Metagenome / Metatranscriptome Family F037791

Basic Information
Family ID	F037791
Family Type	Metagenome / Metatranscriptome
Number of Sequences	167
Average Sequence Length	41 residues
Representative Sequence	LVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRASGDL
Number of Associated Samples	144
Number of Associated Scaffolds	167

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	24.70 %
% of genes near scaffold ends (potentially truncated)	48.50 %
% of genes from short scaffolds (< 2000 bps)	85.03 %
Associated GOLD sequencing projects	140
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Most Common Taxonomy
Group	Unclassified (50.898 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.784 % of family members)
Environment Ontology (ENVO)	Unclassified (28.144 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (24.551 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 167 Family Scaffolds
PF01979	Amidohydro_1	13.77
PF01268	FTHFS	5.99
PF01593	Amino_oxidase	2.40
PF13561	adh_short_C2	1.80
PF03631	Virul_fac_BrkB	1.80
PF02777	Sod_Fe_C	1.20
PF01258	zf-dskA_traR	1.20
PF13193	AMP-binding_C	1.20
PF02222	ATP-grasp	0.60
PF01177	Asp_Glu_race	0.60
PF08666	SAF	0.60
PF00080	Sod_Cu	0.60
PF07724	AAA_2	0.60
PF16916	ZT_dimer	0.60
PF01135	PCMT	0.60
PF13673	Acetyltransf_10	0.60
PF02897	Peptidase_S9_N	0.60
PF07690	MFS_1	0.60
PF00561	Abhydrolase_1	0.60

COG ID	Name	Functional Category	% Frequency in 167 Family Scaffolds
COG2759	Formyltetrahydrofolate synthetase	Nucleotide transport and metabolism [F]	5.99
COG1295	Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)	Function unknown [S]	1.80
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	1.20
COG1734	RNA polymerase-binding transcription factor DksA	Transcription [K]	1.20
COG1505	Prolyl endopeptidase PreP, S9A serine peptidase family	Amino acid transport and metabolism [E]	0.60
COG1770	Protease II	Amino acid transport and metabolism [E]	0.60
COG2032	Cu/Zn superoxide dismutase	Inorganic ion transport and metabolism [P]	0.60
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.60
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.60
COG2519	tRNA A58 N-methylase Trm61	Translation, ribosomal structure and biogenesis [J]	0.60
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.60

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
All Organisms	root	All Organisms	49.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
cellular organisms	root	All Organisms → cellular organisms	49.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	49.10 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	42.51 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.60 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	14.37 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.99 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.20 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	3.59 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.20 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.20 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1.20 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.60 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	0.60 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	0.60 %
Oceanospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	3.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.20 %
Chromobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae	0.60 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	0.60 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.60 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.60 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.60 %
Oceanospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	0.60 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Nitrosomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas	3.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.20 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	0.60 %
Hyphomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium	0.60 %
Chromobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group	0.60 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.60 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.60 %
Oceanospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	0.60 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Nitrosomonas halophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	3.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.20 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.60 %
Microvirga tunisiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis	0.60 %
Chromobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium	0.60 %
unclassified Hyphomicrobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium	0.60 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.60 %
Oceanospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	0.60 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.90 %
Nitrosomonas halophila	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	3.59 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.20 %
Hyphomicrobium sp. MC1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	0.60 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	0.60 %
Microvirga tunisiensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis	0.60 %
Chromobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium	0.60 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.60 %
Oceanospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	0.60 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.60 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459015\|G14TP7Y01BUU8Z	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC1	649	Open in IMG/M
3300001991\|JGI24743J22301_10054430	Not Available	818	Open in IMG/M
3300002908\|JGI25382J43887_10126132	All Organisms → cellular organisms → Bacteria → Proteobacteria	1326	Open in IMG/M
3300004009\|Ga0055437_10199130	Not Available	641	Open in IMG/M
3300004051\|Ga0055492_10142720	Not Available	566	Open in IMG/M
3300004057\|Ga0055496_10146770	Not Available	591	Open in IMG/M
3300004071\|Ga0055486_10040814	All Organisms → cellular organisms → Bacteria → Proteobacteria	898	Open in IMG/M
3300004079\|Ga0055514_10134617	Not Available	655	Open in IMG/M
3300004463\|Ga0063356_106112823	All Organisms → cellular organisms → Bacteria → Proteobacteria	516	Open in IMG/M
3300004781\|Ga0062379_10120383	Not Available	631	Open in IMG/M
3300005093\|Ga0062594_100964511	Not Available	815	Open in IMG/M
3300005181\|Ga0066678_10130958	Not Available	1551	Open in IMG/M
3300005186\|Ga0066676_10312467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1043	Open in IMG/M
3300005347\|Ga0070668_100253127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	1463	Open in IMG/M
3300005367\|Ga0070667_100277300	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	1505	Open in IMG/M
3300005438\|Ga0070701_10271005	Not Available	1033	Open in IMG/M
3300005441\|Ga0070700_101513860	All Organisms → cellular organisms → Bacteria → Proteobacteria	571	Open in IMG/M
3300005445\|Ga0070708_100000563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	27746	Open in IMG/M
3300005451\|Ga0066681_10455774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	785	Open in IMG/M
3300005454\|Ga0066687_10066658	All Organisms → cellular organisms → Bacteria → Proteobacteria	1729	Open in IMG/M
3300005558\|Ga0066698_10076282	All Organisms → cellular organisms → Bacteria → Proteobacteria	2172	Open in IMG/M
3300005564\|Ga0070664_101473155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	644	Open in IMG/M
3300005574\|Ga0066694_10563509	Not Available	530	Open in IMG/M
3300005577\|Ga0068857_101023082	All Organisms → cellular organisms → Bacteria → Proteobacteria	796	Open in IMG/M
3300005598\|Ga0066706_10266637	Not Available	1337	Open in IMG/M
3300005719\|Ga0068861_100845232	Not Available	862	Open in IMG/M
3300005764\|Ga0066903_100122365	All Organisms → cellular organisms → Bacteria → Proteobacteria	3622	Open in IMG/M
3300005764\|Ga0066903_100664244	All Organisms → cellular organisms → Bacteria → Proteobacteria	1826	Open in IMG/M
3300005764\|Ga0066903_104295407	Not Available	762	Open in IMG/M
3300005836\|Ga0074470_10606544	Not Available	718	Open in IMG/M
3300005993\|Ga0080027_10110083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Chromobacterium group → Chromobacterium	1038	Open in IMG/M
3300006032\|Ga0066696_10304440	Not Available	1036	Open in IMG/M
3300006224\|Ga0079037_100033222	All Organisms → cellular organisms → Bacteria → Proteobacteria	3844	Open in IMG/M
3300006224\|Ga0079037_100313367	All Organisms → cellular organisms → Bacteria → Proteobacteria	1459	Open in IMG/M
3300006224\|Ga0079037_101382330	Not Available	702	Open in IMG/M
3300006354\|Ga0075021_10386102	All Organisms → cellular organisms → Bacteria → Proteobacteria	877	Open in IMG/M
3300006572\|Ga0074051_11560716	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae	573	Open in IMG/M
3300006572\|Ga0074051_11633962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	622	Open in IMG/M
3300006581\|Ga0074048_13278626	Not Available	656	Open in IMG/M
3300006603\|Ga0074064_11642662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	536	Open in IMG/M
3300006604\|Ga0074060_11841685	Not Available	671	Open in IMG/M
3300006605\|Ga0074057_12048663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	502	Open in IMG/M
3300006854\|Ga0075425_102117646	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300006871\|Ga0075434_102543508	All Organisms → cellular organisms → Bacteria → Proteobacteria	513	Open in IMG/M
3300006904\|Ga0075424_100134903	All Organisms → cellular organisms → Bacteria → Proteobacteria	2612	Open in IMG/M
3300007004\|Ga0079218_10023091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3446	Open in IMG/M
3300007076\|Ga0075435_100871929	Not Available	785	Open in IMG/M
3300009053\|Ga0105095_10818442	All Organisms → cellular organisms → Bacteria → Proteobacteria	522	Open in IMG/M
3300009089\|Ga0099828_10736106	All Organisms → cellular organisms → Bacteria → Proteobacteria	885	Open in IMG/M
3300009111\|Ga0115026_10028244	All Organisms → cellular organisms → Bacteria → Proteobacteria	2853	Open in IMG/M
3300009111\|Ga0115026_10163440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1449	Open in IMG/M
3300009120\|Ga0117941_1046577	All Organisms → cellular organisms → Bacteria	1157	Open in IMG/M
3300009131\|Ga0115027_10026758	All Organisms → cellular organisms → Bacteria → Proteobacteria	2641	Open in IMG/M
3300009131\|Ga0115027_10994592	Not Available	656	Open in IMG/M
3300009162\|Ga0075423_12864838	Not Available	528	Open in IMG/M
3300009167\|Ga0113563_10470270	All Organisms → cellular organisms → Bacteria	1362	Open in IMG/M
3300009170\|Ga0105096_10002931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	7597	Open in IMG/M
3300009177\|Ga0105248_11668685	Not Available	722	Open in IMG/M
3300009179\|Ga0115028_12082632	Not Available	503	Open in IMG/M
3300009870\|Ga0131092_10917866	All Organisms → cellular organisms → Bacteria → Proteobacteria	717	Open in IMG/M
3300010325\|Ga0134064_10440943	Not Available	529	Open in IMG/M
3300010375\|Ga0105239_10285548	Not Available	1858	Open in IMG/M
3300011444\|Ga0137463_1120493	Not Available	987	Open in IMG/M
3300012133\|Ga0137329_1044004	All Organisms → cellular organisms → Bacteria → Proteobacteria	579	Open in IMG/M
3300012203\|Ga0137399_10863586	Not Available	762	Open in IMG/M
3300012363\|Ga0137390_11096188	Not Available	745	Open in IMG/M
3300012495\|Ga0157323_1032499	Not Available	561	Open in IMG/M
3300013297\|Ga0157378_11234568	Not Available	787	Open in IMG/M
3300013297\|Ga0157378_11668119	All Organisms → cellular organisms → Bacteria → Proteobacteria	684	Open in IMG/M
3300013306\|Ga0163162_12975435	Not Available	545	Open in IMG/M
3300013315\|Ga0173609_10383017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1320	Open in IMG/M
3300013769\|Ga0119887_1043824	All Organisms → cellular organisms → Bacteria → Proteobacteria	1298	Open in IMG/M
3300014303\|Ga0075358_1046584	Not Available	722	Open in IMG/M
3300014305\|Ga0075349_1012552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1511	Open in IMG/M
3300014315\|Ga0075350_1037261	All Organisms → cellular organisms → Bacteria → Proteobacteria	1000	Open in IMG/M
3300014322\|Ga0075355_1198779	Not Available	557	Open in IMG/M
3300014326\|Ga0157380_11000729	Not Available	869	Open in IMG/M
3300014875\|Ga0180083_1032133	Not Available	1033	Open in IMG/M
3300014969\|Ga0157376_10401795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1325	Open in IMG/M
3300015075\|Ga0167636_1021206	Not Available	883	Open in IMG/M
3300015252\|Ga0180075_1034727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis	786	Open in IMG/M
3300015264\|Ga0137403_10658558	Not Available	909	Open in IMG/M
3300015371\|Ga0132258_10150622	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5578	Open in IMG/M
3300015371\|Ga0132258_10974600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2142	Open in IMG/M
3300015372\|Ga0132256_100253466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1830	Open in IMG/M
3300015372\|Ga0132256_100615132	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1201	Open in IMG/M
3300015372\|Ga0132256_101628345	All Organisms → cellular organisms → Bacteria → Proteobacteria	755	Open in IMG/M
3300015372\|Ga0132256_102559678	Not Available	611	Open in IMG/M
3300015373\|Ga0132257_103582849	Not Available	565	Open in IMG/M
3300017959\|Ga0187779_11023060	Not Available	574	Open in IMG/M
3300018027\|Ga0184605_10025938	All Organisms → cellular organisms → Bacteria → Proteobacteria	2387	Open in IMG/M
3300018052\|Ga0184638_1110981	Not Available	1004	Open in IMG/M
3300018053\|Ga0184626_10000848	All Organisms → cellular organisms → Bacteria	10099	Open in IMG/M
3300018056\|Ga0184623_10525130	Not Available	502	Open in IMG/M
3300018060\|Ga0187765_11204784	Not Available	531	Open in IMG/M
3300018061\|Ga0184619_10018571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2836	Open in IMG/M
3300018429\|Ga0190272_11298488	Not Available	723	Open in IMG/M
3300018481\|Ga0190271_13835589	Not Available	503	Open in IMG/M
3300018482\|Ga0066669_11299974	All Organisms → cellular organisms → Bacteria	658	Open in IMG/M
3300019248\|Ga0180117_1066200	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	887	Open in IMG/M
3300019887\|Ga0193729_1196570	Not Available	691	Open in IMG/M
3300021316\|Ga0210351_1345352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → Nitrosomonas halophila	591	Open in IMG/M
3300021473\|Ga0194043_1248816	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300022185\|Ga0079039_1306718	Not Available	502	Open in IMG/M
3300022214\|Ga0224505_10265602	All Organisms → cellular organisms → Bacteria → Proteobacteria	652	Open in IMG/M
3300022756\|Ga0222622_10714272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	729	Open in IMG/M
3300025848\|Ga0208005_1166191	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300025907\|Ga0207645_10026129	All Organisms → cellular organisms → Bacteria → Proteobacteria	3775	Open in IMG/M
3300025956\|Ga0210104_1000973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3765	Open in IMG/M
3300025956\|Ga0210104_1002797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2143	Open in IMG/M
3300025958\|Ga0210069_1005224	All Organisms → cellular organisms → Bacteria → Proteobacteria	1687	Open in IMG/M
3300025968\|Ga0210103_1059293	All Organisms → cellular organisms → Bacteria	629	Open in IMG/M
3300026072\|Ga0208292_1015803	Not Available	946	Open in IMG/M
3300026075\|Ga0207708_10889193	Not Available	770	Open in IMG/M
3300026322\|Ga0209687_1222522	Not Available	582	Open in IMG/M
3300026476\|Ga0256808_1013001	Not Available	1029	Open in IMG/M
3300026550\|Ga0209474_10239992	Not Available	1126	Open in IMG/M
3300026857\|Ga0208893_1004348	Not Available	541	Open in IMG/M
3300027871\|Ga0209397_10325920	All Organisms → cellular organisms → Bacteria	739	Open in IMG/M
3300027871\|Ga0209397_10711462	Not Available	505	Open in IMG/M
3300027885\|Ga0209450_10743496	Not Available	710	Open in IMG/M
3300027900\|Ga0209253_10179194	All Organisms → cellular organisms → Bacteria → Proteobacteria	1703	Open in IMG/M
3300028597\|Ga0247820_10554433	Not Available	788	Open in IMG/M
3300028665\|Ga0302160_10101353	Not Available	634	Open in IMG/M
3300028741\|Ga0302256_10232977	Not Available	508	Open in IMG/M
3300028743\|Ga0302262_10199451	Not Available	682	Open in IMG/M
3300029984\|Ga0311332_10335362	All Organisms → cellular organisms → Bacteria → Proteobacteria	1164	Open in IMG/M
3300029987\|Ga0311334_10080141	All Organisms → cellular organisms → Bacteria → Proteobacteria	2375	Open in IMG/M
3300029990\|Ga0311336_10002963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	12901	Open in IMG/M
3300030000\|Ga0311337_11661643	All Organisms → cellular organisms → Bacteria → Proteobacteria	560	Open in IMG/M
3300030002\|Ga0311350_10721618	Not Available	894	Open in IMG/M
3300030294\|Ga0311349_10751784	Not Available	919	Open in IMG/M
3300031232\|Ga0302323_100785291	Not Available	1046	Open in IMG/M
3300031543\|Ga0318516_10531258	All Organisms → cellular organisms → Bacteria → Proteobacteria	674	Open in IMG/M
3300031562\|Ga0310886_10933017	Not Available	553	Open in IMG/M
3300031726\|Ga0302321_100112037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2749	Open in IMG/M
3300031726\|Ga0302321_102154966	Not Available	648	Open in IMG/M
3300031834\|Ga0315290_10822224	Not Available	793	Open in IMG/M
3300031873\|Ga0315297_10000283	All Organisms → cellular organisms → Bacteria → Proteobacteria	28850	Open in IMG/M
3300031873\|Ga0315297_10164362	Not Available	1812	Open in IMG/M
3300031918\|Ga0311367_12088285	Not Available	545	Open in IMG/M
3300031940\|Ga0310901_10603678	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300032013\|Ga0310906_10590393	Not Available	764	Open in IMG/M
3300032018\|Ga0315272_10545357	Not Available	581	Open in IMG/M
3300032068\|Ga0318553_10215736	Not Available	1001	Open in IMG/M
3300032177\|Ga0315276_11216622	Not Available	793	Open in IMG/M
3300032180\|Ga0307471_104192050	Not Available	509	Open in IMG/M
3300032256\|Ga0315271_10705147	Not Available	867	Open in IMG/M
3300032256\|Ga0315271_11302464	Not Available	627	Open in IMG/M
3300032256\|Ga0315271_11646073	Not Available	552	Open in IMG/M
3300032261\|Ga0306920_103635902	All Organisms → cellular organisms → Bacteria → Proteobacteria	567	Open in IMG/M
3300032275\|Ga0315270_10104185	Not Available	1664	Open in IMG/M
3300032397\|Ga0315287_10056461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4334	Open in IMG/M
3300032397\|Ga0315287_10701574	Not Available	1195	Open in IMG/M
3300032782\|Ga0335082_10042000	Not Available	4789	Open in IMG/M
3300032828\|Ga0335080_11142081	All Organisms → cellular organisms → Bacteria → Proteobacteria	786	Open in IMG/M
3300033004\|Ga0335084_12224206	Not Available	531	Open in IMG/M
3300033408\|Ga0316605_10192774	All Organisms → cellular organisms → Bacteria → Proteobacteria	1705	Open in IMG/M
3300033408\|Ga0316605_10194009	Not Available	1700	Open in IMG/M
3300033408\|Ga0316605_10314794	All Organisms → cellular organisms → Bacteria	1379	Open in IMG/M
3300033481\|Ga0316600_10570206	All Organisms → cellular organisms → Bacteria → Proteobacteria	790	Open in IMG/M
3300033482\|Ga0316627_100081871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	2130	Open in IMG/M
3300033482\|Ga0316627_101022120	Not Available	803	Open in IMG/M
3300033483\|Ga0316629_10531503	Not Available	861	Open in IMG/M
3300033483\|Ga0316629_10726012	Not Available	754	Open in IMG/M
3300034195\|Ga0370501_0063731	Not Available	1193	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.84%
Host-Associated	Host-Associated	16.77%
Engineered	Engineered	2.40%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	47.31%
Aquatic	Environmental → Aquatic	33.53%
Plants	Host-Associated → Plants	16.77%
Wastewater	Engineered → Wastewater	1.80%
Solid Waste	Engineered → Solid Waste	0.60%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	39.52%
Freshwater	Environmental → Aquatic → Freshwater	18.56%
Rhizosphere	Host-Associated → Plants → Rhizosphere	11.38%
Sediment	Environmental → Aquatic → Sediment	7.78%
Peat	Environmental → Terrestrial → Peat	7.78%
Marine	Environmental → Aquatic → Marine	7.19%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.39%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	1.20%
Grass	Engineered → Solid Waste → Grass	0.60%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	22.75%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.98%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	7.78%
Lake	Environmental → Aquatic → Freshwater → Lake	7.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.59%
Wetlands	Environmental → Aquatic → Marine → Wetlands	5.39%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.99%
Loam	Environmental → Terrestrial → Soil → Loam	4.79%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.79%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	4.19%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.80%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.20%
Coastal	Environmental → Aquatic → Marine → Coastal	0.60%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.60%
Sediment	Environmental → Aquatic → Marine → Sediment	0.60%
Composting	Engineered → Solid Waste → Grass → Composting	0.60%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.60%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified	0.60%
Mine Water	Engineered → Wastewater → Industrial Wastewater → Mine Water	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	11.38%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	9.58%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.78%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	7.78%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.19%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	6.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.59%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	5.39%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.79%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.59%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.59%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.40%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.40%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.99%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.80%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.20%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.20%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.60%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.60%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.60%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.60%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.60%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.60%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.60%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified	0.60%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	7.78%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	6.59%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	6.59%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	5.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.99%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	4.19%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.19%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.40%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.40%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	2.40%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	2.99%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.99%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.99%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.99%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.99%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.80%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.80%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.80%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.20%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	1.20%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.20%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.20%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.20%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.60%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.60%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.60%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment	0.60%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.60%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.60%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.60%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.60%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.60%
Lake Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment	0.60%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.60%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.60%
Glacier Forefield Soils	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils	0.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.60%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.60%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.60%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.60%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.60%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.60%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.60%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.60%
Sewage Treatment Plant	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sewage Treatment Plant	0.60%
Sediment	Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment	0.60%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459015	Litter degradation PV4	Engineered	Open in IMG/M
3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Host-Associated	Open in IMG/M
3300002908	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm	Environmental	Open in IMG/M
3300004009	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2	Environmental	Open in IMG/M
3300004051	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2	Environmental	Open in IMG/M
3300004057	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2	Environmental	Open in IMG/M
3300004071	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2	Environmental	Open in IMG/M
3300004079	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004781	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005181	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005993	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300006572	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006603	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006604	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006605	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009120	Lake sediment microbial communities from Tanners Lake, St. Paul, MN	Environmental	Open in IMG/M
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300012133	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013315	Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B	Engineered	Open in IMG/M
3300013769	Sewage treatment plant microbial communities from Vermont, USA - Sand_B	Engineered	Open in IMG/M
3300014303	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1	Environmental	Open in IMG/M
3300014305	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1	Environmental	Open in IMG/M
3300014315	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014875	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015075	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river)	Environmental	Open in IMG/M
3300015252	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019248	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300021316	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021473	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m	Environmental	Open in IMG/M
3300022185	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022214	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025848	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025956	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025958	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025968	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026072	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental	Open in IMG/M
3300026476	Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026857	Soil and rhizosphere microbial communities from Laval, Canada - mgLMB (SPAdes)	Environmental	Open in IMG/M
3300027871	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental	Open in IMG/M
3300028597	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14	Environmental	Open in IMG/M
3300028665	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3	Environmental	Open in IMG/M
3300028741	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4	Environmental	Open in IMG/M
3300028743	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031918	III_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031940	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032018	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300034195	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4PV_01905810	2170459015	Switchgrass, Maize And Mischanthus Litter	VSAYLVLLRMEVTAFHPLPFDRKRLVSVALFLAFIGRANGDL
JGI24743J22301_100544301	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	MSAYLVLLRMEVAAFTRSGHGLTRTGAIVSVALFLAFIHRASGDLW
JGI25382J43887_101261322	3300002908	Grasslands Soil	MSAYLVLLRMEVAAFHPLPYDGKRLVSVALFIAFIHRASGDL*
Ga0055437_101991302	3300004009	Natural And Restored Wetlands	LVLLRMEVAAFHPLPDRFDPARQRLVSVALFIAFIGRANGDL
Ga0055492_101427202	3300004051	Natural And Restored Wetlands	NCASAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL*
Ga0055496_101467701	3300004057	Natural And Restored Wetlands	CASAYLVLLRMEVAAFHPPSRRFDPERKRLVSVALFIAFIGRANGDL*
Ga0055486_100408142	3300004071	Natural And Restored Wetlands	LVLLRMEVAAFHPPSRRFDPERKRLVSVALFIAFIGRANGDL*
Ga0055514_101346172	3300004079	Natural And Restored Wetlands	ASMSAYLVLLRMEVAAFHPLPCDGKRLVSVALFLAFIGRANGDL*
Ga0063356_1061128232	3300004463	Arabidopsis Thaliana Rhizosphere	CLVLLRMEVAAFHPHRIGVTLRLVSVALFIAFIHRANGDL*
Ga0062379_101203832	3300004781	Wetland Sediment	MSAYLVLLRMEVAAFHPPRGLTPGRLVSVALFLAFVIRASGDL*
Ga0062594_1009645112	3300005093	Soil	VSAYLVLLRMEVTAFHPLPFDRKRLVSVALFLAFIGRANGDL*
Ga0066678_101309582	3300005181	Soil	YLVLLRMEVAAFHPLPRSFTCAVRLVSVALFLAFTRRASGGL*
Ga0066676_103124672	3300005186	Soil	MSAYLVLLRMEVAAFHPLQFDRKRLVSVALFLAFARRASGGL*
Ga0070668_1002531272	3300005347	Switchgrass Rhizosphere	MEVAAFHPPPIRCDPDRGRLVSVALFLAFVSRASGDLLRPG
Ga0070667_1002773001	3300005367	Switchgrass Rhizosphere	MEVAAFHPPPIRYDPARGRLVSVALFLAFVSRASGDLLRPG
Ga0070701_102710051	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	YLVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL*
Ga0070700_1015138602	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MEVAAFHPPRTRCEPDPRRLVSVALFLAFVSRASGDLLRPG
Ga0070708_1000005632	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MSAYLVLLRMEVAAFHPLAFDGKRLVSVALFLAFIGRANGDL*
Ga0066681_104557742	3300005451	Soil	MSAYLVLLRMEVAAFHPLPFDWKRLVSVALFLAFTRRASGGL*
Ga0066687_100666583	3300005454	Soil	MSAYLVLLRMEVAASPASAQFYVRGKRLVSVALFLAFTRRASGGL*
Ga0070706_1003699402	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	SVIVRYLVLLRMEVAAFHPHPLDRMRLVSVALFLAFTAARANGL*
Ga0066698_100762822	3300005558	Soil	MSAYLVLLRMEVAAFHPLPAKEAIVSVALFLAFVARFRGDL*
Ga0070664_1014731552	3300005564	Corn Rhizosphere	LVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL*
Ga0066694_105635091	3300005574	Soil	MSAYLVLLRMEVAAFTRFRAVYLRGKRLVSVALFLAFTRRASGGL*
Ga0068857_1010230822	3300005577	Corn Rhizosphere	LVLLRMEVAAFHPKRYDPLRLVSVALFLAFVGRANGDL*
Ga0066706_102666372	3300005598	Soil	MSAYLVLLRMEVAAFHPLPAKKAIVSVALFLAFVARFRGDL*
Ga0068861_1008452321	3300005719	Switchgrass Rhizosphere	LVLLRMEVAAFHPKRYDPLRLVSVALFLAFVGRAGGDL*
Ga0066903_1001223652	3300005764	Tropical Forest Soil	LVLLRMEVAAFHPSAFDGRRLVSVALFLAFVHRASGDL*
Ga0066903_1006642443	3300005764	Tropical Forest Soil	LVLLRMEVAAFHPPAFDRRRLVSVALFLAFIHRASGDL*
Ga0066903_1042954072	3300005764	Tropical Forest Soil	SAYLVLLRMEVAAFHPPRCYPQRLVSVALFHAFVCRANGDL*
Ga0074470_106065442	3300005836	Sediment (Intertidal)	MEVAAFHPLPDRFDPEWPRLVSVALFIAFIGRANGDL*
Ga0080027_101100831	3300005993	Prmafrost Soil	VSAYLVLLRMEVTAFHPPPFDRKRLVSVALFLAFIGRANGDL*
Ga0066696_103044402	3300006032	Soil	MSAYLVLLRMEVAAFHPLPFDWKRLVSVALFLAFVHRASGDL*
Ga0079037_1000332223	3300006224	Freshwater Wetlands	LVLLRMEVAAFHPPPTRYDPERKRLVSVALFIAFIGRANGDL*
Ga0079037_1003133672	3300006224	Freshwater Wetlands	MLLRMEVAAFHPPPFDRRRLVSVALFLAFIGRASGDL*
Ga0079037_1013823302	3300006224	Freshwater Wetlands	MEVAAFHPPPARFDPDPRRLVSVALFLAFVGRASGDLLRPGVTR
Ga0075021_103861022	3300006354	Watersheds	VSAYLVLLRMEVTAFHPPPFDRRRLVSVALFLAFIGRANGDL*
Ga0074051_115607162	3300006572	Soil	LVLLRMEVAAFHPLPRRYDPERTRLVSVALFIAFIGRANGDL*
Ga0074051_116339622	3300006572	Soil	LVLLRMEVAAFHPLSREGKRLVSVALFLAFIGRANGDL*
Ga0074048_132786262	3300006581	Soil	SAYLVLLRMEVTAFHPLPFDRKRLVSVALFLAFIGRANGDL*
Ga0074064_116426622	3300006603	Soil	MSAYLVLLRMEVAAFHPPRFDPWRLVSVALFLTFVVRASGDL*
Ga0074060_118416851	3300006604	Soil	SSAYLVLLRMEVAAFHPLPSRFDPSRQRLVSVALFIAFIGRANGDL*
Ga0074057_120486631	3300006605	Soil	MSAYLVLLRMEVAAFHPPRFDPRRLVSVALFLTFVVRASGDL*
Ga0075425_1021176462	3300006854	Populus Rhizosphere	MSAYLVLLRMEVAAFHPLPAHLCATGRLVSVALFLAFVARVSGDL*
Ga0075434_1025435082	3300006871	Populus Rhizosphere	SSSAYLVLLRMEVAAFHPLPEQFDPCRMRLVSVALFIAFVDRASGDL*
Ga0075424_1001349032	3300006904	Populus Rhizosphere	MSAYLVLLRMEVAAFHPLPCEGKRLVSVALFLAFVGRASGDL*
Ga0079218_100230916	3300007004	Agricultural Soil	SAYLVLLRMEVAAFHPLPRFDPRRRLVSVALFLAFINRASGDL*
Ga0075435_1008719292	3300007076	Populus Rhizosphere	MSAYLVLLRMEVAAFHPLPAHVCNRKRLVSVALFLAFVARVSGDL*
Ga0105095_108184421	3300009053	Freshwater Sediment	MEVAAFHPPPVRFDPDPRRLVSVALFLAFVGRASGDLLRP
Ga0099828_107361061	3300009089	Vadose Zone Soil	ASSSAYLVLLRMEVAAFHPHPLDRMRLVSVALFLAFTAARANGL*
Ga0115026_100282442	3300009111	Wetland	LVLLRMEVAAFHPPPRRYDPERMRLVSVAAFIVFIGRANGDL*
Ga0115026_101634402	3300009111	Wetland	MLLRMEVAAFHPLPFDGKRLVSVALFLAFVHRASGDL*
Ga0117941_10465771	3300009120	Lake Sediment	MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRANGDL*
Ga0115027_100267582	3300009131	Wetland	LVLLRMEVAAFHPPPFDRRRLVSVALFLAFIGRASGDL*
Ga0115027_109945921	3300009131	Wetland	LVLLRMEVAAFHPLPNRFDPGRPRLVSVALFIAFINRANGDL
Ga0075423_128648382	3300009162	Populus Rhizosphere	AASMSAYLVLLRMEVAAFHPLPRGKRLVSVALFLAFVTRSRGDL*
Ga0113563_104702701	3300009167	Freshwater Wetlands	MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL*
Ga0105096_100029315	3300009170	Freshwater Sediment	MLLRMEVAAFHPLPFDRKRLVSVALFLAFIHRANGDL*
Ga0105248_116686851	3300009177	Switchgrass Rhizosphere	LVLLRMEVAAFHPPRGRFDPFRGRLVSVALFIAFVGRV
Ga0115028_120826321	3300009179	Wetland	TSAYLMLLRMEVAAFHPLPFDGKRLVSVALFLAFVHRASGDL*
Ga0131092_109178662	3300009870	Activated Sludge	LVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRANGDL*
Ga0134064_104409431	3300010325	Grasslands Soil	MSAYLVLLRMEVAAFHPLQFDRKRLVSVALFLAFARRASGDL*
Ga0105239_102855483	3300010375	Corn Rhizosphere	AASSFAYLVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL*
Ga0137463_11204932	3300011444	Soil	VSAYLVLLRMEVTAFHPLPFDGKRLVSVALFLAFIGRANGDL*
Ga0137329_10440042	3300012133	Soil	LVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL*
Ga0137399_108635862	3300012203	Vadose Zone Soil	LVLLRMEVAAFHPLPYDGKRLVSVALFIAFIHRASGDL*
Ga0137390_110961881	3300012363	Vadose Zone Soil	LVLLRMEVAAFHPLRTWHNARPGRLVSVALFLAFDDRSRDRLIAA
Ga0157323_10324991	3300012495	Arabidopsis Rhizosphere	LVLLRMEVAAFHPPAFDARRLVSVALFLAFVGRASGDL*
Ga0157378_112345682	3300013297	Miscanthus Rhizosphere	MEVAAFHPLPVEGKRLVSVALFLAFAETARLRLVR
Ga0157378_116681192	3300013297	Miscanthus Rhizosphere	SYLVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL*
Ga0163162_129754351	3300013306	Switchgrass Rhizosphere	ACDAIASAYLVLLRMEVAAFHPPPCNRGRLVSVALFLTFVHRASGDL*
Ga0173609_103830172	3300013315	Sediment	MSAYLVLLRMEVAAFHPPGRSPGRLVSVALFLAFVIRASGDL*
Ga0119887_10438242	3300013769	Sewage Treatment Plant	LVLLRMEVAAFHPPAFDGRRLVSVALFLAFIDRANGDL*
Ga0075358_10465842	3300014303	Natural And Restored Wetlands	MEVAAFHPPPGRFDPAWLRLVSVALFIAFIGRANGDL*
Ga0075349_10125521	3300014305	Natural And Restored Wetlands	LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL*
Ga0075350_10372612	3300014315	Natural And Restored Wetlands	LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL*
Ga0075355_11987791	3300014322	Natural And Restored Wetlands	MSAYLVLLRMEVAAFHPLPCDGKRLVSVALFLAFVGRANGDL*
Ga0157380_110007291	3300014326	Switchgrass Rhizosphere	MARAASWSAYLVLLRMEVAAFHPLPCNRKRLVSVALFLAF
Ga0180083_10321332	3300014875	Soil	VSAYLVLLRMEVAAFHPPAFDGKRLVSVALFLAFIGRANGDL*
Ga0157376_104017952	3300014969	Miscanthus Rhizosphere	MEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL*
Ga0167636_10212061	3300015075	Glacier Forefield Soils	LVLLRMEVAAFHPLRTWRTARPERLVSVALFLAFVDR
Ga0180075_10347272	3300015252	Soil	LVLLRMEVAAFHPLSREGKRLVSVALFLALIDRASGDL*
Ga0137403_106585582	3300015264	Vadose Zone Soil	MSAYLVLLRMEVAAFHPLPVAGQRLVSVALFLAFVHRASGDL*
Ga0132258_101506221	3300015371	Arabidopsis Rhizosphere	LVLLRMEVAAFHPPACDRRRLVSVALFLALVDRAS
Ga0132258_109746003	3300015371	Arabidopsis Rhizosphere	LVLLRMEVAAFHPPPIRYDPDRGRLVSVALFLAFVSRASGDL
Ga0132256_1002534661	3300015372	Arabidopsis Rhizosphere	CASAYLVLLRMEVAAFHPPACDRRRLVSVALFLALVGRASGDL*
Ga0132256_1006151322	3300015372	Arabidopsis Rhizosphere	LVLLRMEVAAFPPPAFDGRRLVSVALFLAFVGRASGDL*
Ga0132256_1016283452	3300015372	Arabidopsis Rhizosphere	VSAYLVLLRMEVTAFHPLAFNRKRLVSVALFLAFIDRASGDL*
Ga0132256_1025596782	3300015372	Arabidopsis Rhizosphere	LVLLRMEVAAFHPPPVRHARIRRRLVSVALFIAFVHRASGDL
Ga0132257_1035828491	3300015373	Arabidopsis Rhizosphere	LVLLRMEVAAFHPPAFDGRRLVSVALFLAFVGRASGDL*
Ga0187779_110230601	3300017959	Tropical Peatland	MSAYLVLLRMEVAAFHPPRFEPRRLVSVALFLAFVGRASGDL
Ga0184605_100259382	3300018027	Groundwater Sediment	MSAYLVLLRMEVAAFHPLPYDGKRLVSVALFIAFIHRASGDL
Ga0184638_11109812	3300018052	Groundwater Sediment	AKCASAYLVLLRMEVAAFHPLAFDSKRLVSVALFLAFIGRANGDL
Ga0184626_100008481	3300018053	Groundwater Sediment	LVLLRMEVAAFHPLAFDGKRLVSVALFLAFIGRANGDL
Ga0184623_105251302	3300018056	Groundwater Sediment	SSSAYLVLLRMEVAAFHPLSREGKRLVSVAQFLVFISHASGDL
Ga0187765_112047841	3300018060	Tropical Peatland	LVLLRMEVAAFHPPAFDRRRLVSVALFLAFVDRASGDL
Ga0184619_100185712	3300018061	Groundwater Sediment	MSAYLVLLRMEVAALHPLPYDGKRLVSVALFIAFIHRASGDL
Ga0190272_112984882	3300018429	Soil	LVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRASGDL
Ga0190271_138355891	3300018481	Soil	ASAYLVLLRMEVAAFHPLPFDRKRLVSVALFLAFIGRASGDL
Ga0066669_112999741	3300018482	Grasslands Soil	LVLLRMEVAAFHPPACDRRRLVSVALFLALVDRASGDL
Ga0180117_10662001	3300019248	Groundwater Sediment	MSAYLVLLRMEVAAFHPPRFDPRRLVSVALFLTFVVRASGDL
Ga0193729_11965702	3300019887	Soil	MEVAAFHPLRTWRDARPGRLVSVALFLAFVDRSRDRLI
Ga0210351_13453523	3300021316	Estuarine	MEVAAFHPPPDRFDPLRRRLVSVALFIAFINRVNGDL
Ga0194043_12488161	3300021473	Anoxic Zone Freshwater	LVLLRMEVAAFHPLPRRYDPERKRLVSVALFIAFIGRANGDL
Ga0079039_13067181	3300022185	Freshwater Wetlands	MEVAAFHPLPRRFDPERTRLVSVALFIAFIGRANGDL
Ga0224505_102656021	3300022214	Sediment	AKCASAYLVLLRMEVAAFHPLPCDGKRLVSVALFLAFINRASGDL
Ga0222622_107142722	3300022756	Groundwater Sediment	VSAYLVLLRMEVAAFHPLAFDSKRLVSVALFLAFIGRANGDL
Ga0208005_11661912	3300025848	Aqueous	LVLLRMEVAAFHPPRFDPRRLVSVALFLAFVIRASGDL
Ga0207645_100261292	3300025907	Miscanthus Rhizosphere	LVLLRMEVAAFHPLAREGKRLVSVALFLVFIGRASGDL
Ga0210104_10009731	3300025956	Natural And Restored Wetlands	YLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL
Ga0210104_10027973	3300025956	Natural And Restored Wetlands	YLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL
Ga0210069_10052242	3300025958	Natural And Restored Wetlands	LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL
Ga0210103_10592932	3300025968	Natural And Restored Wetlands	ANCASAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIDRASGDL
Ga0208292_10158032	3300026072	Natural And Restored Wetlands	LVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL
Ga0207708_108891931	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	VLLRMEVAAFHPLAREGKRLVSVSLFLVFIGRASGDL
Ga0209687_12225222	3300026322	Soil	YLVLLRMEVAAFHPLPFDWKRLVSVALFLAFTRRASGGL
Ga0256808_10130012	3300026476	Sediment	RATLAYLVLLRMEVAAFHPLPDEGQRLVSVALFLAFVGRANGDL
Ga0209474_102399922	3300026550	Soil	ADVTRAASMSAYLVLLRMEVAAFHPLPFDWKRLVSVALFLAFVHRASGDL
Ga0208893_10043481	3300026857	Soil	VSAYLVLLRMEVTAFHPPPFDRRRLVSVALFLAFIGRANGDL
Ga0209397_103259202	3300027871	Wetland	MSAYLVLLRMEVAAFHPPGRSPGRLVSVALFLAFVIRASGDL
Ga0209397_107114621	3300027871	Wetland	MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL
Ga0209450_107434961	3300027885	Freshwater Lake Sediment	MLLRMEVAAFHPPPFEGKRLVSVALFLAFIHRANGDL
Ga0209253_101791942	3300027900	Freshwater Lake Sediment	LVLLRMEVAAFHPLPCDGKRLVSVALFLAFIGRANGDL
Ga0247820_105544332	3300028597	Soil	SAYLVLLRMEVAAFHPLSRSCLPGKRLVSVALFLAFTCRASGGL
Ga0302160_101013532	3300028665	Fen	VSAYLVLLRMEVTAFHPPPFYRRRLVSVALFLAFIDRANGDL
Ga0302256_102329773	3300028741	Fen	MEVAAFHPLPDQFDPEWQRLVSVALFIAFIGRANGDL
Ga0302262_101994512	3300028743	Fen	AYLVLLRMEVTAFHPPPCNGRRLVSVALFLAFVGRANGDL
Ga0311332_103353622	3300029984	Fen	MSAYLVLLRMEVAAFHPLSCDRKRLVSVALFLAFIGRANGDL
Ga0311334_100801413	3300029987	Fen	VSAYLVLLRMEVTAFHPLPCDRKRLVSVALFLAFIGRANGDL
Ga0311336_100029631	3300029990	Fen	VSAYLVLLRMEVTAFHPPPFKGRRLVSVALFLAFIGRANGD
Ga0311337_116616431	3300030000	Fen	SAYLVLLRMEVAAFHPPRFDARRLVSVALFLAFIGRANGDL
Ga0311350_107216182	3300030002	Fen	SAYLVLLRMEVTAFHPPPFDRKRLVSVALFLAFIGRANGDL
Ga0311349_107517841	3300030294	Fen	LVLLRMEVAAFHPLAREGKRLVSVALFLTFIHRANGDL
Ga0302323_1007852913	3300031232	Fen	MEVAAFHPLPDQFDPERQRLVSVALFIAFIGRANGDL
Ga0318516_105312582	3300031543	Soil	ASSSAYLVLLRMEVAAFHPPRCYPRRLVSVALFLAFVGRANGDL
Ga0310886_109330172	3300031562	Soil	CVAKCTSAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL
Ga0302321_1001120375	3300031726	Fen	SVSAYLVLLRMEVTAFHPPPFKGRRLVSVALFLAFIGRANGDL
Ga0302321_1021549662	3300031726	Fen	VSAYLVLLRMEVTAFHPPPFDRKRLVSVALFLAFIGRA
Ga0315290_108222242	3300031834	Sediment	LVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL
Ga0315297_1000028315	3300031873	Sediment	VSAYLVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL
Ga0315297_101643623	3300031873	Sediment	VSAYLVLLRMEVTSFHPLACEGKRLVSVALFLAFIGRANGDL
Ga0311367_120882851	3300031918	Fen	MEVAAFHPLPDQFDPEWQRLVSVALFIAFIGRANG
Ga0310901_106036782	3300031940	Soil	AKCTSAYLVLLRMEVAAFHPLPCDRKRLVSVALFLAFIGRANGDL
Ga0310906_105903931	3300032013	Soil	AYLVLLRMEVAAFHPPRCDPRRLVSVALFLAFVGRASGDL
Ga0315272_105453571	3300032018	Sediment	LLRMEVTAFHPPPFNGRRLVSVALFLAFVGRANGDL
Ga0318553_102157362	3300032068	Soil	RRAASSSAYLVLLRMEVAAFHPPRCYPQRLVSVALFLAFVRRANGDL
Ga0315276_112166222	3300032177	Sediment	MEVAAFHPPRFDPRRLVSVALFLAFVSRANGDLLR
Ga0307471_1041920501	3300032180	Hardwood Forest Soil	ADVTRAASMSAYLVLLRMEVAAFHPLPVAGQRLVSVALFLAFIHRASGDL
Ga0315271_107051471	3300032256	Sediment	LRMEVAAFHPLPDRFDPERPRLVSVALFIAFIGRANGDL
Ga0315271_113024641	3300032256	Sediment	LVLLRMEVAAFHPPRFDPRRLVSVALFLAFVNRANGDL
Ga0315271_116460731	3300032256	Sediment	VAAFHPLPRRYDPERTRLVSVALFIAFIGRANGDL
Ga0306920_1036359021	3300032261	Soil	LVLLRMEVAAFHPPRCYPRRLVSVALFLAFVGRANGDL
Ga0315270_101041852	3300032275	Sediment	MEVAAFHPLPDRFDPERQRLVSVALFIAFIGRANGDL
Ga0315287_100564611	3300032397	Sediment	VSAYLVLLRMEVAAFHPLPDRFDPERQRLVSVALFIAFIG
Ga0315287_107015742	3300032397	Sediment	SAYLVLLRMEVAAFHPLPFDGKRLVSVALFLAFVGRASGDL
Ga0335082_100420004	3300032782	Soil	MSAYLVLLRMEVAAFHPPRYDPWRLVSVALFLAFVGRASGDL
Ga0335080_111420812	3300032828	Soil	LVLLRMEVAAFHPPAFDGRRLVSVALFLAFIDRASGDL
Ga0335084_122242062	3300033004	Soil	LVLLRMEVAAFHPPAFDGRRLVSVALFLAFAGRASGDL
Ga0316605_101927742	3300033408	Soil	LVLLRMEVAAFHPPPTRYDPERKRLVSVALFIAFIGRANGDL
Ga0316605_101940093	3300033408	Soil	MLLRMEVAAFHPLPFDGKRLVSVALFLAFVHRASGDL
Ga0316605_103147942	3300033408	Soil	MLLRMEVAAFHPPPFDRRRLVSVALFLAFIGRASGDL
Ga0316600_105702062	3300033481	Soil	LVLLRMEVAAFHPPPTRYDPERKRLVSVALFIAFVGRANGDL
Ga0316627_1000818712	3300033482	Soil	MLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRVSGDL
Ga0316627_1010221202	3300033482	Soil	CVAKCTSAYLMLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL
Ga0316629_105315031	3300033483	Soil	LVLLRMEVAAFHPLPFDGKRLVSVALFRAFIGRASGDL
Ga0316629_107260121	3300033483	Soil	RAACVAKCTSAYLMLLRMEVAAFHPLPFDGKRLVSVALFLAFIHRASGDL
Ga0370501_0063731_2_121	3300034195	Untreated Peat Soil	YLVLLRMEVTAFHPPACDSRRLVSVALFLAFVGRANGDL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F037791

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign