Metagenome / Metatranscriptome Family F037639

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F037639
Family Type	Metagenome / Metatranscriptome
Number of Sequences	167
Average Sequence Length	40 residues
Representative Sequence	YQGIDTSFLVATLTAAIQEQQALITQLTARITALEGA
Number of Associated Samples	127
Number of Associated Scaffolds	167

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	1.89 %
% of genes near scaffold ends (potentially truncated)	92.81 %
% of genes from short scaffolds (< 2000 bps)	88.02 %
Associated GOLD sequencing projects	119
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (47.305 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.946 % of family members)
Environment Ontology (ENVO)	Unclassified (61.677 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (62.874 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 167 Family Scaffolds
PF13392	HNH_3	5.39
PF07460	NUMOD3	1.80
PF13884	Peptidase_S74	1.80
PF01541	GIY-YIG	0.60
PF11649	T4_neck-protein	0.60
PF00959	Phage_lysozyme	0.60
PF01391	Collagen	0.60
PF00182	Glyco_hydro_19	0.60
PF05065	Phage_capsid	0.60
PF16080	Phage_holin_2_3	0.60
PF10746	Phage_holin_2_2	0.60
PF09374	PG_binding_3	0.60
PF00386	C1q	0.60
PF09636	XkdW	0.60

COG ID	Name	Functional Category	% Frequency in 167 Family Scaffolds
COG3179	Chitinase, GH19 family	Carbohydrate transport and metabolism [G]	0.60
COG3979	Chitodextrinase	Carbohydrate transport and metabolism [G]	0.60
COG4653	Predicted phage phi-C31 gp36 major capsid-like protein	Mobilome: prophages, transposons [X]	0.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.28 %
Unclassified	root	N/A	37.72 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	53.89 %
Unclassified	root	N/A	37.72 %
cellular organisms	root	All Organisms → cellular organisms	8.38 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	47.31 %
Unclassified	root	N/A	37.72 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	8.38 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	47.31 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.59 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.40 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.60 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	47.31 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.80 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.20 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	47.31 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.20 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.60 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.60 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.60 %
Moraxellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales	0.60 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	46.11 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	0.60 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	0.60 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.60 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.60 %
Moraxellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae	0.60 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.60 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.11 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.60 %
Roseobacter phage CRP-1	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1	0.60 %
Acinetobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter	0.60 %
Streptococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae	0.60 %
unclassified Methylococcaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae	0.60 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.60 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.11 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Methylococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	0.60 %
Lactococcus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Lactococcus	0.60 %
Acinetobacter junii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter junii	0.60 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.60 %
Roseobacter phage CRP-1	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1	0.60 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.60 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	46.11 %
Unclassified	root	N/A	37.72 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.39 %
Lactococcus raffinolactis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Lactococcus → Lactococcus raffinolactis	0.60 %
Methylococcaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	0.60 %
Acinetobacter junii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter junii	0.60 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.60 %
Roseobacter phage CRP-1	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1	0.60 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.60 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.60 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000517\|PR_CR_10_Liq_3_inCRDRAFT_1047147	Not Available	593	Open in IMG/M
3300001605\|Draft_10208808	Not Available	1169	Open in IMG/M
3300001605\|Draft_10390145	Not Available	740	Open in IMG/M
3300001842\|RCM30_1107051	Not Available	528	Open in IMG/M
3300002138\|M3t6FKB1_1396566	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38629	Open in IMG/M
3300002408\|B570J29032_109612691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	937	Open in IMG/M
3300002930\|Water_104205	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2270	Open in IMG/M
3300003393\|JGI25909J50240_1121425	Not Available	515	Open in IMG/M
3300004095\|Ga0007829_10053223	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	786	Open in IMG/M
3300004128\|Ga0066180_10172107	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300004774\|Ga0007794_10066821	All Organisms → Viruses → Predicted Viral	1071	Open in IMG/M
3300004802\|Ga0007801_10158650	Not Available	644	Open in IMG/M
3300005580\|Ga0049083_10072959	All Organisms → cellular organisms → Bacteria	1201	Open in IMG/M
3300005585\|Ga0049084_10256730	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	586	Open in IMG/M
3300006109\|Ga0007870_1118450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Lactococcus → Lactococcus raffinolactis	517	Open in IMG/M
3300006115\|Ga0007816_1017880	All Organisms → cellular organisms → Bacteria	1665	Open in IMG/M
3300006122\|Ga0007837_1063184	Not Available	627	Open in IMG/M
3300006802\|Ga0070749_10026399	All Organisms → Viruses → Predicted Viral	3648	Open in IMG/M
3300006805\|Ga0075464_10766878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	598	Open in IMG/M
3300006863\|Ga0075459_1096812	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	507	Open in IMG/M
3300006875\|Ga0075473_10324387	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	623	Open in IMG/M
3300006947\|Ga0075444_10412360	Not Available	506	Open in IMG/M
3300007538\|Ga0099851_1308972	Not Available	557	Open in IMG/M
3300007597\|Ga0102919_1061124	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1178	Open in IMG/M
3300007640\|Ga0070751_1220614	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	730	Open in IMG/M
3300007974\|Ga0105747_1214213	Not Available	638	Open in IMG/M
3300007992\|Ga0105748_10339041	Not Available	642	Open in IMG/M
3300008259\|Ga0114841_1269055	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300008267\|Ga0114364_1048951	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1528	Open in IMG/M
3300008267\|Ga0114364_1104123	Not Available	877	Open in IMG/M
3300008448\|Ga0114876_1024486	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3058	Open in IMG/M
3300008448\|Ga0114876_1050954	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1869	Open in IMG/M
3300008450\|Ga0114880_1011484	All Organisms → Viruses → Predicted Viral	4350	Open in IMG/M
3300009068\|Ga0114973_10444370	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	675	Open in IMG/M
3300009081\|Ga0105098_10769191	Not Available	517	Open in IMG/M
3300009151\|Ga0114962_10349913	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	811	Open in IMG/M
3300009151\|Ga0114962_10482396	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	658	Open in IMG/M
3300009155\|Ga0114968_10004132	Not Available	10822	Open in IMG/M
3300009159\|Ga0114978_10535687	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	683	Open in IMG/M
3300009160\|Ga0114981_10742858	Not Available	518	Open in IMG/M
3300009161\|Ga0114966_10241025	Not Available	1122	Open in IMG/M
3300009161\|Ga0114966_10512263	Not Available	682	Open in IMG/M
3300009164\|Ga0114975_10607432	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	583	Open in IMG/M
3300009170\|Ga0105096_10460754	Not Available	659	Open in IMG/M
3300009180\|Ga0114979_10441750	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	757	Open in IMG/M
3300009684\|Ga0114958_10265616	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	845	Open in IMG/M
3300010160\|Ga0114967_10477894	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	612	Open in IMG/M
3300010354\|Ga0129333_10140118	Not Available	2222	Open in IMG/M
3300010374\|Ga0114986_1051397	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	747	Open in IMG/M
3300010885\|Ga0133913_12734511	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1192	Open in IMG/M
3300012012\|Ga0153799_1085979	Not Available	563	Open in IMG/M
3300013005\|Ga0164292_10981706	Not Available	528	Open in IMG/M
3300013086\|Ga0163202_1155572	Not Available	505	Open in IMG/M
3300013372\|Ga0177922_11103500	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	546	Open in IMG/M
3300014811\|Ga0119960_1043587	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	715	Open in IMG/M
3300015050\|Ga0181338_1040062	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	698	Open in IMG/M
3300017716\|Ga0181350_1129958	Not Available	599	Open in IMG/M
3300017722\|Ga0181347_1118918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → unclassified Methylococcaceae → Methylococcaceae bacterium	740	Open in IMG/M
3300017722\|Ga0181347_1150195	Not Available	636	Open in IMG/M
3300017723\|Ga0181362_1020476	Not Available	1422	Open in IMG/M
3300017723\|Ga0181362_1054882	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	825	Open in IMG/M
3300017736\|Ga0181365_1126665	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	611	Open in IMG/M
3300017754\|Ga0181344_1133605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	711	Open in IMG/M
3300017754\|Ga0181344_1141362	Not Available	688	Open in IMG/M
3300017761\|Ga0181356_1247331	Not Available	509	Open in IMG/M
3300017761\|Ga0181356_1249263	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	506	Open in IMG/M
3300017774\|Ga0181358_1109535	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	981	Open in IMG/M
3300017774\|Ga0181358_1228123	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	595	Open in IMG/M
3300017774\|Ga0181358_1271808	Not Available	526	Open in IMG/M
3300017777\|Ga0181357_1146934	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	871	Open in IMG/M
3300017777\|Ga0181357_1276818	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	576	Open in IMG/M
3300017777\|Ga0181357_1303765	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	541	Open in IMG/M
3300017777\|Ga0181357_1332311	Not Available	509	Open in IMG/M
3300017778\|Ga0181349_1204138	Not Available	681	Open in IMG/M
3300017778\|Ga0181349_1209708	All Organisms → Viruses	669	Open in IMG/M
3300017780\|Ga0181346_1022799	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	2625	Open in IMG/M
3300017780\|Ga0181346_1243097	Not Available	632	Open in IMG/M
3300017780\|Ga0181346_1333129	Not Available	507	Open in IMG/M
3300017784\|Ga0181348_1177594	Not Available	778	Open in IMG/M
3300017784\|Ga0181348_1220697	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	669	Open in IMG/M
3300017784\|Ga0181348_1231329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	648	Open in IMG/M
3300017784\|Ga0181348_1242031	Not Available	628	Open in IMG/M
3300017784\|Ga0181348_1272177	Not Available	577	Open in IMG/M
3300017785\|Ga0181355_1167970	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	878	Open in IMG/M
3300017785\|Ga0181355_1353844	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	539	Open in IMG/M
3300019784\|Ga0181359_1098711	All Organisms → Viruses → Predicted Viral	1073	Open in IMG/M
3300020714\|Ga0214182_1032392	Not Available	720	Open in IMG/M
3300021137\|Ga0214165_1096747	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	569	Open in IMG/M
3300021961\|Ga0222714_10060418	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-1	2567	Open in IMG/M
3300021963\|Ga0222712_10405898	Not Available	827	Open in IMG/M
3300021963\|Ga0222712_10420086	Not Available	808	Open in IMG/M
3300022179\|Ga0181353_1071653	Not Available	884	Open in IMG/M
3300022190\|Ga0181354_1205611	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	584	Open in IMG/M
3300022198\|Ga0196905_1153740	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	591	Open in IMG/M
3300022407\|Ga0181351_1246234	Not Available	560	Open in IMG/M
3300022407\|Ga0181351_1253783	Not Available	545	Open in IMG/M
(restricted) 3300023210\|Ga0233412_10137852	Not Available	1040	Open in IMG/M
3300024343\|Ga0244777_10378653	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	884	Open in IMG/M
3300024555\|Ga0255280_1125689	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	504	Open in IMG/M
3300025369\|Ga0208382_1029795	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	686	Open in IMG/M
3300025417\|Ga0208616_1045324	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	640	Open in IMG/M
3300025423\|Ga0208746_1024342	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1061	Open in IMG/M
3300025635\|Ga0208147_1074683	Not Available	842	Open in IMG/M
3300025636\|Ga0209136_1163265	All Organisms → Viruses	574	Open in IMG/M
3300025732\|Ga0208784_1200292	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter junii	582	Open in IMG/M
3300025744\|Ga0255245_1016776	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	918	Open in IMG/M
3300025896\|Ga0208916_10217278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	828	Open in IMG/M
3300026572\|Ga0255270_1056197	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1002	Open in IMG/M
3300027193\|Ga0208800_1055379	Not Available	539	Open in IMG/M
3300027601\|Ga0255079_1106320	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	551	Open in IMG/M
3300027621\|Ga0208951_1096164	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	812	Open in IMG/M
3300027649\|Ga0208960_1073058	All Organisms → cellular organisms → Bacteria → Proteobacteria	1001	Open in IMG/M
3300027733\|Ga0209297_1021799	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3039	Open in IMG/M
3300027733\|Ga0209297_1250540	Not Available	679	Open in IMG/M
3300027749\|Ga0209084_1369910	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300027785\|Ga0209246_10161092	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	881	Open in IMG/M
3300027798\|Ga0209353_10121756	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1173	Open in IMG/M
3300027798\|Ga0209353_10344370	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	623	Open in IMG/M
3300027798\|Ga0209353_10347046	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	620	Open in IMG/M
3300027798\|Ga0209353_10390730	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	573	Open in IMG/M
3300028025\|Ga0247723_1044137	All Organisms → Viruses → Predicted Viral	1308	Open in IMG/M
3300028108\|Ga0256305_1101860	Not Available	693	Open in IMG/M
3300028392\|Ga0304729_1051552	All Organisms → Viruses → Predicted Viral	1544	Open in IMG/M
3300028393\|Ga0304728_1186060	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	730	Open in IMG/M
3300028393\|Ga0304728_1273061	Not Available	557	Open in IMG/M
3300028394\|Ga0304730_1252152	Not Available	635	Open in IMG/M
3300031673\|Ga0307377_10551517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	832	Open in IMG/M
3300031707\|Ga0315291_11100690	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	659	Open in IMG/M
3300031746\|Ga0315293_11168097	Not Available	537	Open in IMG/M
3300031758\|Ga0315907_10065627	All Organisms → Viruses → Predicted Viral	3156	Open in IMG/M
3300031857\|Ga0315909_10435025	Not Available	928	Open in IMG/M
3300031885\|Ga0315285_10283957	All Organisms → Viruses → Predicted Viral	1253	Open in IMG/M
3300031951\|Ga0315904_10436986	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1174	Open in IMG/M
3300031951\|Ga0315904_11454982	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	508	Open in IMG/M
3300031952\|Ga0315294_10598989	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	987	Open in IMG/M
3300031952\|Ga0315294_10718028	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	874	Open in IMG/M
3300031952\|Ga0315294_11621393	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	500	Open in IMG/M
3300032117\|Ga0316218_1144385	Not Available	892	Open in IMG/M
3300032156\|Ga0315295_10668278	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1050	Open in IMG/M
3300032156\|Ga0315295_11488809	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	653	Open in IMG/M
3300032173\|Ga0315268_12680775	Not Available	512	Open in IMG/M
3300032275\|Ga0315270_10250375	All Organisms → Viruses → Predicted Viral	1099	Open in IMG/M
3300032401\|Ga0315275_12444553	Not Available	542	Open in IMG/M
3300032401\|Ga0315275_12568806	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	526	Open in IMG/M
3300032516\|Ga0315273_11658273	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	777	Open in IMG/M
3300033557\|Ga0316617_102777835	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	510	Open in IMG/M
3300033996\|Ga0334979_0607902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	580	Open in IMG/M
3300034018\|Ga0334985_0231756	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1198	Open in IMG/M
3300034068\|Ga0334990_0558453	Not Available	605	Open in IMG/M
3300034092\|Ga0335010_0312454	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	896	Open in IMG/M
3300034101\|Ga0335027_0574321	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	692	Open in IMG/M
3300034104\|Ga0335031_0481808	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	759	Open in IMG/M
3300034112\|Ga0335066_0336513	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	842	Open in IMG/M
3300034117\|Ga0335033_0426679	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	649	Open in IMG/M
3300034118\|Ga0335053_0066576	All Organisms → cellular organisms → Bacteria → Proteobacteria	2539	Open in IMG/M
3300034119\|Ga0335054_0441762	Not Available	737	Open in IMG/M
3300034119\|Ga0335054_0530398	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	654	Open in IMG/M
3300034121\|Ga0335058_0238189	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1061	Open in IMG/M
3300034283\|Ga0335007_0228221	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1271	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.80%
Engineered	Engineered	1.20%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	96.41%
Terrestrial	Environmental → Terrestrial	2.40%
Wastewater	Engineered → Wastewater	1.20%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	81.44%
Marine	Environmental → Aquatic → Marine	14.37%
Soil	Environmental → Terrestrial → Soil	1.20%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.20%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	1.20%
Unclassified	Environmental → Aquatic → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	38.92%
Lake	Environmental → Aquatic → Freshwater → Lake	34.13%
Coastal	Environmental → Aquatic → Marine → Coastal	7.78%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	3.59%
River	Environmental → Aquatic → Freshwater → River	2.99%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.99%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.99%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.20%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.20%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	1.20%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.60%
Inlet	Environmental → Aquatic → Marine → Inlet	0.60%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.60%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.60%
Clay	Environmental → Terrestrial → Soil → Clay	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	35.93%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	26.35%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	7.78%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	7.78%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	3.59%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.40%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.99%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.99%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	1.80%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.20%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.20%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.20%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	1.20%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.60%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.60%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.60%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	26.95%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	11.98%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	8.98%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	7.78%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	6.59%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	5.99%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.40%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.40%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	2.99%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.99%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	1.80%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.80%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.80%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.80%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.20%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	1.20%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.20%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	1.20%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	1.20%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.60%
Aquatic	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic	0.60%
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	0.60%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.60%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.60%
Estuary Water	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water	0.60%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	0.60%
Enviromental	Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental	0.60%
Marine	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine	0.60%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.60%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.60%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000517	Marine microbial community from Cabo Rojo, Puerto Rico - PR CR 10% Liquid 3	Environmental	Open in IMG/M
3300001605	Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin	Engineered	Open in IMG/M
3300001842	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b	Environmental	Open in IMG/M
3300002138	M3t6FKB1 (102f)	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300002930	Estuary water microbial communities from Pearl Estuary, Zhujiang, China	Environmental	Open in IMG/M
3300003393	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD	Environmental	Open in IMG/M
3300004095	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09	Environmental	Open in IMG/M
3300004128	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)	Environmental	Open in IMG/M
3300004774	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M	Environmental	Open in IMG/M
3300004802	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300006109	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08	Environmental	Open in IMG/M
3300006115	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09	Environmental	Open in IMG/M
3300006122	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07	Environmental	Open in IMG/M
3300006128	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07	Environmental	Open in IMG/M
3300006802	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006863	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA	Environmental	Open in IMG/M
3300006875	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA	Environmental	Open in IMG/M
3300006947	Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007597	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02	Environmental	Open in IMG/M
3300007640	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28	Environmental	Open in IMG/M
3300007974	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um	Environmental	Open in IMG/M
3300007992	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008267	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009684	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010374	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012012	Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013086	Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014811	Aquatic viral communities from ballast water - Michigan State University - AB_ballast water	Environmental	Open in IMG/M
3300015050	Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020714	Freshwater microbial communities from Trout Bog Lake, WI - 14NOV2007 epilimnion	Environmental	Open in IMG/M
3300021137	Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion	Environmental	Open in IMG/M
3300021142	Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022198	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300023210 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024555	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025369	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)	Environmental	Open in IMG/M
3300025417	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes)	Environmental	Open in IMG/M
3300025423	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes)	Environmental	Open in IMG/M
3300025635	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025636	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)	Environmental	Open in IMG/M
3300025732	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025744	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026572	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027193	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)	Environmental	Open in IMG/M
3300027601	Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h	Environmental	Open in IMG/M
3300027621	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)	Environmental	Open in IMG/M
3300027649	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028108	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028392	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)	Environmental	Open in IMG/M
3300028393	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031673	Soil microbial communities from Risofladan, Vaasa, Finland - TR-3	Environmental	Open in IMG/M
3300031707	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20	Environmental	Open in IMG/M
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031885	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300032117	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003	Environmental	Open in IMG/M
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental	Open in IMG/M
3300032173	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034068	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034104	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120	Environmental	Open in IMG/M
3300034112	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M
3300034118	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165	Environmental	Open in IMG/M
3300034119	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166	Environmental	Open in IMG/M
3300034121	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174	Environmental	Open in IMG/M
3300034283	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
PR_CR_10_Liq_3_inCRDRAFT_10471473	3300000517	Enviromental	IDPSKIVATLTAAIQEQQAQIEALQAEVQALKDKA*
Draft_102088081	3300001605	Hydrocarbon Resource Environments	KDEVDAEGKPKYQGVDTSFLVATLTAAIQEQQVLIDQLKGRLDAANL*
Draft_103901452	3300001605	Hydrocarbon Resource Environments	AVDADGKPQYQGIDVSFLVATLTAAIQEQQALITQLQADVAALKAK*
RCM30_11070511	3300001842	Marine Plankton	PKYQGIDTSFLVATLTAALQEMKAIIDDQAARIQALENK*
M3t6FKB1_139656624	3300002138	Marine	MLPRYQGIDTSFLVATLTAAIQEQQAIITALTTRITALEAK*
B570J29032_1096126913	3300002408	Freshwater	GKPQYQGIDTSFLVATLTAAIQELKAIVDAQAVRIAALEIK*
B570J40625_1005133544	3300002835	Freshwater	KPQYQGIDTSFLVATLTAAIQELKAIVDAQAVRIAALEIK*
Water_1042055	3300002930	Estuary Water	DKDGKPVYQGMDTSHLVATLVAAIQEQQALIESLTTRLTALENK*
JGI25909J50240_11214252	3300003393	Freshwater Lake	GNIKPQGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL*
Ga0007829_100532233	3300004095	Freshwater	NEDGTPKYQGVDTSFLVATLTAAIQEQQALITDLQARLTKAGL*
Ga0066180_101721072	3300004128	Freshwater Lake	AVDDEGNPKYQGIDTSFLVATLTAAIKEQQALITQLTERITALEAK*
Ga0007794_100668213	3300004774	Freshwater	NPQYQGIDTSFLVATLTCAIQELKAIIDLQATRISALESKIV*
Ga0007801_101586501	3300004802	Freshwater	IRPQGVDTAKLVAILVAAMQEQQAVIEALIARIVALESK*
Ga0049083_100729593	3300005580	Freshwater Lentic	QGIDTSFLVATLTAAIQEQQALITALTTRITALENNNATQ*
Ga0049084_102567302	3300005585	Freshwater Lentic	TSFLVATLTAAIQEQQALITQLQTQITALNAKVGI*
Ga0007870_11184502	3300006109	Freshwater	QGIDTSYLVATLTAAIQEQQALITDLQARLTKAGL*
Ga0007816_10178804	3300006115	Freshwater	DGKPIYQGVDTSFLVATLTAAIQEQQTIINDLKARITALEGAK*
Ga0007837_10631843	3300006122	Freshwater	YQGVDTSFLVATLTAAIQEQQALITDLQARLTKAGL*
Ga0007828_10767942	3300006128	Freshwater	KPVYQGIDTSFLVATLTSAIQELNTLVNAQAAEITALKAKVGV*
Ga0070749_100263991	3300006802	Aqueous	QGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL*
Ga0075464_107668781	3300006805	Aqueous	KDGIDAHGNPDYQGVDASFLIATLTAAIQEQQALIEELKTRVTALENT*
Ga0075459_10968121	3300006863	Aqueous	IDTSFLVATLTAAIKEQQAMIQEQSATIASLTARIEALEAA*
Ga0075473_103243873	3300006875	Aqueous	GNPKYQGIDTSFLIATLTAAIKELKEIVDTQAAKIAVLEQA*
Ga0075444_104123602	3300006947	Marine	KHQGVDTSFLVATLTAAIQEQQVIIEALTTRITALEG*
Ga0099851_13089721	3300007538	Aqueous	QYQGIDTSFLVATITAAIQEQQAIIESLKARLDAANL*
Ga0102919_10611242	3300007597	Estuarine	YQGVDTSFLVATLTKAIQEQQALIESLTTRLTALEGK*
Ga0070751_12206141	3300007640	Aqueous	PQYQGVDTSFLVATLTAAIQELKAENDALKARLDAANL*
Ga0105747_12142131	3300007974	Estuary Water	PVYQGIDVSFLVATLTAAIQEQQALIVSLTARIATLEAK*
Ga0105748_103390411	3300007992	Estuary Water	QSVDTSFLVATLVSAIQEQQALIESLTTRLTALESK*
Ga0114841_12690552	3300008259	Freshwater, Plankton	DTSFLVATLTAAIQEQQALITQLQADVAELKGRP*
Ga0114364_10489511	3300008267	Freshwater, Plankton	MGTRTVPSYQGVDTSFLIATLTAAIQEQQALITALTTRITALEAA*
Ga0114364_11041235	3300008267	Freshwater, Plankton	PQGIDTSFLVATLTAAIQEQQALITQLTARITALESA*
Ga0114876_10244867	3300008448	Freshwater Lake	VPQGIDTSFLVATLTAAIQEQQALITSLTARIAALEGATQ*
Ga0114876_10509541	3300008448	Freshwater Lake	QGIDTSFLVATLTAAIQEQQALIAALQADVAALKGAQA*
Ga0114880_101148411	3300008450	Freshwater Lake	GIDTSFLVATLTAALQEAHSLIKNLETRISALEAK*
Ga0114880_10616954	3300008450	Freshwater Lake	YQGIDTSFLSATLAAAIQELHQIVQAQAAEIAELKANLP*
Ga0114973_104443701	3300009068	Freshwater Lake	GKPIYQGIDTNCVVTSLTAAIQEQQALITSLTARITALEST*
Ga0105098_107691913	3300009081	Freshwater Sediment	VDTSFLVATLTAAIQEQQAIITQLQADVAALKAAA*
Ga0114962_103499131	3300009151	Freshwater Lake	QGVDTSFLVATLTAAIQEQQALITSLTARITALEAR*
Ga0114962_104823961	3300009151	Freshwater Lake	VDAEGNPQYQGIDTSFLVATLTAAIQEQQAFITSLTTRITALENK*
Ga0114968_100041321	3300009155	Freshwater Lake	PKYQGMDTSHLVATLVSAIQEQQALIESLTTRLTALENK*
Ga0114978_105356871	3300009159	Freshwater Lake	YQGIDTSFLVATLTAAIQEQQALIQDLTTRLAALEAK*
Ga0114981_107428583	3300009160	Freshwater Lake	HQGVDTSFLVATLTAAIQEQQALIESLTTRLTALENK*
Ga0114966_102410254	3300009161	Freshwater Lake	YQGIDTSFLVATLTAAIQEQQTLIESLTARLTALENK*
Ga0114966_105122631	3300009161	Freshwater Lake	GIDTSFLVATLTAAIQEQQAIIENLTTRLVALEAK*
Ga0114975_106074323	3300009164	Freshwater Lake	DGSPKHQGIDTSFLVATLTAAIQEQQALITSLTARITALEAK*
Ga0105096_104607541	3300009170	Freshwater Sediment	QGIDVSFLVATLTAAIQEQQAIIESLKARLDAANL*
Ga0114979_104417501	3300009180	Freshwater Lake	KDGNPKYQGIDTSFLVATLTAAIQEQQTLITQLTARITALESA*
Ga0114958_102656163	3300009684	Freshwater Lake	SIKSQGIDTSFLVATLTAAIQEQQALIQSLTDRVAQLEAK*
Ga0114967_104778941	3300010160	Freshwater Lake	YQGIDTSFLVATLTAAIQEQQALITQLTARITALEGA*
Ga0129333_101401181	3300010354	Freshwater To Marine Saline Gradient	DAEGKPQYQGIDTSFLVATLTAAIKEQQAIIEQLTTRITALEAK*
Ga0114986_10513973	3300010374	Deep Subsurface	QGIDTSFLVATLTAAIQEQQTIIESLKARLDAANL*
Ga0133913_127345111	3300010885	Freshwater Lake	QGIDTSFLVATLTAAIQEQQALITSLTARITALEGA*
Ga0153799_10859791	3300012012	Freshwater	GIDTSFLVATLTAAIQEQQAMIEELKAKVVALEGAA*
Ga0164292_109817061	3300013005	Freshwater	PQYQGIDTSFLVATLTAAIQEQQALITALTARITALENK*
Ga0163202_11555722	3300013086	Freshwater	AVDEKGDPKYQQVDVSFLVATLTAAIQEQQALITALTARITALENKT*
Ga0177922_111035003	3300013372	Freshwater	FLVATLTAAIQEQQALITSLTTRITALEGANNGS*
Ga0119960_10435871	3300014811	Aquatic	MGEREVPKYQGIDTSFLVATLTAAIQEQQAIITALTTRITAL
Ga0181338_10400621	3300015050	Freshwater Lake	NGQEFIVPQGIDTSFLVATLTAAIQEQQALIQSLKARLDAANL*
Ga0181350_11299581	3300017716	Freshwater Lake	IDTSFLVATLTAAIQEQQALITQLQADVASLKGASA
Ga0181347_11189181	3300017722	Freshwater Lake	KYQGIDTSFLVATLTAAIQEQQALITQLQADVAALKAQ
Ga0181347_11501953	3300017722	Freshwater Lake	GDIKSQGIDTSFLVATLTAAIQEQQALITALTTRITALENN
Ga0181362_10204761	3300017723	Freshwater Lake	TKIKPQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA
Ga0181362_10407831	3300017723	Freshwater Lake	QHQGIDTSFLVATLTAAIQELKAVVDAQAARITALESAP
Ga0181362_10548821	3300017723	Freshwater Lake	NEQTRPNYQGIDTSFLVATLTAAIQELKAEVDSLKAQINGASA
Ga0181365_11266652	3300017736	Freshwater Lake	DTSFLVATLTAAIQEQQALITSLTARIAALEGTPA
Ga0181344_11336051	3300017754	Freshwater Lake	KQGVDSSFLVATLTAAIQEQQALIVALTARIDALEAK
Ga0181344_11413623	3300017754	Freshwater Lake	DAEGNPEYQGIDTSFLVATLTAAIQEQQAIINDLKARIETLESK
Ga0181356_12473312	3300017761	Freshwater Lake	DADGNPAYQGIDTSFLVATLTAAIQEQQALITSLTARIVALELT
Ga0181356_12492633	3300017761	Freshwater Lake	TPKYQGIDTSFLVATLTAAIQEQQAIILSLKARLDAANL
Ga0181358_10023701	3300017774	Freshwater Lake	TKIKPQGIDTSFLVATLTAAIQELKAIVDTQAARITALEAA
Ga0181358_11095351	3300017774	Freshwater Lake	VDAEGKPKYQGIDTSFLVATLTAAIQEQQALITQLQTQITALNAKVGI
Ga0181358_12281233	3300017774	Freshwater Lake	IHQGIDTSFLVATLTAAIQEQQALITALTARITALESI
Ga0181358_12718081	3300017774	Freshwater Lake	VNAEGNSEYQGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA
Ga0181357_11469344	3300017777	Freshwater Lake	SIKPQGIDTSFLVATLTAAIQEQQALITQLTARITALESA
Ga0181357_12768181	3300017777	Freshwater Lake	RPIHQGIDTSFLVATLTAAIQEQQALITALTARITALESI
Ga0181357_13037652	3300017777	Freshwater Lake	RYQGIDVSFLVATLTAAIQEQQALITSLTARIAALEA
Ga0181357_13323111	3300017777	Freshwater Lake	SEYQGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA
Ga0181349_12041381	3300017778	Freshwater Lake	RQGVDTSFLVATLTAAIQEQQALITQLTARITALETP
Ga0181349_12097083	3300017778	Freshwater Lake	VDTSFLVATLTAAIQEQQAIINALEARLTALEAKP
Ga0181346_10227991	3300017780	Freshwater Lake	AVDAEGNPRYQGVDTSFLVATLTAAIQEQQALITQLTARITALEAA
Ga0181346_12430971	3300017780	Freshwater Lake	NGDIKSQGIDTSFLVATLTAAIQEQQALITALTTRITALENN
Ga0181346_13331292	3300017780	Freshwater Lake	PKYQGVDTSFLVATLTAAIQEQQALITSLTARITALEGA
Ga0181348_11775941	3300017784	Freshwater Lake	GSIKSQGIDTSFLVAILTAAMQEQQALITQLTARITALETS
Ga0181348_12206973	3300017784	Freshwater Lake	GSIKPQGIDTSFLVATLTAAIQEQQALITQLTARITALESA
Ga0181348_12313291	3300017784	Freshwater Lake	TGTEVRPIHQGIDTSFLVATLTAAIQEQQALITALTARITALESI
Ga0181348_12420312	3300017784	Freshwater Lake	KPQGIDTSFLVATLTAAIQEQQALITSLTARITALEGA
Ga0181348_12721771	3300017784	Freshwater Lake	KPRYQGVDTSFLVATLTAAIQEQQVMINELMAKVAALESK
Ga0181355_11679702	3300017785	Freshwater Lake	GVDTSFSVATVVKGMQEQQAIIATLEARIAALEAK
Ga0181355_13538442	3300017785	Freshwater Lake	GNPQYQGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA
Ga0181359_10987113	3300019784	Freshwater Lake	QGIDTSFLVATLTAAIQEQQALITALTTRITALEGAAA
Ga0214182_10323921	3300020714	Freshwater	GIDTSFLVATLTAAIQEQQALITDLTTRLTALEGK
Ga0214165_10967471	3300021137	Freshwater	EGKPIYQGIDTSFLVATLTAAIQEQQAIITDLKTRIETLEAK
Ga0214192_11028561	3300021142	Freshwater	VDDEGNPKYQGIDTSFLVATLVSAIQEQQAIIEQLKTKIL
Ga0222714_100604185	3300021961	Estuarine Water	AEGNPLHQGIDTSFLVATLTAAIQEQQAIIESLKADVAILKGVQP
Ga0222712_104058982	3300021963	Estuarine Water	IDTSFLVATLTAAIQEQQALITSLTARITALENKT
Ga0222712_104200864	3300021963	Estuarine Water	DEEGKPQYQGIDTSFLVATLTAAIKEQQALIEQLTTRIAALEAK
Ga0181353_10716531	3300022179	Freshwater Lake	GKPVYQGIDTSFLVATLTAAIQEQQAMINELKAEVAALKGA
Ga0181354_12056113	3300022190	Freshwater Lake	GVTPKYQGIDTSFLVATLTAAIQEQQAIILSLKARLDAANL
Ga0196905_11537401	3300022198	Aqueous	NPVYQGIDTSFLVATLTKAIQEQQTIIEDLKTRVSTLEGN
Ga0181351_12462341	3300022407	Freshwater Lake	KDAVHKDGKPKYQGVDTSFLVATLVSAIQEQQALIESLTTRLTALENK
Ga0181351_12537831	3300022407	Freshwater Lake	EYQGVDTSFLVATLTAAIQEQQTIINDLKARVETLEAK
(restricted) Ga0233412_101378521	3300023210	Seawater	AIPVYQGVDLSKMVPILTAAIQEQQVLINDLTARIEALEG
Ga0244777_103786533	3300024343	Estuarine	QGIDTSFLVATLTAAIQEQNVLIQSLKARLDAANL
Ga0255280_11256891	3300024555	Freshwater	SIKPQGIDTSFLVATLTAAIQEQQQMIETLQAKVAALEAK
Ga0208382_10297951	3300025369	Freshwater	KDDVSDTGQIKSQAVDPSKIVATLVLAVQEQQALIESLTTRLTALENK
Ga0208616_10453242	3300025417	Freshwater	VDAEGKPVYQGVDTSFLVATLTAAIQEQQTIINDLKARIETLEAK
Ga0208746_10243422	3300025423	Freshwater	AVDAEGKPVYQGIDTSFLVATLTAAIQEQQALITTLQTQVAAIQAKVGA
Ga0208147_10746831	3300025635	Aqueous	AVDAEGKPQYQGVDTSFLVATLVAAIKEQQAIIEQLTTRIEALEQQP
Ga0209136_11632653	3300025636	Marine	PQYQQMDHSTLVPLLTAAIQEQQATITALTDRITALENA
Ga0208784_12002921	3300025732	Aqueous	YQGIDVSFLVATLTAAIQEQQAMIESLKARLDAANL
Ga0255245_10167762	3300025744	Freshwater	QYQGVDTSFLVATLVAAIKEQQAIITALTARITALEAN
Ga0208916_102172781	3300025896	Aqueous	DTSFLIATLSAAIQEQQTIITALTARITALEGAAA
Ga0255270_10561971	3300026572	Freshwater	DGSIKPQGIDTSFLVATLTAAIQEQQQMIETLQAKVAALEAK
Ga0208800_10553793	3300027193	Estuarine	LDANGNIKPQGIDVSFLVATLTAAIQEQQALIESLTTRLTALENK
Ga0255079_11063201	3300027601	Freshwater	YQGIDTSFLVATLTAAIKEQQAMINELKAEVAALKGA
Ga0208951_10961641	3300027621	Freshwater Lentic	AVDADGKPQYQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA
Ga0208960_10730581	3300027649	Freshwater Lentic	TSFLVATLTAAIQEQQALITQLQTQITALNAKVGI
Ga0209297_10217997	3300027733	Freshwater Lake	DGNPKYQGIDTSFLVATLTAAIQEQQALITTLTDRITALEAK
Ga0209297_12505403	3300027733	Freshwater Lake	PQYQGVDTSFLVATLTAAIQEQQALITSLTTRLTALENK
Ga0209084_13699102	3300027749	Freshwater Lake	GVDTSFLVATLTAAIQEQQALITSLTARITALEAR
Ga0209246_101610921	3300027785	Freshwater Lake	NDENPKYQQVDTSFLVATLTAAIQEQQALITALTARITALEN
Ga0209353_101217564	3300027798	Freshwater Lake	PEYQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA
Ga0209353_103093611	3300027798	Freshwater Lake	VDEEGNPQYQGIDTSFLIATLSAAIQELHALVKTQAQDIADLKAKLP
Ga0209353_103443703	3300027798	Freshwater Lake	QGIDTSFLVATLTAAIQEQQALITSLTARITALEST
Ga0209353_103470463	3300027798	Freshwater Lake	AVDADGKPQYQGIDTSFLVATLTAAIQEQQALITQLTARLDAANL
Ga0209353_103907301	3300027798	Freshwater Lake	DTSFLVATLTAAIQEQQALITALTTRITALEGAAA
Ga0247723_10441374	3300028025	Deep Subsurface Sediment	GVDTSFLVATLTAAIQEQQALITSLTTRITALETK
Ga0256305_11018603	3300028108	Freshwater	PQYQGIDTSYLVATLTAAIQEQQAFITTLTARITALEGA
Ga0304729_10515521	3300028392	Freshwater Lake	GIDYSRFVPFLTAAIQEQQALITSLTDRIAALEAR
Ga0304728_11860601	3300028393	Freshwater Lake	PKHQGIDVSFLVSTLTAAIQEQQALITSLTDRIVALEAK
Ga0304728_12730612	3300028393	Freshwater Lake	NPKYQGIDVSFLVATLTAAIQEQQTLITALTARVGMLEEIIKGST
Ga0304730_12521523	3300028394	Freshwater Lake	VYQGVDTSFLVATLVSAIQEQQALIESLTTRLTALENK
Ga0307377_105515172	3300031673	Soil	FLVATLTAAIQEQQALITGQQAMLASLTARIEALENK
Ga0315291_111006903	3300031707	Sediment	QGIDTSFLVATLTAAIQEMKAIIDAQSARITALENK
Ga0315293_111680971	3300031746	Sediment	QGVDTSFLVATLTKAIQEQQALIESLTTRLTALENK
Ga0315907_100656271	3300031758	Freshwater	SIKPQGIDTSFLVATLTAAIKEQQQMIETLQAKVAALEAK
Ga0315909_104350251	3300031857	Freshwater	IDTSFLVATLTAAIQEQQAIIESLTARVVALEGAQIV
Ga0315285_102839571	3300031885	Sediment	TSFLIATLSAAIQELHALVKTQDSTITALTTRITALEAA
Ga0315904_102880314	3300031951	Freshwater	YQGIDTSFLSATLAAAIQELHQIVQAQAAEIAELKANLP
Ga0315904_104369862	3300031951	Freshwater	DDEGNPVYQGIDTSFLVATLTAAIQEQQALITQLQADVAALKGA
Ga0315904_114549821	3300031951	Freshwater	YQGIDTSFLVATLTAAIQEQQAIIESLTARVAALEQP
Ga0315294_105989891	3300031952	Sediment	DADGKPKYQGIDTSFLVATLTKAIQEQQALIESLTTRLTNLENK
Ga0315294_107180284	3300031952	Sediment	QGIDTSFLVATLTAAIQEQQAIIETMRTEIDALKAKVGT
Ga0315294_116213932	3300031952	Sediment	QGIDTSFLVATLTAAIQEQQALITTLTERITALEGV
Ga0316218_11443853	3300032117	Freshwater	MASLVLNGKPKYQGIDTSFLVATLTAALQEAHGLIKDLEARLVVLESK
Ga0315295_106682781	3300032156	Sediment	DAVDADGKPVHQGIDTSFLVATLTAAIQEQQALITALTARITALEAK
Ga0315295_114888091	3300032156	Sediment	AEMDTRTVPVYQMVDTSFLVATLTAAIQEQQALITTLTARISALESA
Ga0315268_126807751	3300032173	Sediment	QGIDTSFLVATLTAALQEAHGLIKDLTTRITASESK
Ga0315270_102503751	3300032275	Sediment	GKPQYQGIDTIFLVDILTAALQEQQAIIETLKARLDAANL
Ga0315275_124445531	3300032401	Sediment	QGIDTSFLVATLTAAIQEQQAMIESLRQRLSAANL
Ga0315275_125688061	3300032401	Sediment	VHQGIDTSFLVATLTAAIQEQQALITSLTARITALEST
Ga0315273_116582734	3300032516	Sediment	PQYQGMDTSFLIATLVSAIQEQQALIESLTTRLSALENK
Ga0316617_1027778352	3300033557	Soil	AEGKPQYQGIDTSFLVATLTAAIQEQQALITALTARVALLEGN
Ga0334979_0607902_2_157	3300033996	Freshwater	DADGNVTGTEERPVYQGIDTSFLVAMLTAAIQEQQALITSLTARITALEAK
Ga0334985_0231756_2_127	3300034018	Freshwater	KGNPKYQGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL
Ga0334990_0558453_473_604	3300034068	Freshwater	TEERPVYQGIDTSFLVAMLTAAIQEQQALITSLTSRITALESI
Ga0335010_0312454_774_896	3300034092	Freshwater	VPAYQGVDTSFLVATLTAAMQEQQAIITALTARIVALEAK
Ga0335027_0574321_581_691	3300034101	Freshwater	GVDTSFLVATLTAAIKEQQALITQLQLDVAALKGAA
Ga0335031_0481808_1_114	3300034104	Freshwater	QGVDTSFLVATLTAAIQEQQQIINDLKARIETLEGAK
Ga0335066_0336513_724_840	3300034112	Freshwater	IHQGIDTSFLVATLTAALQEAHGLIKDLQSRVDALEAK
Ga0335033_0426679_3_122	3300034117	Freshwater	RPQGVDTSFLVATLTAAIQEQQAMIVQLQADVAALKSTN
Ga0335053_0066576_2413_2535	3300034118	Freshwater	VPKYQGIDTSFLVATLTAAIQEQQALITALTTRITALEAA
Ga0335054_0441762_618_737	3300034119	Freshwater	NPKYQGIDTSFLVATLTAAIQEQQAIIESLKARLDAANL
Ga0335054_0530398_503_625	3300034119	Freshwater	VHQGIDTSFLVATLTAAIQEQQALITQLQADVATLKALKA
Ga0335058_0238189_2_127	3300034121	Freshwater	EVNGLYGLDKSGLVPVLIKAIQEQQALITQLTARITALEGA
Ga0335007_0228221_1_120	3300034283	Freshwater	PVYQGIDTSFLVATLTAAIQEQQAMIDELKAKVAALEAA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters