Basic Information | |
---|---|
Family ID | F037904 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 167 |
Average Sequence Length | 45 residues |
Representative Sequence | MNYGTLPSRFLNAVDNLPNPRAQMVRRDGRWESISSQEFLRR |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 167 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 35.93 % |
% of genes near scaffold ends (potentially truncated) | 98.20 % |
% of genes from short scaffolds (< 2000 bps) | 91.02 % |
Associated GOLD sequencing projects | 116 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.012 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.138 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.533 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.713 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 11.43% Coil/Unstructured: 67.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 167 Family Scaffolds |
---|---|---|
PF01175 | Urocanase | 32.34 |
PF07238 | PilZ | 3.59 |
PF00501 | AMP-binding | 1.20 |
PF05096 | Glu_cyclase_2 | 1.20 |
PF01979 | Amidohydro_1 | 0.60 |
PF01042 | Ribonuc_L-PSP | 0.60 |
PF06983 | 3-dmu-9_3-mt | 0.60 |
PF00665 | rve | 0.60 |
PF08818 | DUF1801 | 0.60 |
PF05199 | GMC_oxred_C | 0.60 |
PF14559 | TPR_19 | 0.60 |
PF08327 | AHSA1 | 0.60 |
PF07110 | EthD | 0.60 |
PF07969 | Amidohydro_3 | 0.60 |
PF01408 | GFO_IDH_MocA | 0.60 |
PF12852 | Cupin_6 | 0.60 |
PF03713 | DUF305 | 0.60 |
PF12681 | Glyoxalase_2 | 0.60 |
PF00753 | Lactamase_B | 0.60 |
PF13290 | CHB_HEX_C_1 | 0.60 |
PF07883 | Cupin_2 | 0.60 |
PF04366 | Ysc84 | 0.60 |
COG ID | Name | Functional Category | % Frequency in 167 Family Scaffolds |
---|---|---|---|
COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 32.34 |
COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.60 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.60 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.60 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.60 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.60 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.60 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.60 |
COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.60 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.60 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.60 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.01 % |
Unclassified | root | N/A | 5.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY01DNZH9 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101208976 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300002917|JGI25616J43925_10194527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300002917|JGI25616J43925_10393085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300004082|Ga0062384_101128637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300005093|Ga0062594_100765834 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300005176|Ga0066679_11007932 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005332|Ga0066388_108676106 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300005467|Ga0070706_101357551 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005536|Ga0070697_101406556 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005545|Ga0070695_101430329 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300005554|Ga0066661_10849693 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005559|Ga0066700_10592882 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300005764|Ga0066903_102452880 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300005764|Ga0066903_106268041 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300005841|Ga0068863_100228293 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
3300005921|Ga0070766_10095306 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300005952|Ga0080026_10173487 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300006028|Ga0070717_10124064 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
3300006031|Ga0066651_10826619 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006050|Ga0075028_101043864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300006172|Ga0075018_10705124 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006173|Ga0070716_100816821 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300007255|Ga0099791_10274644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300007258|Ga0099793_10303914 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300007258|Ga0099793_10423503 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300009012|Ga0066710_102046460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300009038|Ga0099829_10558637 | Not Available | 951 | Open in IMG/M |
3300009088|Ga0099830_10426992 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300009088|Ga0099830_10745476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300009088|Ga0099830_11169414 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300009089|Ga0099828_10999393 | Not Available | 745 | Open in IMG/M |
3300009089|Ga0099828_11431139 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300009090|Ga0099827_11339170 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300009525|Ga0116220_10081119 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300010048|Ga0126373_10874822 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300010321|Ga0134067_10111381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
3300010321|Ga0134067_10508633 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010333|Ga0134080_10512369 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300010337|Ga0134062_10048195 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
3300010360|Ga0126372_12324876 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300010366|Ga0126379_10372333 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
3300010366|Ga0126379_10533674 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300010366|Ga0126379_11956191 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300011269|Ga0137392_10551089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300011269|Ga0137392_10958422 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300011270|Ga0137391_10094753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2583 | Open in IMG/M |
3300011270|Ga0137391_10204422 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
3300011270|Ga0137391_10349746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1269 | Open in IMG/M |
3300011270|Ga0137391_10413869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
3300011270|Ga0137391_11398562 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300011271|Ga0137393_10031736 | All Organisms → cellular organisms → Bacteria | 4001 | Open in IMG/M |
3300012189|Ga0137388_10467002 | Not Available | 1171 | Open in IMG/M |
3300012189|Ga0137388_11737504 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300012202|Ga0137363_10110035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2108 | Open in IMG/M |
3300012202|Ga0137363_10365920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
3300012202|Ga0137363_10375909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
3300012202|Ga0137363_10452409 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300012203|Ga0137399_11052513 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300012203|Ga0137399_11145432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300012205|Ga0137362_10140738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2057 | Open in IMG/M |
3300012206|Ga0137380_10506568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
3300012206|Ga0137380_11609845 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300012210|Ga0137378_10444097 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300012210|Ga0137378_11170797 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300012357|Ga0137384_10212747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1617 | Open in IMG/M |
3300012361|Ga0137360_10410281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
3300012362|Ga0137361_10329838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1399 | Open in IMG/M |
3300012363|Ga0137390_10629868 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300012582|Ga0137358_10092046 | Not Available | 2050 | Open in IMG/M |
3300012922|Ga0137394_10761139 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300012927|Ga0137416_10185816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1657 | Open in IMG/M |
3300012929|Ga0137404_10505129 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300012944|Ga0137410_11433410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300012972|Ga0134077_10391972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
3300012975|Ga0134110_10055878 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300012975|Ga0134110_10246243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300014501|Ga0182024_10031174 | All Organisms → cellular organisms → Bacteria | 9130 | Open in IMG/M |
3300015054|Ga0137420_1045882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
3300015197|Ga0167638_1099794 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300015241|Ga0137418_10410591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
3300015241|Ga0137418_10842287 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300015242|Ga0137412_10007466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8769 | Open in IMG/M |
3300015242|Ga0137412_10415171 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300015264|Ga0137403_10896701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300016319|Ga0182033_10114357 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300016357|Ga0182032_10773861 | Not Available | 810 | Open in IMG/M |
3300016387|Ga0182040_11338504 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300016422|Ga0182039_10394593 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300017823|Ga0187818_10494055 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300017823|Ga0187818_10584453 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300017942|Ga0187808_10411159 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300017943|Ga0187819_10339609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300017993|Ga0187823_10393963 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300017995|Ga0187816_10465083 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300018006|Ga0187804_10486015 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300018090|Ga0187770_11745435 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300020140|Ga0179590_1129009 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300020579|Ga0210407_10695311 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300020579|Ga0210407_11066145 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300020579|Ga0210407_11252548 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300020581|Ga0210399_10657373 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300020581|Ga0210399_10687066 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300021088|Ga0210404_10466538 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300021088|Ga0210404_10686058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300021170|Ga0210400_10007431 | All Organisms → cellular organisms → Bacteria | 9075 | Open in IMG/M |
3300021170|Ga0210400_11201353 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300021170|Ga0210400_11637591 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300021171|Ga0210405_10979831 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300021178|Ga0210408_10041120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3631 | Open in IMG/M |
3300021178|Ga0210408_10330659 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300021401|Ga0210393_11172531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300021406|Ga0210386_11307867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300021433|Ga0210391_10213863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium OLB17 | 1515 | Open in IMG/M |
3300021476|Ga0187846_10390813 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300021478|Ga0210402_10997077 | Not Available | 764 | Open in IMG/M |
3300021559|Ga0210409_10029132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5321 | Open in IMG/M |
3300021559|Ga0210409_11433705 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300021560|Ga0126371_11615449 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300024323|Ga0247666_1047447 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300024330|Ga0137417_1345637 | Not Available | 1388 | Open in IMG/M |
3300025899|Ga0207642_10421484 | Not Available | 803 | Open in IMG/M |
3300025900|Ga0207710_10136268 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300025939|Ga0207665_10754231 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300025939|Ga0207665_10862967 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300026322|Ga0209687_1167756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300026323|Ga0209472_1039864 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
3300026325|Ga0209152_10138295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300026446|Ga0257178_1033513 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300026494|Ga0257159_1023009 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
3300026551|Ga0209648_10635427 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300026551|Ga0209648_10814871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300026557|Ga0179587_10120400 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300026859|Ga0207859_1022146 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300026988|Ga0207834_1009503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1391 | Open in IMG/M |
3300027648|Ga0209420_1092931 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300027663|Ga0208990_1112134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300027768|Ga0209772_10259900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300027855|Ga0209693_10290495 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300027862|Ga0209701_10467224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300027882|Ga0209590_10527508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
3300027898|Ga0209067_10577031 | Not Available | 644 | Open in IMG/M |
3300028536|Ga0137415_10416776 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300030991|Ga0073994_10039789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300030991|Ga0073994_11875824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → alpha proteobacterium U9-1i | 521 | Open in IMG/M |
3300031544|Ga0318534_10204829 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300031564|Ga0318573_10248284 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300031708|Ga0310686_106284449 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300031744|Ga0306918_11503553 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031754|Ga0307475_11214494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
3300031754|Ga0307475_11295540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300031835|Ga0318517_10349397 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300031879|Ga0306919_10459257 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300031890|Ga0306925_10707445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
3300031942|Ga0310916_10985654 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300031947|Ga0310909_11035839 | Not Available | 669 | Open in IMG/M |
3300031962|Ga0307479_10349225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1462 | Open in IMG/M |
3300031962|Ga0307479_10364400 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300031962|Ga0307479_10666511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300031962|Ga0307479_11809096 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300032180|Ga0307471_102559244 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300032205|Ga0307472_101685481 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300032805|Ga0335078_10050872 | All Organisms → cellular organisms → Bacteria | 6124 | Open in IMG/M |
3300032805|Ga0335078_10270548 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
3300033480|Ga0316620_10445678 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300033547|Ga0316212_1054612 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300033983|Ga0371488_0147388 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.37% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.19% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.19% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.99% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.80% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.80% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.60% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.60% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.60% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.60% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.60% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.60% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
3300026988 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_00602690 | 2170459010 | Grass Soil | MTYGTLPSRFLNAIDSRPNSRAQMFRHPDSTWESITSAELLRRIAGLSMALVE |
JGIcombinedJ26739_1012089763 | 3300002245 | Forest Soil | MTYGTLPSRFLHAVDELPSPRAQLYRHTDRWEAISSQE |
JGI25616J43925_101945271 | 3300002917 | Grasslands Soil | MNYGTLPSRFLNAVDNLPNPRAQMFRRDGRWETIGSQEFLRRVA |
JGI25616J43925_103930852 | 3300002917 | Grasslands Soil | MNYGTLPSRFLNAIDNLPNPRAQMVRRDGRWEAISSQEFLR |
Ga0062384_1011286372 | 3300004082 | Bog Forest Soil | MNYASLPTRLLYAMDTFPTPRAQMVRRGGKWEEISSQEFLRRV |
Ga0062594_1007658341 | 3300005093 | Soil | MSYGTLPSRFLKAIDSLPNPRAQLTRRANVWEPITSAEFLRRVAGLSMAL |
Ga0066679_110079321 | 3300005176 | Soil | MTYGTLPSRFLNAIDSSPNPRAQMFRHPDSTWESIASSELLR |
Ga0066388_1086761062 | 3300005332 | Tropical Forest Soil | MYIQFSMSYGILPSHFLAAVEEHPSPRAQMFRGPNGWESIPSQEFLR |
Ga0070706_1013575512 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYGTLLSRLLNAVDSYPNPRAQLVRRNNIWEPISSAEFLRRVAGLSMALVE |
Ga0070697_1014065562 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYGTLTSRFLQAMDSRPNARAQMFRHPDSTWEAISSAELL |
Ga0070695_1014303292 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYGTLPSRFLKAIDSLPNPRAQLTRRANVWEPISSAEFLR |
Ga0066661_108496931 | 3300005554 | Soil | MNSTTTYGTLPSRLLNALDSLPNPRAQIVRRNGRWEAIPSQDFLRRVAGLST |
Ga0066700_105928822 | 3300005559 | Soil | MSYGTLPSRFLKAIDSLPNPRAQLTRRANVWEPISSVEFL |
Ga0066903_1024528801 | 3300005764 | Tropical Forest Soil | MSYDALPSRFLSAVDRYPSPRAQMVRRAGRWEAISSQEFLRRV |
Ga0066903_1062680412 | 3300005764 | Tropical Forest Soil | MRYSESRASTQNMTYGTLPSRFLNAVDNLANGRAQVVRRDGRWEAIPSQEFLRRVAGLSTALVELGVK |
Ga0068863_1002282931 | 3300005841 | Switchgrass Rhizosphere | MSYGTLPSRFLKAIDSLPNPRAQLTRRANVWEPITSAEFLRRVAGLSMALV |
Ga0070766_100953062 | 3300005921 | Soil | MNYGTLPSRLLNALDSLSNPRAQMFRGADGWKPISSEEL |
Ga0080026_101734872 | 3300005952 | Permafrost Soil | MTYGTLPSRFLNAIDSLPNPRAQMFRRENLWHPISSAELLRRVAG |
Ga0070717_101240644 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYGTLPSRFLNAIDSRPNEHAQMVRRSGAWESIPSAELLRRVAGLSMALVELGIKP |
Ga0066651_108266192 | 3300006031 | Soil | MTYGTLTSRLLNAVDHLPNPRAQRVRRAGQWEAVSSEEFLRRVAGLSSALVELG |
Ga0075028_1010438642 | 3300006050 | Watersheds | MNYGTLPSRFLIAVDTMPNPRAQMVRRADRWESIPSQEFLRR |
Ga0075018_107051241 | 3300006172 | Watersheds | MNYGTLPSRFLHAVIELPNPRAQMFRREDSWHEIS |
Ga0070716_1008168211 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYATLPSRFLNAVDSVPNARAQMARRGEQWDSISSAEFLRRVAGLSSALVELGVKPGDR |
Ga0099791_102746442 | 3300007255 | Vadose Zone Soil | MNYGTLPSRLLTVIDKLPNARAQMVRRDGRWEPISSQEFL |
Ga0099793_103039142 | 3300007258 | Vadose Zone Soil | MNYGTLPSRLLKVIDGLPNPRAQMVRREGRWDAISSQEF |
Ga0099793_104235032 | 3300007258 | Vadose Zone Soil | MNYGTLTSRFLQAMDSRPNARAQMFRHPDSTWEAISSAELLRRVAGL |
Ga0066710_1020464602 | 3300009012 | Grasslands Soil | MNYGTLPSRFLNAIDNLPNPRAQMVCRDGRWQAIGSQEFLRRVAGLSTAF |
Ga0099829_105586371 | 3300009038 | Vadose Zone Soil | MNYGTLPSRFLSAIDSHPNSRAQMFRHDDSTWESIASAELLRRVAGLSMALVELGVKPGD |
Ga0099830_104269921 | 3300009088 | Vadose Zone Soil | MNYGTLPSRFLNAIDSRPNSRAQMFRHADSSWESISSAELLRRVAGLSMALVELGVKPGDRV |
Ga0099830_107454762 | 3300009088 | Vadose Zone Soil | MNYGTLPSRFLNVVDNLPNPRAQMVRRDGRWESISSQEFLRRV |
Ga0099830_111694141 | 3300009088 | Vadose Zone Soil | MNYGTLPSRFLNAIDSRPNSRAQIFRHADSTWESISSAELLRRVAGLSMALVELGVKPGDPV |
Ga0099828_109993931 | 3300009089 | Vadose Zone Soil | MNYGTLPSRFLSAIDAHPNSRAQMLRHADSTWESIASAELLRR |
Ga0099828_114311392 | 3300009089 | Vadose Zone Soil | MNYGTLPSRFLNVVDNLPNPRAQMVRRDGRWEPISS |
Ga0099827_113391702 | 3300009090 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNPRAQMFRRDGRWQPIS |
Ga0116220_100811192 | 3300009525 | Peatlands Soil | MNYASLPSRFLHAIDEHPSPRAQLARGSEGWVPISSQEFLRRVA |
Ga0126373_108748221 | 3300010048 | Tropical Forest Soil | MYIQFSMNYGILPSHFLAAVEEHPSPRAQMFRGPNGWESIPSQEFLRR |
Ga0134067_101113812 | 3300010321 | Grasslands Soil | MTYGTLTSRLLNAVDHLPNPRAQRVRRAGQWEAVSSEEFLRRVAGLSSALVE |
Ga0134067_105086331 | 3300010321 | Grasslands Soil | MSYGTLPSRFLNTVDHLPHPRAQMARRDGKWQAVSS |
Ga0134080_105123691 | 3300010333 | Grasslands Soil | MNYGTLPSRFLNAVDNLPNPRAQMFRRDGRWQPITSQEF |
Ga0134062_100481951 | 3300010337 | Grasslands Soil | MNYGTLPSRFLNAVDTHPNPRAQMVRRDGRWEAIASQEF |
Ga0126372_123248762 | 3300010360 | Tropical Forest Soil | MSYGTLPSRFLNAIDSLPTPRAQLTRRNNAWQSISSAEFLRRVAGLSMALVE |
Ga0126379_103723331 | 3300010366 | Tropical Forest Soil | MNYGTLPSRLLTALDSHPNPRTQLFRRGEVWEAISSTEFLRRIAGLSTAFVELGVKPGERVI |
Ga0126379_105336741 | 3300010366 | Tropical Forest Soil | MGYSTLPCRFLQAVDEHPSPRAQMVRRRERWDAISSQEFLRRVAGLADCF |
Ga0126379_119561911 | 3300010366 | Tropical Forest Soil | MDYGTLPIRFLNAVEEYPSPRAQMFRGRERWEAISSQEMA |
Ga0137392_105510892 | 3300011269 | Vadose Zone Soil | MINYGTLPSRFLNAVDNLPNPRAQMVRRDGRWESISSQEFLRRV |
Ga0137392_109584221 | 3300011269 | Vadose Zone Soil | MNYGTLPSRFLNAIDTLPNQRAQMVRGPHSWEAISSEELLRRVAGLSSALVELGVKPG |
Ga0137391_100947531 | 3300011270 | Vadose Zone Soil | MNYGTLPSRFLNVVDNLPNPRAQMIRRDGRWEAIASQEFLRRVAGLSA |
Ga0137391_102044221 | 3300011270 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNARAQMVRRDGRWQAISSQEFLGR |
Ga0137391_103497461 | 3300011270 | Vadose Zone Soil | MNYGTLPSRFMNAIDNLPNPRAQMIRRDGRWEAIASQEFLH |
Ga0137391_104138691 | 3300011270 | Vadose Zone Soil | MMNYGTLPSRFLNAVDNLPNPRAQMVRRDGRWESISSQEFL |
Ga0137391_113985621 | 3300011270 | Vadose Zone Soil | MNYGTLPSRFLNAVDSLPNPRAQMSRGADRWTAISSEELLRRVA |
Ga0137393_100317361 | 3300011271 | Vadose Zone Soil | MNYGTLPSRFLSAIDSRPNSRAQMFRHADSSWESISSAE |
Ga0137388_104670022 | 3300012189 | Vadose Zone Soil | MNYGTLPSRFLSAIDSHPNSRAQMFRHADSSWESISSAELLRRIAGL |
Ga0137388_117375041 | 3300012189 | Vadose Zone Soil | MTYGTLPSRFLNAIDSRPNQCAQMFRHADSTWESISSTELLRRVAGLSMALV |
Ga0137363_101100354 | 3300012202 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNTRAQMVRRDGRWEAIASQEFL |
Ga0137363_103659202 | 3300012202 | Vadose Zone Soil | MNYGTLPSRLLTVIDKLPNPRAQMIRRDGRWEPISSQEFLRRVAGLSTAFV |
Ga0137363_103759091 | 3300012202 | Vadose Zone Soil | MNYGTLPSRFLNAIDNLPNPRAQMVRRDGRWETISSQEFL |
Ga0137363_104524092 | 3300012202 | Vadose Zone Soil | MTYGTLPSRFLSGIDSHPNSRAQMFRHPDSTWESISSAELLRRIAGL |
Ga0137399_110525132 | 3300012203 | Vadose Zone Soil | MNYGTLPTRFLNAVEEHPSPRAQMFRGPDSWESISSQ |
Ga0137399_111454321 | 3300012203 | Vadose Zone Soil | MNYGTLPVRFLNAVDNLPNPRAQMVRRDGRWQAITSQEFLRR |
Ga0137362_101407381 | 3300012205 | Vadose Zone Soil | MNYGTLPSRFLSAIDSYPNSRAQMFRHADSTWESISSAELLRRIAGLSMALVELG |
Ga0137380_105065681 | 3300012206 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNPRAQIFRRDGRWQPISSQEFLRRV |
Ga0137380_116098451 | 3300012206 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNPRAQMFRRDGRWQPISS |
Ga0137378_104440971 | 3300012210 | Vadose Zone Soil | MNSTTNYGTLPSRLLNTVDNLPSPRAQMMRRDGRWEAIASQEFLRRVA |
Ga0137378_111707971 | 3300012210 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNPRAQMFRRDGRWQPISSQ |
Ga0137384_102127472 | 3300012357 | Vadose Zone Soil | MTYGTLTSRLLNAVDHLPNPRAQRVRRAGQWEAVSSEEFLRRVAGLSSALVELGV |
Ga0137360_104102812 | 3300012361 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNPRAQMVRRDGRWESISSQEFLRR |
Ga0137361_103298382 | 3300012362 | Vadose Zone Soil | MNYGTLPSRFLSAIDSYPNSRAQMFRHADSTWESIS |
Ga0137390_106298681 | 3300012363 | Vadose Zone Soil | MNYGTLPSRFLSAIDSHPNSRAQMFRHADSTWESIASAELLR |
Ga0137358_100920461 | 3300012582 | Vadose Zone Soil | MNYGTLPSRLLNAIDNLPNPRAQLVRRDGRWEAISSQEFLRRVAGLSTALVELGVK |
Ga0137394_107611392 | 3300012922 | Vadose Zone Soil | MEYSDPQTMNYGTLPSRLLTVIDKLPNPRAQMVRRDGRWEPI |
Ga0137416_101858161 | 3300012927 | Vadose Zone Soil | MEYSDPQTMNYGTLPSRLLNVIDKLPNPRAQIIRRDGRWEPISSQEFLRRVAGLSTAFV |
Ga0137404_105051291 | 3300012929 | Vadose Zone Soil | MNYGTLPSRLLNAVDSLPTPRAQMFRRADGWQSISSAEFLRRVAGLSTAFVELGVHP |
Ga0137410_114334102 | 3300012944 | Vadose Zone Soil | MNYGTLPSRFLNAIDNLPNQRAQMVRRDGRWEVISSQEFLR |
Ga0134077_103919721 | 3300012972 | Grasslands Soil | MTYGTLTSRLLNAVDHLPNPRAQRVRRAGQWEAVSSEEFLRR |
Ga0134110_100558781 | 3300012975 | Grasslands Soil | MNYGTLPARFLNAVDTLPNARAQMVRRDGRWETISS |
Ga0134110_102462432 | 3300012975 | Grasslands Soil | MNYGTLPSRFLNAVDTHPNPRAQMVRRDGRWEAIASQ |
Ga0182024_1003117410 | 3300014501 | Permafrost | MTYGTLPSRFLNAIDSLPNPRAQMYRRDNLWHPISS |
Ga0137420_10458821 | 3300015054 | Vadose Zone Soil | MNYGTLPSRFLNAIDNLPNSRAQMVRRDGRWEAISSHLLAGI |
Ga0167638_10997941 | 3300015197 | Glacier Forefield Soil | MTYGTLPSRFLNAIDSLPNPRAQMFRRDHVWHAISSA |
Ga0137418_104105912 | 3300015241 | Vadose Zone Soil | MNYGTLPSRFLNAIDNLPNPRAQMVRRDGRWEAISSQEFLRRV |
Ga0137418_108422871 | 3300015241 | Vadose Zone Soil | MNYGTLPSRLLTVIDNLPNPRAQMIRRDGRWEPISSQEFLRRVAGLSTAF |
Ga0137412_100074661 | 3300015242 | Vadose Zone Soil | MNYGTLPSRFLNAVDNLPNPRAQMARRDGRWEAIASQEF |
Ga0137412_104151711 | 3300015242 | Vadose Zone Soil | MSYGTLPTRFLNAVEEHPSPRAQMFRGPDRWESISSQEFL |
Ga0137403_108967011 | 3300015264 | Vadose Zone Soil | MNNGTLPSRFLQAVDNLPNARAQMVRRSGQWESIASGEFLRRAAGLS |
Ga0182033_101143571 | 3300016319 | Soil | MSYSTLPSRFLNAVDRHPSLRAQMVRRAERWQAISSQEFLRRVA |
Ga0182032_107738611 | 3300016357 | Soil | MSYSTLPSRFLNAVDRHPSLRAQMVRRAERWEAISSQE |
Ga0182040_113385041 | 3300016387 | Soil | MAYASLPSCFLQAVDKLPSPRAQMVRRAERWEAISSQELLRRVAGLADC |
Ga0182039_103945933 | 3300016422 | Soil | MSYDALPSRFLSAVDRYPSRRAQMVRRAGRWEAISSQEFLRRVAGLA |
Ga0187818_104940551 | 3300017823 | Freshwater Sediment | MSYPTLPSRFLQAVDEYPSPRAQMFRRGDGWESISSQEFLR |
Ga0187818_105844531 | 3300017823 | Freshwater Sediment | MLYPTLPSCFLQAVDEYPSPQAQMFRRADRWEAISSQEFL |
Ga0187808_104111591 | 3300017942 | Freshwater Sediment | MSYDSLPSRFLQAVDELPSPRAQMVRRADRWEAISSQEFLRRVAGL |
Ga0187819_103396092 | 3300017943 | Freshwater Sediment | MNYGTLPSRFLNAVDNLPNPRAQLVRRNSRWETISS |
Ga0187823_103939632 | 3300017993 | Freshwater Sediment | MTYGTLPARFLQSIDAYPNSRAQMFRHADSTWEGIPSEEFLRRVAGLSMALVELGVKPGDRVGLFSA |
Ga0187816_104650831 | 3300017995 | Freshwater Sediment | MNYGTLPSRFLNAVDKLPNPRAQMFRRDGRWESIAS |
Ga0187804_104860152 | 3300018006 | Freshwater Sediment | MNYPTLPSRFLQAVDEYPSPRAQMFRRADRWEAISS |
Ga0187770_117454351 | 3300018090 | Tropical Peatland | MAYGTLPSRFLHAVDEYPSPRAQLFRRSDRWEAISL |
Ga0179590_11290091 | 3300020140 | Vadose Zone Soil | MTYGTLPSRFLNAIDSHPNPRAQMLRHPDSNWESISSAELL |
Ga0210407_106953112 | 3300020579 | Soil | MNYGTLPTRFLNAVEERPSPRAQMFRGPDRWESISSQEFLRRVAGLANAF |
Ga0210407_110661452 | 3300020579 | Soil | MTYGTLPSRFLNAIDTLPNPRAQMFRRDNLWQPISSA |
Ga0210407_112525481 | 3300020579 | Soil | MNYGTLPTRFLNAVEEHPSPRAQMFRGPDRWEAIS |
Ga0210399_106573731 | 3300020581 | Soil | MSYRTLPARFLKAVDEHPSPRAQMVRGAERWEAISSQEFLRRVAGLAD |
Ga0210399_106870661 | 3300020581 | Soil | MSYGTLPTRFLNAVEEHPSPRAQMFRGPDRWEAISSQE |
Ga0210404_104665381 | 3300021088 | Soil | MNYGTLPSRFLNAIDSRPNSRAQMFRHSDSTWESISSAELLRRVAGLSMALVELGVKPG |
Ga0210404_106860582 | 3300021088 | Soil | MNYGTLPSRFLNAVDNLPNPRAQMVRRDGRWQAISSQE |
Ga0210400_1000743110 | 3300021170 | Soil | MTYGTLPSRFVNAIDSRPNSRAQMFRRADSSWESISSAELLRRVAGLSMALVELGV |
Ga0210400_112013531 | 3300021170 | Soil | MNYGTLPSRFLNAIDSRPNQRAQMFRHADSIWESISSAEL |
Ga0210400_116375911 | 3300021170 | Soil | MSYGTLPTRFLNAVEEHPSPRAQMFRGPDRWEAISSQEFLRRV |
Ga0210405_109798311 | 3300021171 | Soil | MTYGTLPARFLNAIDTLPNPRAQMFRRDNLWQPISSAELLRR |
Ga0210408_100411203 | 3300021178 | Soil | MNNGTLPSRFLNAVDNLPNARAQMVRRSGEWESIASGEFLRRVAG |
Ga0210408_103306592 | 3300021178 | Soil | MNYGTLPSRFLNAIDSRPNSRAQMFRHSDSTWESISSAELLRRVAGLSMALVDWA |
Ga0210393_111725312 | 3300021401 | Soil | MNYGTLPSRLLNAVDSVPNPRAQMVRVNGQWQSISSQ |
Ga0210386_113078671 | 3300021406 | Soil | MNYGTLPSRFLNAIDNLPNPRAQMVRRDGRWEAIPSQE |
Ga0210391_102138631 | 3300021433 | Soil | MNYGTLPSRLLNAVDSLSNPRAQMFRAADGWKPIASEELLR |
Ga0187846_103908131 | 3300021476 | Biofilm | MNYSTLPSRFLNAVDTLPNLRAQMVRRDGHWQAISSAEFLRRVAGLS |
Ga0210402_109970772 | 3300021478 | Soil | MNYGTLPSRLLNAVDSYPNPRAQLVRRNNIWEPISSSELLRRVAGLSMALV |
Ga0210409_100291326 | 3300021559 | Soil | MNYGTLPSRFLNAVDNLPNPRAQMVRRGDRWESIPSQEFL |
Ga0210409_114337051 | 3300021559 | Soil | MDYGTLPTRFLNAVEEHPSPRAQMFRGPDRWEAISSQEFLR |
Ga0126371_116154491 | 3300021560 | Tropical Forest Soil | MSYSTLPSRFLSAVDRYPSPRAQMVRRAGRWEAISSQEFLRRVAG |
Ga0247666_10474471 | 3300024323 | Soil | MNYGTLPSRLLNAVDSLSNPRAQLVRAADGWKEISSEEMLRRIAGL |
Ga0137417_13456372 | 3300024330 | Vadose Zone Soil | MTYGTLPSRFVNAIDSRPTTRAQMFRHADSSWESIASAELLRRVAGLSMALVELGVKPGD |
Ga0207642_104214842 | 3300025899 | Miscanthus Rhizosphere | MSYGTLPSRFLKAIDSLPNPRAQLTRRANVWEPISSAEFLRRVAGLSMALVELGVKPGDRVA |
Ga0207710_101362682 | 3300025900 | Switchgrass Rhizosphere | MSYGTLPSRFLKAIDSLPNPRAQLTRRANVWEPISSAEFL |
Ga0207665_107542311 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYATLPSRFLNAVDSVPNARAQMARRGEQWDSISSAEFLRRVAGLS |
Ga0207665_108629673 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYGTLPSRFLNAIDSRPNERAQMVRRNGTWESIPSAELLRRVAGLSMALA |
Ga0209687_11677562 | 3300026322 | Soil | MTYGTLTSRLLNAVDHLPNPRAQRVRRAGQWEAVSSEEFLRRVAGLSSALVEL |
Ga0209472_10398644 | 3300026323 | Soil | MSYGTLPSRFLNAMDNLANPRAQMMRRDGRWEPVGSEEFLRRVAGLSS |
Ga0209152_101382951 | 3300026325 | Soil | MNYGTLPSRFLNAVDTHPNPRAQMVRRDGRWEALASQEFL |
Ga0257178_10335131 | 3300026446 | Soil | MNYGTLPTRFLNAVEEHPSPRAQMFRGPDGWEALSSQEFL |
Ga0257159_10230092 | 3300026494 | Soil | MNYGTLPSRLLNAIDSLPNARAQMFRAADGWKPISSEEFLRRVAGLS |
Ga0209648_106354271 | 3300026551 | Grasslands Soil | MTYGTLPSRFLNGIDSRPNQRAQMVRRNGAWESIS |
Ga0209648_108148712 | 3300026551 | Grasslands Soil | MNYGTLPSRFLNAVDNLPNPRAQMFRRDGRWQPISSQE |
Ga0179587_101204003 | 3300026557 | Vadose Zone Soil | MTYGTLPSRFLNAIDSRPNQRAQMFRHADSTWESIPSEEMLR |
Ga0207859_10221461 | 3300026859 | Tropical Forest Soil | MNYSTLPSRFLNAVDRYPSPRAQMVRRAERWEAISSQEFLR |
Ga0207834_10095031 | 3300026988 | Tropical Forest Soil | MNYSTLPSRFLNAVDRYPSPRAQMVRRAERWEAISSQEFLRRVA |
Ga0209420_10929312 | 3300027648 | Forest Soil | MSYGTLPSRFLNAVDSLPNPRAQLFRRDNTWHPIS |
Ga0208990_11121342 | 3300027663 | Forest Soil | MEYSDSQTMNYGTLPSRLLTVIDKLPNPRAQMIRRDG |
Ga0209772_102599002 | 3300027768 | Bog Forest Soil | MNYQSLPARLLYAVDTFQTPRAQMVRRGGKWEEISSQEFLRRVAGLA |
Ga0209693_102904952 | 3300027855 | Soil | MNYGTLPSRLLNAVDSLSNPRAQMFRSANGWKAIASEELLR |
Ga0209701_104672242 | 3300027862 | Vadose Zone Soil | MNYGTLPSRFLNVVDNLPNPRAQMVRRDGKWEAIPSQEFLRRV |
Ga0209590_105275082 | 3300027882 | Vadose Zone Soil | MNYGTLPSRFLNVVDNLPNPRAQMVRHDGRWDSIS |
Ga0209067_105770311 | 3300027898 | Watersheds | MNYGTLPSRFLSAVEEHPSPRAQMFRGPERWEAISSQEMLRR |
Ga0137415_104167761 | 3300028536 | Vadose Zone Soil | MTYGTLPSRFLNAIDSRPNSRAQMARRNGVWESISSAELLRRIAGLSMALVELGVKPGDR |
Ga0073994_100397891 | 3300030991 | Soil | MNYGTLPSRFLSAIDQLPNPQAQMFRHGDRWEAISSAEFLCRVAGLSSALVELGVKMG |
Ga0073994_118758242 | 3300030991 | Soil | MTYGTLPSRFLNAIDSHPTSRAQIFRHADSTWESISSAELLR |
Ga0318534_102048291 | 3300031544 | Soil | MSYDALPSRFLSAVDRYPSPRAQMVRRAGRWEAISSQEFLRRVAGLANCF |
Ga0318573_102482841 | 3300031564 | Soil | MSYDALPSRFLSAVDRYPSPRAQMVRRAGRWEAISSQEFLRRVA |
Ga0310686_1062844491 | 3300031708 | Soil | MSYGTLPSRLLNAVDSYPNPRAQLFRRNQIWEPISSAEL |
Ga0306918_115035531 | 3300031744 | Soil | MSYDALPSRFLSAVDRYPSRRAQMVRRAGRWEAISSQEFLRRVAGL |
Ga0307475_112144941 | 3300031754 | Hardwood Forest Soil | MNYGTLPSRFLNAVDNLPNPRAQMVRRADGWDSIPSQEFLRR |
Ga0307475_112955402 | 3300031754 | Hardwood Forest Soil | MTYGTLPSRFLNAVDHLPNSRAQMVRRDGKWEAVSSQEFLRRVAGL |
Ga0318517_103493972 | 3300031835 | Soil | MSYDALPSRFLSAVDRYPSPRAQMVRRAGRWEAISSQEFLRRVAG |
Ga0306919_104592573 | 3300031879 | Soil | MSYDALPSRFLSAVDRYPSPRAQMVRRAGRWEAISSQEFLRRVAGLA |
Ga0306925_107074452 | 3300031890 | Soil | MTYGTLPSRFLNAVDQLPNPRAQMVRRDGKWEAVSSEEFLRRVA |
Ga0310916_109856541 | 3300031942 | Soil | MNYGTLPTRFLNAVEEHPSHRAQMFRGPERWEAISSQEMVRRVAG |
Ga0310909_110358392 | 3300031947 | Soil | MGYSTLPCRFLQAVDEHPSPRAQMVRRGERWDAISSKEFLRRV |
Ga0307479_103492251 | 3300031962 | Hardwood Forest Soil | MNYGTLPSRFLNVVDNLPNPRAQMVRREGKWEAISS |
Ga0307479_103644001 | 3300031962 | Hardwood Forest Soil | MNYGTLPSRFLNVVDSLPNPRAQMVRRDGKWEAIPSQEFLRRVAG |
Ga0307479_106665111 | 3300031962 | Hardwood Forest Soil | MNYGTLPSRFLNAIDSRPNSRAQMFRHADSTWESISSAELLRRVAGLSMALVELGVKPG |
Ga0307479_118090961 | 3300031962 | Hardwood Forest Soil | MNYGTLPSRFLNAIDSRPNQRAQMFRHADSTWESISSAELLRRVS |
Ga0307471_1025592441 | 3300032180 | Hardwood Forest Soil | MNYGTLPSRFLNAIDTLPSPRAQMVRGLHSWEAISSEELLRRVAGLSSAL |
Ga0307472_1016854811 | 3300032205 | Hardwood Forest Soil | MNYGTLPSRFLNAIDSLPNSRAQLTRRSPNLWEPISSSEFLRRVAGFSMALVELG |
Ga0335078_100508722 | 3300032805 | Soil | MNYGTLPSRLLQAVDNLANLRAQMFRVADGWKNIASEELLRRA |
Ga0335078_102705483 | 3300032805 | Soil | MNYGTLPSRFLHAIDTWPNSRAQMIKRDGKWESISSQEFLRRVAGLSQAFFELGVKPG |
Ga0316620_104456781 | 3300033480 | Soil | MNYGTLPSRLLNAVDSLSNPRAQMFRAADGWKEISS |
Ga0316212_10546121 | 3300033547 | Roots | MNYGTLPSRLLNAVDSLSNPRAQMFRGADGWQSISSEEFL |
Ga0371488_0147388_1090_1236 | 3300033983 | Peat Soil | MNYGSLPSRFLHAIDEHPSPRAQLVRRSEGWEPISSQEFLRRVAGLSNA |
⦗Top⦘ |