3300015279	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIKEYEKKILVQEEVLEPPLTD*
Ga0182160_10228031	3300015281	Miscanthus Phyllosphere	MHIENELTKIVTIGDHEFEEVIEEYKEEILVQEEVPEPPLTD*
Ga0182160_10251291	3300015281	Miscanthus Phyllosphere	VENELAEIVTIGDHKFEEVIEEYEEEILVQEKVLEPPLTN*
Ga0182160_10532351	3300015281	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFDEVIEEYEEEILVQEEVPEPPLID*
Ga0182160_10591401	3300015281	Miscanthus Phyllosphere	MHVENELAEIVAIGDHEFEEVIEEYEEEILMQEEVSEPPLTD*
Ga0182124_10344271	3300015282	Miscanthus Phyllosphere	MHVENELAEIVTTGNHEFEEIVEEYEEKILMQEEVPKTPLTDSADTTHV*
Ga0182124_10580481	3300015282	Miscanthus Phyllosphere	MHIENELTEIMTIGDHEFEEVIEKYEEEILVQEEVLKPPLTD*
Ga0182124_10630471	3300015282	Miscanthus Phyllosphere	MHVENELMEIMTIGDHEFEEVIEEYEEEILVEVPEPPLTD*
Ga0182124_10692031	3300015282	Miscanthus Phyllosphere	MHVENELAEIETTNDCEIEEIVKEYEEIVVQEEVLEPPLTDS
Ga0182124_10728051	3300015282	Miscanthus Phyllosphere	MHVENELAEIVTIGDHKFEEVIEKYEKEILVQEEVPEPPLTN*
Ga0182124_10734312	3300015282	Miscanthus Phyllosphere	MHVENEFTEIMAIGDHEFEEVIEEYEEDILMQEEVPEPPLTD*
Ga0182156_10184701	3300015283	Miscanthus Phyllosphere	MHIENKLAEIMTTGEPEFEEIIKEYEVEILMQEEVLEP
Ga0182156_10227901	3300015283	Miscanthus Phyllosphere	LAEIVTIGDHEFEEIIEEYEEEILVQEEAPELPLTD*
Ga0182156_10242511	3300015283	Miscanthus Phyllosphere	MHIENELAEIVTTDDHEFEKIIEEYEEEILVQEEVPELPL
Ga0182156_10399461	3300015283	Miscanthus Phyllosphere	MHVENELAEIMTTGDHEIEDIIEEYEKEILMKEEVP*
Ga0182156_10731332	3300015283	Miscanthus Phyllosphere	MHVENELVEIVTIGDHEFEEVIKEYEEEILVQEEVPEPLLTN*
Ga0182186_10265971	3300015285	Miscanthus Phyllosphere	MHVENELVEFMTAGEQKYEEVIEEYEEDILVQEEVPELPLID*
Ga0182186_10509251	3300015285	Miscanthus Phyllosphere	MHVENELTEIVTIGDHEFEEVIEEEVPEPPLMTEMTLCLPKASPDA*
Ga0182186_10611301	3300015285	Miscanthus Phyllosphere	MHIENELAEIVTTCEHEFEEIIEDYEEKILMQEEVPEPPLTDSADT
Ga0182186_10824421	3300015285	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEKVIEEYEEEIIVQEEILEPPLID*
Ga0182176_10273611	3300015286	Miscanthus Phyllosphere	MHVENELAEIVITSDHEFEEIVEEYEEKILVQEEVLELP
Ga0182176_10324101	3300015286	Miscanthus Phyllosphere	MHVENELVEIVTTDDHEFEEIIEEYEDEVLVREEVPEPPPTDSVDTAPS*
Ga0182176_10554231	3300015286	Miscanthus Phyllosphere	VENELTEIVTIGDHEFEEVIEEYEEGILVQEEVLEPPLTD*
Ga0182176_10632301	3300015286	Miscanthus Phyllosphere	MHVENELAEIMTIGDHKFEEVIEEYEKEILMKEEVL*
Ga0182173_10415551	3300015288	Miscanthus Phyllosphere	MHVENELAEIVTIRDHEFKDVIEEYKEEILVQEEVPEPPLTN*
Ga0182173_10798001	3300015288	Miscanthus Phyllosphere	MQVENELAEIVIIGDHEFEEVIEEYEEILMQEEVLEPPLTD*
Ga0182138_10284191	3300015289	Miscanthus Phyllosphere	MHVENKLAEIVAIRDHEFEEVIEECKEEILVQEEVLEPSLTD*
Ga0182138_10616331	3300015289	Miscanthus Phyllosphere	MHVENELVEIMTIGDHEFEEVIEEYEEEILAQEEVPEPRLTD*
Ga0182138_10642351	3300015289	Miscanthus Phyllosphere	MHIENEFAGIVTIRDHEFEEVIEEYEEEILVQEKVPEPPLTD*
Ga0182138_10688131	3300015289	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYKEEILMQEEVPEPPLTD*
Ga0182125_10131732	3300015291	Miscanthus Phyllosphere	MHVENELAEIVTTNDHVFEEIVEEYVEEMLVQEEVPKPPLTDSADTAPA*
Ga0182125_10190571	3300015291	Miscanthus Phyllosphere	MHVENELTEIVTIGDHEFEEVIEEYEEEILLQEEVSVPPLTD*
Ga0182125_10693981	3300015291	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEMIEEYEEILVQEVPEPPLTN*
Ga0182141_10343761	3300015292	Miscanthus Phyllosphere	MHIENELVKIMTIGDHEFEEVIEKYEEEILVQEEVPEPSLTD*
Ga0182141_10799602	3300015292	Miscanthus Phyllosphere	MHVDNELAEIMIIGDHEFKVVIKEYEEEILMQEVSEPPLTD*
Ga0182126_10661812	3300015294	Miscanthus Phyllosphere	MHVENELAEVMTIGDHEFEEVIKEYVEEILMQEEVLEPPLTD*
Ga0182175_10420171	3300015295	Miscanthus Phyllosphere	MYVENELAEIVTIGDHEFEEVIEEFEEEILVQEEVPELPLTD*
Ga0182175_10420782	3300015295	Miscanthus Phyllosphere	MHVEKKLAEIVTIGDHEFEEVIEEYEEEILMQEEVPEPPLTD*
Ga0182175_10552001	3300015295	Miscanthus Phyllosphere	MRVENELAEIVTTGNHEFEEIIEEYEEEILVQEEVLEQPLTDL
Ga0182175_10673671	3300015295	Miscanthus Phyllosphere	MHVENELAEIMTIGDHEFKEVIEEYEEEILMQEEVLEPSLTD*
Ga0182175_10949141	3300015295	Miscanthus Phyllosphere	MHVENVLVEFVTASEQEYEEVIEEYEEEILVQAEVLEPPLTD*
Ga0182157_10305132	3300015296	Miscanthus Phyllosphere	MHEENELAEIVTTSDHEFKEIIEEYEEEILVQEKVPEPPLTDSANTMPA*
Ga0182157_10477211	3300015296	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYDEEILVQEEV*
Ga0182157_11018321	3300015296	Miscanthus Phyllosphere	MHVENELVEIVTTSNHKFKEIVEECKEKILVQEEVLEPPLTNSADTAP
Ga0182157_11030041	3300015296	Miscanthus Phyllosphere	MHIENELAEIVTIGDHEFEEVIEEYEEEILVQEKVLEPPLTN*
Ga0182106_10362781	3300015298	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEKILVQEKVLEPPLTD*
Ga0182106_10768651	3300015298	Miscanthus Phyllosphere	MHIENELAEIVTIGDHEFEEVIEEYEEEILMQEEVPEPPLTD*
Ga0182107_10127371	3300015299	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEEILMQEEVPKLPLTD*
Ga0182107_10381331	3300015299	Miscanthus Phyllosphere	MHVENELVEIMTIRDHEFEEVIEEYEEEVLMQEEVPKLPLTD*
Ga0182107_10820121	3300015299	Miscanthus Phyllosphere	MHVENELAEIVTTGDHEFEEIIEEYEEEILMQEEVLEPPLTDAVDTAPA*
Ga0182108_10770392	3300015300	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYKEILVQQEVPEQPLTDLADTPPA*
Ga0182108_10904161	3300015300	Miscanthus Phyllosphere	MHVENELAEIVTTGDHEFEEIVEEYEEEILVQECGRTA*
Ga0182143_10148801	3300015302	Miscanthus Phyllosphere	MHVENKMAGIVTIGDHEFEEVIEEYEEEILMQEEVLEPPLID*
Ga0182143_10312811	3300015302	Miscanthus Phyllosphere	MHVENKLAEIVTIGDHEFEEVIEEYEEEILVQEEVPEPPLTD*
Ga0182143_10587351	3300015302	Miscanthus Phyllosphere	MHVENELVKIMTIRDHKFEEVIEEYEEEILVEVPEPPLTD*
Ga0182143_10753451	3300015302	Miscanthus Phyllosphere	MHVENKLAEIVTIGDHEFEEIIEEYEEEILVQEEIPKPPLTD*
Ga0182123_10458611	3300015303	Miscanthus Phyllosphere	MHVKNKVAEIDTIEDHKFKEVIEEYKEEILMQEEVLEPPLTD*
Ga0182123_10459771	3300015303	Miscanthus Phyllosphere	MHIENELMEIVTIVDHEFEEVIEEYKEKILVQEEVLELPLTD*
Ga0182112_10567321	3300015304	Miscanthus Phyllosphere	MHAENELAKIMIIRDHESEEVIEEYEEEILMQEEV
Ga0182112_10569001	3300015304	Miscanthus Phyllosphere	MHVEIELAEIVTIGDHEFKEVIEEYEEKVLMREEVLEPPLTD*
Ga0182112_10895271	3300015304	Miscanthus Phyllosphere	MHVRNELAEIVTIGNHEFEEWIEEYEEEILMQDEVPKPPLTD*
Ga0182158_10222681	3300015305	Miscanthus Phyllosphere	MHVENELAEVMTIGDHEFEEVIEEYGEEILMQEEVLEPPLTN*
Ga0182158_10348983	3300015305	Miscanthus Phyllosphere	MRVENKLAEIVIVGDHEFKKIIEEYEEEILVQEEVLEPP*
Ga0182158_10506381	3300015305	Miscanthus Phyllosphere	MHVENKLVEIVTTDDHEFEEIIEKYEEEILMREEVLEPPLTDSADTAPA*
Ga0182158_10509901	3300015305	Miscanthus Phyllosphere	MHAKNKLVEIVTIGDHEFEEVIEEYEEVVLEPPLTEQS*
Ga0182158_10575611	3300015305	Miscanthus Phyllosphere	MHIENELAEIVTIGDHKFEEMIGEYEEILVQEEVPE
Ga0182158_10586142	3300015305	Miscanthus Phyllosphere	ELAEIVTIGDHKFEEVIEEYKEEILVQEEVPELPLTD*
Ga0182144_10821861	3300015307	Miscanthus Phyllosphere	MHVENELAEIMTIRDHEFKEVIEEYEEEILMQKEVLEPPLTNSANTAPA*
Ga0182142_10827521	3300015308	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEKVIEEYEEEILVQEEVLEPPLTD*
Ga0182140_10336202	3300015314	Miscanthus Phyllosphere	MHVENELVEIVAIGDHEFEEVIEEYEEKVLLQEEVLEPPLTDS*
Ga0182140_10432272	3300015314	Miscanthus Phyllosphere	MLVENELAEIVAIRDHEFKEVIKEYEEEILMQEEVPEPPRTD*
Ga0182127_10351331	3300015321	Miscanthus Phyllosphere	MHVENELAEIITTGDHEFEEIIEEYEEEILMQEEVLESPLTDSVDSPK*
Ga0182127_10612931	3300015321	Miscanthus Phyllosphere	MHVENELAKIVTIGDHKFKDVIEEYEEEILVQEEVPEPPLT
Ga0182127_11181671	3300015321	Miscanthus Phyllosphere	MHVENELAEIVAIGDHEFEEVIEEYEEEILVQEKVSKPPLTD*
Ga0182110_10261551	3300015322	Miscanthus Phyllosphere	MHVENELAEIMTIGDHELEEIIKEYEEILVQEEVIEPPLTD*
Ga0182110_10641802	3300015322	Miscanthus Phyllosphere	MHVKNELVEIVTIGDHEFEEVIKEYEEEILVQEEVPKPSLTD*
Ga0182110_10859151	3300015322	Miscanthus Phyllosphere	VEIVTIGDHEFEEVIEEYEEEILMQEDVPKPPLTD*
Ga0182110_10884031	3300015322	Miscanthus Phyllosphere	MHVENELAKIVTIGDHEFEEIVEEYENKILVQEEVLEPPLTD*
Ga0182187_10673571	3300015341	Miscanthus Phyllosphere	MHVENELVEIVTIRDHEFEEVIEEYKEEILMQEEVPELPLTD*
Ga0182187_11231991	3300015341	Miscanthus Phyllosphere	MHVENELAEIMTIGDHKFEEIIEEYEEEILMLEEVPEPPLTN*
Ga0182187_11804261	3300015341	Miscanthus Phyllosphere	MHVENVLAEIVTIGDHEFKEVIEEYKEEILVQEEVLKPVLTD*
Ga0182109_11285251	3300015342	Miscanthus Phyllosphere	MHVENELAEIMTIRDHEFKEVIEEYEEEIFMQEEVPEPPLTD*
Ga0182109_11375102	3300015342	Miscanthus Phyllosphere	MRVENELAEIVTIGDHEFKEVIEEYEEEILMQEEVLEPPLTD*
Ga0182109_12091741	3300015342	Miscanthus Phyllosphere	MHVENELTEIMTIGDHEFEEMIEENEEDILMQEVVLEPPLTD*
Ga0182155_11347921	3300015343	Miscanthus Phyllosphere	MHVENELTEIVTTGDHEFEEIVKEYEEEILVQEEVSEPPLTLS*
Ga0182155_12190002	3300015343	Miscanthus Phyllosphere	MHVENELMEIVTIGDHEFEEVIEEYKEEILVQEEVLKPPLTDLADTAPA
Ga0182189_10876281	3300015344	Miscanthus Phyllosphere	MHVENKLAEIVTIGDHKFKEVIEEYEEEILMQEKVSEPPLID*
Ga0182189_11905571	3300015344	Miscanthus Phyllosphere	MHAENKLTEIMTIGDHEFKEVIKEYKVEILLQEEVLEPPLTD*
Ga0182189_12215181	3300015344	Miscanthus Phyllosphere	MHVENELAEIVTIRDHEFKEVVEEYEEKILVQEEIPKLPLTD*
Ga0182111_10256871	3300015345	Miscanthus Phyllosphere	MHVENELAEIVTIKDHEFEEVVEEYEKILVQEEVPEPLQIACL*
Ga0182111_11882681	3300015345	Miscanthus Phyllosphere	MHVENKLVEIVTIRDHEFQEVIEEYEEEILVQKEVLEPPLTD*
Ga0182139_10957962	3300015346	Miscanthus Phyllosphere	ENELAEIMTIGDHEFKELIEEYEEEILMLEKVSEPPLTG*
Ga0182139_11083191	3300015346	Miscanthus Phyllosphere	MHIENELVEIVTTGRHEFKEIIEEYVEKILVQEEVLEPPLTNVDDTAPA*
Ga0182139_11452001	3300015346	Miscanthus Phyllosphere	MHVENELVEIMTIGDHEFEEVIEEYEEDILVQKEVLEPPLID*
Ga0182139_11559961	3300015346	Miscanthus Phyllosphere	VLHHHRMHVENELVEIVTIGDHEFKEVIEEYEEEILVQDKVSEPPLTD*
Ga0182139_11864131	3300015346	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEEILVQEKVLEPPLTN*
Ga0182139_12153002	3300015346	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIKEYEEEVLEPSLTD*
Ga0182177_12261241	3300015347	Miscanthus Phyllosphere	MYVENELAEIVTIGGHEFEEIVEEYEEEILVKEEVPEPPLTDSADTAPA*
Ga0182161_11230211	3300015351	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFKEVIEEYEEKVLMREEVLEPPLTD*
Ga0182161_11537891	3300015351	Miscanthus Phyllosphere	VEIVTIGDHEFDEVIEEYEEDILVQEEVPKPPLTD*
Ga0182159_13266671	3300015355	Miscanthus Phyllosphere	MHVEKELVEIVAIEDHEFKEVIEEYKEEILVQEEVLE
Ga0182159_13414001	3300015355	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFDEVIEEYEEEILVQEEIPEPPLTD*
Ga0182145_10629981	3300015361	Miscanthus Phyllosphere	MHIENKLAEIVTIRDHEFEEVIEEYEEEILVQKEVLEPPLTD*
Ga0182203_10746511	3300017404	Miscanthus Phyllosphere	MHVESELAEIVTIRDHEFKEVIEEYEEEILMQEEVPEPPLTD
Ga0182204_11175061	3300017409	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEEILVQEEVPESPLTDAVDTAPA
Ga0182207_10469051	3300017410	Miscanthus Phyllosphere	MHVENELVEIVTTSDPKFEKIVEEYEEEILVQEEVPEPPLTDS
Ga0182207_10479481	3300017410	Miscanthus Phyllosphere	MHVENELTEIVTTSDCEFEEIVEEYEDEILVQEEVPEPPLTDS
Ga0182207_11096431	3300017410	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVVVEYEEGILVQEEIP
Ga0182207_11775001	3300017410	Miscanthus Phyllosphere	MHIKNESVEIVTIGEHEFEEIVKEYEEKILVQEKIPEPPLTDSADTAPA
Ga0182208_10864691	3300017411	Miscanthus Phyllosphere	MHVENELAKIVTIGDHEFKEMIEEYEEVLEPPLTD
Ga0182208_11109501	3300017411	Miscanthus Phyllosphere	MHVENELAEIMTIEDHEFEKVIKEYEKEILMQEEVPKPPLTD
Ga0182222_10519171	3300017413	Miscanthus Phyllosphere	MYVKNELAEIVITGDHEFMEIVEECEEEILVQEEVPKPPLTDAVDTALV
Ga0182222_10575561	3300017413	Miscanthus Phyllosphere	MYVENELAEIVTIGDHEFEEVIEEYEGEILVQEEVPEVQVTD
Ga0182222_11091721	3300017413	Miscanthus Phyllosphere	MHVENELAEIVTTGDHEFEEIVEEYEEEILVQEEVLEPSLTDLAYTLPAQG
Ga0182202_10767732	3300017415	Miscanthus Phyllosphere	MHVENELAAIVTIEDQEFKEVIEEYEEEILMQEKVH
Ga0182202_11107521	3300017415	Miscanthus Phyllosphere	MHIESELVEFVTMGVQEYEEVIEEYEEEILMQEEVPEPPLTD
Ga0182230_10902482	3300017417	Miscanthus Phyllosphere	LAEIVTIGDHEFEEVIEEYEEEILMQEEVPEPPLTD
Ga0182228_10465281	3300017420	Miscanthus Phyllosphere	LAEIVTIGDHEFEEIIEEYEEEILVQEEVLEPPLTD
Ga0182228_10991411	3300017420	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFKEIVEEYEEEILVQEEVPKSPLAYSADTASV
Ga0182228_11036891	3300017420	Miscanthus Phyllosphere	MLVENELAEIVIIRDHEFEEVIEEYVEEILVQEEVLEPPLTDXADTTPT
Ga0182224_10748071	3300017425	Miscanthus Phyllosphere	MHVQNELAEIVTIGDHEFEKVIEEYEEEILMQEEVLEPPLTDXADTAPAQ
Ga0182224_11171181	3300017425	Miscanthus Phyllosphere	NKSAEIVTTGDHEFEEIVEEYEEEILVQEEVPELPLTNRLS
Ga0182224_11410182	3300017425	Miscanthus Phyllosphere	MHVENELAEIMTIGDHEFEEVIEEYEEVILMWEEVLEPPLTD
Ga0182190_10899691	3300017427	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEEVLMQEEVL
Ga0182190_11264151	3300017427	Miscanthus Phyllosphere	VEIVTIGDHEFDEVIEEYEEDILVQEEVPKPPLTD
Ga0182206_11017711	3300017433	Miscanthus Phyllosphere	MHVENELAEIRTIRDHEFEEVIEEYEDEILVQEEVPKPPLID
Ga0182206_11084281	3300017433	Miscanthus Phyllosphere	MHVENELAEIVTIEDHEFEEIVKEYEEEIVVQKEVPELPLTNSVDTAPA
Ga0182206_11138671	3300017433	Miscanthus Phyllosphere	MHVENELAKIVTIGDHEFEEIVEEYENKILVQEEVLEPPLTN
Ga0182209_10767541	3300017436	Miscanthus Phyllosphere	IENEFAEIVTIGDHKFKEVIEEYEEKILVQEEVLKPPLTN
Ga0182209_10916491	3300017436	Miscanthus Phyllosphere	MHVENELAEIVTIGDHEFEEVIEEYEEEILMQEEVLE
Ga0182191_10996091	3300017438	Miscanthus Phyllosphere	HHHHRVHIENESAEIVTTGEHEFEEIIEEYEEKILVQEEVPKPPLTDAVDTALV
Ga0182221_10589622	3300017442	Miscanthus Phyllosphere	VLHRHCMHVENELAEIVTIGDHEFDEVIEEYEEEMLVQEVPEPSLTD
Ga0182221_11687091	3300017442	Miscanthus Phyllosphere	MHVENELAKIVTIGDHEFKEVIEEHKEVILVQEEVPEPSLTG
Ga0182193_11194181	3300017443	Miscanthus Phyllosphere	MHVENELAEIVTTGDHEFEEYEKEILVQEKVLEPPLTDSADTA
Ga0182229_10563232	3300017682	Miscanthus Phyllosphere	MHVENELAEIVTIGDHKFEEVIEEYEEEILVQEEVLEPPLTD
Ga0182229_10893841	3300017682	Miscanthus Phyllosphere	MHVENKLTEIVAIGDHKFEEVIEEYEEEVLVQEVLEPPPTD
Ga0182229_10935241	3300017682	Miscanthus Phyllosphere	LSKCQVLHHHCMHVENELAKIVTIGDHEFEEVIEEYKEKILVQEEIPKPSLTD
Ga0182218_10328992	3300017683	Miscanthus Phyllosphere	MHVENELVEIVAIGDHEFEEVIEEYEEEILVQEKVLEPPLTN
Ga0182225_10198111	3300017684	Miscanthus Phyllosphere	MHVENELAEVVTIGDHEFEEVIKEYVEEILMQEEVLEPPLTSXADTLPV
Ga0182225_10639632	3300017684	Miscanthus Phyllosphere	PHMHIENESAKIVTTGDHKFEEIIEDYKEILVQEEILEPPLTD
Ga0182225_10948001	3300017684	Miscanthus Phyllosphere	MHVENELAEIMTIGDHEFEEVIEEYEEEILMQEEVLEPLLTD
Ga0182227_11165151	3300017685	Miscanthus Phyllosphere	MHVENELVEIVTIRHHKFEEVIEEYEEEILVQEEVPELPLTD
Ga0182223_10249161	3300017690	Miscanthus Phyllosphere	MHVENELVEIVTTDDHEFEKIVEEYEEILMQEEVPEPPPTDSPDTAPA
Ga0182223_10394111	3300017690	Miscanthus Phyllosphere	MHVENELVEIVTTDDHEFEEIIKEYEEEVLVREEVPEPPLTD
Ga0182232_10289921	3300021060	Phyllosphere	MHIENESAEIVTTGEHEFEEIIEEYEEKILVQEEVPKPPLTDAVDTALV
Ga0207659_118444851	3300025926	Miscanthus Rhizosphere	MHVENELAEIVTTGDREFEEIVEECEEEILVYEEVPEPPLTDSADTESA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F037544

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign