Basic Information | |
---|---|
Family ID | F038032 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 166 |
Average Sequence Length | 39 residues |
Representative Sequence | MFVGRFFGKTGRGLAVAAAILAAIGLTTVPRPADAGGGW |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 166 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 92.17 % |
% of genes from short scaffolds (< 2000 bps) | 85.54 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.807 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (66.265 % of family members) |
Environment Ontology (ENVO) | Unclassified (85.542 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (67.470 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 166 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 1.81 |
PF13676 | TIR_2 | 1.20 |
PF01177 | Asp_Glu_race | 1.20 |
PF11746 | DUF3303 | 0.60 |
PF12773 | DZR | 0.60 |
PF02371 | Transposase_20 | 0.60 |
PF04972 | BON | 0.60 |
PF00872 | Transposase_mut | 0.60 |
PF00378 | ECH_1 | 0.60 |
PF09286 | Pro-kuma_activ | 0.60 |
PF12840 | HTH_20 | 0.60 |
PF16576 | HlyD_D23 | 0.60 |
PF00072 | Response_reg | 0.60 |
PF01135 | PCMT | 0.60 |
PF01007 | IRK | 0.60 |
COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.81 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.60 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.60 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.60 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.60 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.60 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.81 % |
Unclassified | root | N/A | 48.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005764|Ga0066903_105766973 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300005764|Ga0066903_107748417 | Not Available | 552 | Open in IMG/M |
3300010048|Ga0126373_10814064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 996 | Open in IMG/M |
3300010048|Ga0126373_11408177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 763 | Open in IMG/M |
3300010048|Ga0126373_12293002 | Not Available | 600 | Open in IMG/M |
3300010162|Ga0131853_11334111 | Not Available | 529 | Open in IMG/M |
3300010358|Ga0126370_11192651 | Not Available | 707 | Open in IMG/M |
3300010361|Ga0126378_10209467 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300010361|Ga0126378_11716776 | Not Available | 714 | Open in IMG/M |
3300010361|Ga0126378_12338510 | Not Available | 610 | Open in IMG/M |
3300010361|Ga0126378_12455552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 595 | Open in IMG/M |
3300010366|Ga0126379_12965672 | Not Available | 568 | Open in IMG/M |
3300010376|Ga0126381_100759419 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300010376|Ga0126381_103112332 | Not Available | 657 | Open in IMG/M |
3300010398|Ga0126383_11861616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300012989|Ga0164305_10139038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1630 | Open in IMG/M |
3300016270|Ga0182036_10663683 | Not Available | 841 | Open in IMG/M |
3300016270|Ga0182036_11537651 | Not Available | 559 | Open in IMG/M |
3300016294|Ga0182041_11453805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300016319|Ga0182033_10492891 | Not Available | 1051 | Open in IMG/M |
3300016357|Ga0182032_10805206 | Not Available | 794 | Open in IMG/M |
3300016357|Ga0182032_11148510 | Not Available | 667 | Open in IMG/M |
3300016371|Ga0182034_10043990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae | 2903 | Open in IMG/M |
3300016371|Ga0182034_10083320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2236 | Open in IMG/M |
3300016387|Ga0182040_10210227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
3300016387|Ga0182040_10394684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
3300016404|Ga0182037_10109277 | Not Available | 2008 | Open in IMG/M |
3300016445|Ga0182038_11621350 | Not Available | 582 | Open in IMG/M |
3300021088|Ga0210404_10213902 | Not Available | 1037 | Open in IMG/M |
3300021560|Ga0126371_13596280 | Not Available | 523 | Open in IMG/M |
3300025915|Ga0207693_10124014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2030 | Open in IMG/M |
3300027874|Ga0209465_10474735 | Not Available | 625 | Open in IMG/M |
3300030967|Ga0075399_11004757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
3300031474|Ga0170818_111629374 | Not Available | 718 | Open in IMG/M |
3300031543|Ga0318516_10136669 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
3300031543|Ga0318516_10242989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1041 | Open in IMG/M |
3300031543|Ga0318516_10430998 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300031543|Ga0318516_10721201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300031544|Ga0318534_10399115 | Not Available | 790 | Open in IMG/M |
3300031545|Ga0318541_10073470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1798 | Open in IMG/M |
3300031545|Ga0318541_10079745 | Not Available | 1730 | Open in IMG/M |
3300031545|Ga0318541_10153214 | Not Available | 1265 | Open in IMG/M |
3300031545|Ga0318541_10258273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
3300031545|Ga0318541_10312313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
3300031546|Ga0318538_10379267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
3300031546|Ga0318538_10500561 | Not Available | 658 | Open in IMG/M |
3300031549|Ga0318571_10340765 | Not Available | 573 | Open in IMG/M |
3300031549|Ga0318571_10428820 | Not Available | 521 | Open in IMG/M |
3300031561|Ga0318528_10068862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1819 | Open in IMG/M |
3300031561|Ga0318528_10069307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1813 | Open in IMG/M |
3300031561|Ga0318528_10313567 | Not Available | 842 | Open in IMG/M |
3300031572|Ga0318515_10127708 | Not Available | 1347 | Open in IMG/M |
3300031572|Ga0318515_10776031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300031573|Ga0310915_10095533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1999 | Open in IMG/M |
3300031573|Ga0310915_10382541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
3300031640|Ga0318555_10130984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1337 | Open in IMG/M |
3300031640|Ga0318555_10308331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
3300031668|Ga0318542_10218467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 964 | Open in IMG/M |
3300031668|Ga0318542_10450014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
3300031679|Ga0318561_10018151 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
3300031679|Ga0318561_10211587 | Not Available | 1053 | Open in IMG/M |
3300031681|Ga0318572_10580675 | Not Available | 668 | Open in IMG/M |
3300031682|Ga0318560_10187734 | Not Available | 1102 | Open in IMG/M |
3300031719|Ga0306917_10004498 | All Organisms → cellular organisms → Bacteria | 7355 | Open in IMG/M |
3300031719|Ga0306917_10133103 | Not Available | 1826 | Open in IMG/M |
3300031719|Ga0306917_10183832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1573 | Open in IMG/M |
3300031719|Ga0306917_10307050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1226 | Open in IMG/M |
3300031719|Ga0306917_11066101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
3300031723|Ga0318493_10738253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum | 553 | Open in IMG/M |
3300031724|Ga0318500_10041868 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
3300031736|Ga0318501_10134722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1260 | Open in IMG/M |
3300031744|Ga0306918_10435626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
3300031747|Ga0318502_10099604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1610 | Open in IMG/M |
3300031747|Ga0318502_10325608 | Not Available | 906 | Open in IMG/M |
3300031747|Ga0318502_10915044 | Not Available | 533 | Open in IMG/M |
3300031753|Ga0307477_10734412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
3300031763|Ga0318537_10098585 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300031765|Ga0318554_10322362 | Not Available | 879 | Open in IMG/M |
3300031768|Ga0318509_10228580 | Not Available | 1037 | Open in IMG/M |
3300031768|Ga0318509_10243677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
3300031768|Ga0318509_10594961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
3300031771|Ga0318546_10195093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1381 | Open in IMG/M |
3300031777|Ga0318543_10245121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 799 | Open in IMG/M |
3300031779|Ga0318566_10105272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
3300031780|Ga0318508_1075411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 917 | Open in IMG/M |
3300031781|Ga0318547_10536456 | Not Available | 724 | Open in IMG/M |
3300031781|Ga0318547_10731473 | Not Available | 615 | Open in IMG/M |
3300031792|Ga0318529_10540480 | Not Available | 541 | Open in IMG/M |
3300031793|Ga0318548_10062428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1729 | Open in IMG/M |
3300031793|Ga0318548_10120607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1267 | Open in IMG/M |
3300031793|Ga0318548_10298167 | Not Available | 792 | Open in IMG/M |
3300031796|Ga0318576_10155508 | Not Available | 1067 | Open in IMG/M |
3300031796|Ga0318576_10395689 | Not Available | 653 | Open in IMG/M |
3300031797|Ga0318550_10455908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
3300031819|Ga0318568_10299557 | Not Available | 998 | Open in IMG/M |
3300031821|Ga0318567_10049407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2169 | Open in IMG/M |
3300031833|Ga0310917_11132651 | Not Available | 522 | Open in IMG/M |
3300031835|Ga0318517_10027940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2241 | Open in IMG/M |
3300031846|Ga0318512_10161542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1085 | Open in IMG/M |
3300031846|Ga0318512_10221891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
3300031879|Ga0306919_10432628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
3300031880|Ga0318544_10448789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300031890|Ga0306925_11349254 | Not Available | 706 | Open in IMG/M |
3300031890|Ga0306925_11636059 | Not Available | 624 | Open in IMG/M |
3300031890|Ga0306925_12238901 | Not Available | 507 | Open in IMG/M |
3300031893|Ga0318536_10426759 | Not Available | 669 | Open in IMG/M |
3300031896|Ga0318551_10378919 | Not Available | 803 | Open in IMG/M |
3300031896|Ga0318551_10939919 | Not Available | 505 | Open in IMG/M |
3300031897|Ga0318520_10408172 | Not Available | 831 | Open in IMG/M |
3300031897|Ga0318520_10454581 | Not Available | 787 | Open in IMG/M |
3300031910|Ga0306923_10497099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1380 | Open in IMG/M |
3300031910|Ga0306923_10806258 | Not Available | 1036 | Open in IMG/M |
3300031912|Ga0306921_10547446 | Not Available | 1342 | Open in IMG/M |
3300031912|Ga0306921_10872395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1023 | Open in IMG/M |
3300031941|Ga0310912_10455987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
3300031942|Ga0310916_10299558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1361 | Open in IMG/M |
3300031945|Ga0310913_10560993 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300031947|Ga0310909_10207032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1631 | Open in IMG/M |
3300031947|Ga0310909_10218760 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300031947|Ga0310909_11042102 | Not Available | 667 | Open in IMG/M |
3300031954|Ga0306926_11593350 | Not Available | 749 | Open in IMG/M |
3300031954|Ga0306926_12172230 | Not Available | 619 | Open in IMG/M |
3300031959|Ga0318530_10060033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans | 1452 | Open in IMG/M |
3300031962|Ga0307479_11264731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
3300032009|Ga0318563_10096388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1560 | Open in IMG/M |
3300032010|Ga0318569_10462267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
3300032041|Ga0318549_10050013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum denitrificans | 1722 | Open in IMG/M |
3300032041|Ga0318549_10092766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1308 | Open in IMG/M |
3300032041|Ga0318549_10389910 | Not Available | 628 | Open in IMG/M |
3300032044|Ga0318558_10160305 | Not Available | 1086 | Open in IMG/M |
3300032044|Ga0318558_10281555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
3300032055|Ga0318575_10241725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
3300032055|Ga0318575_10513339 | Not Available | 608 | Open in IMG/M |
3300032059|Ga0318533_10033599 | All Organisms → cellular organisms → Bacteria | 3343 | Open in IMG/M |
3300032059|Ga0318533_10037727 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
3300032059|Ga0318533_10114829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1878 | Open in IMG/M |
3300032059|Ga0318533_10145999 | Not Available | 1671 | Open in IMG/M |
3300032059|Ga0318533_10237792 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300032059|Ga0318533_10693212 | Not Available | 747 | Open in IMG/M |
3300032059|Ga0318533_10825869 | Not Available | 680 | Open in IMG/M |
3300032059|Ga0318533_11002302 | Not Available | 612 | Open in IMG/M |
3300032059|Ga0318533_11454996 | Not Available | 500 | Open in IMG/M |
3300032065|Ga0318513_10283297 | Not Available | 804 | Open in IMG/M |
3300032066|Ga0318514_10309672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 835 | Open in IMG/M |
3300032068|Ga0318553_10272208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 885 | Open in IMG/M |
3300032076|Ga0306924_10461891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1449 | Open in IMG/M |
3300032076|Ga0306924_11989378 | Not Available | 599 | Open in IMG/M |
3300032091|Ga0318577_10148755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1114 | Open in IMG/M |
3300032094|Ga0318540_10644689 | Not Available | 510 | Open in IMG/M |
3300032261|Ga0306920_101835412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
3300033289|Ga0310914_10267642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1538 | Open in IMG/M |
3300033289|Ga0310914_11174402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 669 | Open in IMG/M |
3300033290|Ga0318519_10809409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 66.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.60% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.60% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066903_1057669731 | 3300005764 | Tropical Forest Soil | MTVRRFLGKTGRGLTVAAAILAVIGLTAVPRRADAGGGWGGGW |
Ga0066903_1077484172 | 3300005764 | Tropical Forest Soil | MTVISFFARTGRGLAVAAAIVAAIGLTALPRPADAGGGWGG |
Ga0126373_108140642 | 3300010048 | Tropical Forest Soil | MFVGRFFGKTDRVLAVTAAILAVVGLTTVSRPADAGGGWG |
Ga0126373_114081771 | 3300010048 | Tropical Forest Soil | MTVISFFERTGRGLAVAAAILTAIGVTTVPRPADAGGGWGGGISPGAA |
Ga0126373_122930021 | 3300010048 | Tropical Forest Soil | MTVDRFFGKTGRGLAIAAAILAAIGLTTVPRPADAGGGW |
Ga0131853_113341112 | 3300010162 | Termite Gut | MIVGRLFGKTGRGLTVTAAILAAIGLTTVPRPADAGGGWG |
Ga0126370_111926511 | 3300010358 | Tropical Forest Soil | MTIVRFAGKTSRDLAVAVAILAAIGLTRVPRPADAGGWGGGGISPGAAVAL |
Ga0126378_102094671 | 3300010361 | Tropical Forest Soil | MIAFFGKTGRGLAVAAAILAAIGLTTAPRPADAGGGWGGG |
Ga0126378_117167762 | 3300010361 | Tropical Forest Soil | MTVDRFFGKTGRGLAVAAAILAAIGLTTVPRPADAGGGWGGG |
Ga0126378_123385101 | 3300010361 | Tropical Forest Soil | MIVGRLFGKTGRGLAVAAAILAAIGLTTVPRPADAGGGW |
Ga0126378_124555521 | 3300010361 | Tropical Forest Soil | MTVISFFERTGRGLAIAAAIFAAIGVTTLPRPADAGGGWG |
Ga0126379_129656721 | 3300010366 | Tropical Forest Soil | MTVGRFFVKTGRGLAIAAAILVAVGLTTAPRPADAGGWGGGGI |
Ga0126381_1007594191 | 3300010376 | Tropical Forest Soil | MSFGRFFGKPGRGLAVAAAILAAIGLTTMPRPADAGGGW |
Ga0126381_1031123321 | 3300010376 | Tropical Forest Soil | MTVDRFFGKTGRGLAVTVAILAVVGLTTAPRPAHAGG |
Ga0126383_118616161 | 3300010398 | Tropical Forest Soil | MTVGKFFGKTGRGLAAAAILSIIGLTALPQPADAGEGWGGGGISPGAA |
Ga0164305_101390381 | 3300012989 | Soil | MSVGRFFGKTSPGLAVTAAILAAIGLPTVPRPADAGGGWVGVGSALV |
Ga0182036_106636831 | 3300016270 | Soil | MTVGRLFGKTGRGLVVAAAILAAIGLTTVPRPADAGG |
Ga0182036_115376511 | 3300016270 | Soil | MTIGRFFGKTSRALAVAAAILAAIGLTAVPRPADAGGGWGG |
Ga0182041_114538051 | 3300016294 | Soil | MTVGRFFGKTGRGLAVVAIFAATGLTTEPRPADAGG |
Ga0182033_104928913 | 3300016319 | Soil | MTAGRFFGTTGRGLAVAAILAAIGLTTVPRPADAGGGWGG |
Ga0182032_108052061 | 3300016357 | Soil | MTVGRNSGKTGRRLAAGAAILAAVGLTTLPRPADA |
Ga0182032_111485101 | 3300016357 | Soil | MTGGRFFEKTGRGLTAAAAILAAVGLTTVPRPADAGGWGGGG |
Ga0182034_100439908 | 3300016371 | Soil | MTSGRFFGKTSRTLAVAAAILAAVGLTTLPKPADA |
Ga0182034_100833201 | 3300016371 | Soil | MIVGRFFGKTGRGLATAAAIFAAIGLTTVPRPADAGGVWGGGGISPGAA |
Ga0182040_102102273 | 3300016387 | Soil | MIVGRFFGKTGRGLAVAAAILAAIGLTTVPRPAGAG |
Ga0182040_103946841 | 3300016387 | Soil | MFVGRFFGKTGRGLAVAAAILAAIGLTTLPRPADAGGG |
Ga0182037_101092771 | 3300016404 | Soil | MTVGRLFGKTGRGLVFAAAILAAIGLTTVPRPADAGGG |
Ga0182037_114632732 | 3300016404 | Soil | MIARFIGKIGRPLATAAAILAVIGLATVPRPADAGGGW |
Ga0182038_101297041 | 3300016445 | Soil | MIGRFIGKIGRPLATAAAILAVIGLATVPRPADAGGGWGG |
Ga0182038_116213502 | 3300016445 | Soil | MTVGRFFGKTSRVLAVAAAILAAVGLTAVPRPADAGGGWGGG |
Ga0210404_102139023 | 3300021088 | Soil | MIVGRFFGKTGRGLAIAAAILAAIGLTTVPRPAYAGGGW |
Ga0126371_135962801 | 3300021560 | Tropical Forest Soil | MMVGRFFGKAGRGLAVAAAIVATIGLTTLPHPANAGGG |
Ga0207693_101240143 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVGRFFGKTGRGLAIAAAILAAIGLTTVPRPAYAGGG |
Ga0209465_104747351 | 3300027874 | Tropical Forest Soil | MMLGNFLGKTGRGLAVAAAILAAVGLTTAPRPAHAGGIGPGA |
Ga0075399_110047572 | 3300030967 | Soil | MTVRRFSGKTGRGLAAAAAILAAIGSATVPRPADAG |
Ga0170818_1116293741 | 3300031474 | Forest Soil | MIVGRFFGKTGWRLAVAAALLATIGLTTVPRPADAGGGWG |
Ga0318516_101366691 | 3300031543 | Soil | MKVGRFFFGKTGRALAVTAAILAGIGLTTVPRSATAGGGW |
Ga0318516_102429892 | 3300031543 | Soil | MIVGRFFGKTGRGLAATAAILTAIGLTTVPRPADAGGGWGG |
Ga0318516_104309982 | 3300031543 | Soil | MTSGRFFGKTRRTLAVAAAILAAVGLTTLPEPADAGGGGISPS |
Ga0318516_107212012 | 3300031543 | Soil | MTVCKFFGRTGRGLAVAAAILAAIGLTTVPRPADAGEGWHGGGISPGAAVGI |
Ga0318534_103991152 | 3300031544 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADAGG |
Ga0318534_106420321 | 3300031544 | Soil | MMFGRLLEKTGRGLAVATALVAAVGLTTVPRPADAG |
Ga0318541_100734701 | 3300031545 | Soil | MIVGRFFGKTGRGLAATAAILTAIGLTTVPRPADAGGG |
Ga0318541_100797451 | 3300031545 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADAGGGW |
Ga0318541_101532143 | 3300031545 | Soil | MIVGKFFGKTGRGLTITAAILAAIGLTAVPRPADAGGGW |
Ga0318541_102191761 | 3300031545 | Soil | MAVDRFFRKTGRGLAVAAAILAAIGLTTAPRPADAGGWGGDQTSELVSEIPQIPC |
Ga0318541_102582731 | 3300031545 | Soil | MKVGRFFFGKTGRGLAVTAAILAAIGLTTVPRPATAGG |
Ga0318541_103123131 | 3300031545 | Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRAADAGGWGGGGISPGAAV |
Ga0318538_103792673 | 3300031546 | Soil | MTVNRFFRKTGRGLATAAAVLTAIGLTTVPRPADAGGGW |
Ga0318538_105005612 | 3300031546 | Soil | MIVARFFGKTGRGLAVAASILAAIGLTTVPRPADAGGGWVGGGIS |
Ga0318571_103407652 | 3300031549 | Soil | MTIGRFFGKTSRALAVAAAILAAIGLTAVPRPADA |
Ga0318571_104288201 | 3300031549 | Soil | MKVGRFFFGKTGRGLAVTAAILAAIGLTTVPRPATAGGGW |
Ga0318528_100688625 | 3300031561 | Soil | MTVGRIFGKTGRGLAVAAAILAAIGLTTVPRPAEAGGG |
Ga0318528_100693074 | 3300031561 | Soil | MIVGRLFGKTGRGLAATAAILTAIGLTTVPRPADAGGG |
Ga0318528_103135672 | 3300031561 | Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRPADA |
Ga0318515_101277083 | 3300031572 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADAGGGWGGGAISPGA |
Ga0318515_107760312 | 3300031572 | Soil | MTVGRIFGKTGRGLAVAAAILAAIGLTTVPRPAEAGGGWGGG |
Ga0310915_100955333 | 3300031573 | Soil | MIVSRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGGGWGGG |
Ga0310915_103825411 | 3300031573 | Soil | MIVGRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGG |
Ga0318555_101309842 | 3300031640 | Soil | MTICRFFGKTVRGLAVAAAILAIIGLTTTPRPAHAGGGW |
Ga0318555_103083313 | 3300031640 | Soil | MTVGRFFRKTGRGLAMATAILAAIGLTTVPRPADAGG |
Ga0318542_102184673 | 3300031668 | Soil | MKVGRFFFGKTGRGLAVTAAILAAIGLTTVPRPATAGGGWSGGG |
Ga0318542_104500142 | 3300031668 | Soil | MIVGRFFGKTVRGVAATAAILTAIGLTTVPRPADAGGGWGG |
Ga0318561_100181515 | 3300031679 | Soil | MTVDRFFGKTGRRLAIAAAILAVIGLTTAPRPADAG |
Ga0318561_102115871 | 3300031679 | Soil | MIVSRFFGKTGRGLTITTAILAAIGLTAVPRPADAGGGW |
Ga0318561_108158122 | 3300031679 | Soil | VGRLFGKSSRGLAVAIAMLAAIGLTTIPRPAAAGGGW |
Ga0318572_105806751 | 3300031681 | Soil | LTVRWFFGKTGRGLAVAVAILTAIGLTTVPQPADAGGGWG |
Ga0318560_101877342 | 3300031682 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADA |
Ga0306917_1000449814 | 3300031719 | Soil | MIVGKFFGKTGRGLTITTAILAAIGLTAVPRPADAGGG |
Ga0306917_101331034 | 3300031719 | Soil | MTVNRFFGKTGRGLAVAAAILAALGLTTVPRPADAGGGWGG |
Ga0306917_101838321 | 3300031719 | Soil | MKVGRFFFGKTGRGLAVTAAILAGIGLTTVPRPATAGG |
Ga0306917_103070502 | 3300031719 | Soil | MIVARFFGKTGRGLAVAASILAAIGLTTVPRPADAGGGWG |
Ga0306917_110661011 | 3300031719 | Soil | MTVNTSFRKTGRGLAVAAAILAAIGLTTVPRPADAGGGW |
Ga0318493_107382531 | 3300031723 | Soil | MTIGKTGRGLAVAAAILAAVGLATASRPADAGGGW |
Ga0318500_100418681 | 3300031724 | Soil | MTICRFFGKTVRGLAVAAAILAIIGLTTTPRPAHAG |
Ga0318501_101347221 | 3300031736 | Soil | MIVSRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGGGW |
Ga0306918_104356263 | 3300031744 | Soil | MIVGRFFGKTGRGLAATAAILTAIGLTTVPRPADAGGGW |
Ga0318502_100996043 | 3300031747 | Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRPADAGGG |
Ga0318502_103256081 | 3300031747 | Soil | MKVGRFFFGKTGRALAVTAAILAGIGLTTVPRSATAGGGWGG |
Ga0318502_109150441 | 3300031747 | Soil | MIVSRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGG |
Ga0318494_103699741 | 3300031751 | Soil | MIGRFIGKIGRPLATAAAILAVIGLATVPRPADAGGGW |
Ga0307477_107344121 | 3300031753 | Hardwood Forest Soil | MIVSRFFGKTGRGLAVAAAILVAIGLTTVPRPADAG |
Ga0318537_100985851 | 3300031763 | Soil | MTVDRFFWKTGRRLAIATAILAVIGLTTAPRPADAGGGW |
Ga0318535_103476472 | 3300031764 | Soil | MIGRFIGKIGRPLATAAAILAVIGLATVPRPADAG |
Ga0318554_103223622 | 3300031765 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADAGGG |
Ga0318509_102285802 | 3300031768 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADAGGGWGG |
Ga0318509_102436771 | 3300031768 | Soil | MKVGRFFFGKTGRGLAVTAAILAAIGLTTVPRPAT |
Ga0318509_105949611 | 3300031768 | Soil | MTIGRFFGKTGRGLAVAAAILAAIGSTTVPRPAVA |
Ga0318546_101950934 | 3300031771 | Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRPADAGGGWGGG |
Ga0318543_102451213 | 3300031777 | Soil | MTIGRFFGKTGRGLAVAAAILAAIGSTTVPRPADAGGWGGGGISP |
Ga0318566_101052723 | 3300031779 | Soil | MIVARFFGKTGRGLAVAASILAAIGLTTVPRPADAG |
Ga0318508_10754112 | 3300031780 | Soil | MKVGRFFFGKTGRGLAVTAAILAAIGLTTVPRPATA |
Ga0318547_105364561 | 3300031781 | Soil | MIVAKFFGKTGRGFAAAAAILAAIGLTTVPRPADAGGGGHGG |
Ga0318547_107314732 | 3300031781 | Soil | MTVDRFFWKTGRRLAIATAILAVIGLTTAPRPADAGGGWGGG |
Ga0318529_105404802 | 3300031792 | Soil | MMLGRFFGKTGRGLAVAAAILAAVGLATAPRPAHA |
Ga0318548_100624281 | 3300031793 | Soil | MIVARFFGKTGRGLAVAASILAAIGLTTVPRPADAGGGWVGG |
Ga0318548_101206071 | 3300031793 | Soil | MIVSRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGGG |
Ga0318548_102981671 | 3300031793 | Soil | MIVGKFFGKTGRGLTITAAILAAIGLTAVPRPADAGGGWGGG |
Ga0318576_101555081 | 3300031796 | Soil | MIVGKYFGKTGRGLAVAVAILAAIGLTTVPRPADAGEG |
Ga0318576_103956891 | 3300031796 | Soil | MTVGRFFGKTSRVLAVAAAILAAVGLTAVPRPADAGGG |
Ga0318550_104559082 | 3300031797 | Soil | MIVGRFFGKTVRGVAATAAILTAIGLTTVPRPADAGGG |
Ga0318568_102995572 | 3300031819 | Soil | MIVGKYFGKTGRGLAVAVAILAAIGLTTVPRPADAGG |
Ga0318567_100494074 | 3300031821 | Soil | MIVGRFFGKTVRGVAATAAILTAIGLTTVPRPAVAGGGGG |
Ga0310917_111326511 | 3300031833 | Soil | MTVGRFFGKTGRGLAMATATLAAIGSATVPRPADAGG |
Ga0318517_100279401 | 3300031835 | Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRPADAGGGWGG |
Ga0318517_101059471 | 3300031835 | Soil | MIARFIGKIGRPLATAAAILAVIGLATVPRPADAGGGWGG |
Ga0318512_101615422 | 3300031846 | Soil | MIVGRFFGKTGRGLAATAAILTAIGLTTVPRPADA |
Ga0318512_102218911 | 3300031846 | Soil | MIVARFFGKTGRGLAVAASILAAIGLTTVPRPADAGGGWGGG |
Ga0306919_104326283 | 3300031879 | Soil | MKVGRFFFGKTGRGLAVTAAILAGIGLTTVPRPATAGGGWGG |
Ga0318544_104487892 | 3300031880 | Soil | MTVNRFFRKTGRGLGVAAAILAAIGLTTVPRPADAGGGWG |
Ga0306925_113492541 | 3300031890 | Soil | MTVAGFFGKTGRGLAVAAAILAVIGLTTAPRPAHA |
Ga0306925_116360591 | 3300031890 | Soil | MKVGRFFFGKTGRALAVTAAILAGIGLTTVPRSATAGGGWG |
Ga0306925_122389011 | 3300031890 | Soil | MTVGRFFGKTGRGLAMATAILAAIGSATVPRPADAG |
Ga0318536_104267591 | 3300031893 | Soil | MSVGRFFGKTGRGLAAAAGILAAVGLTTTPRPANAGGIGPGA |
Ga0318551_103789191 | 3300031896 | Soil | MIVAKFFGKTGRGFAAAAAILAAIGLTTVPRPADAGGGGHGSGISPG |
Ga0318551_109399191 | 3300031896 | Soil | MTVGRFFHKTGHGLAVAAAILATIGLTTAPRPAHAGGGW |
Ga0318520_104081721 | 3300031897 | Soil | MTVGRLFGKTGRGLVVAAAILAAIGLTTVPRPADAGGGWGG |
Ga0318520_104545813 | 3300031897 | Soil | MMLGRFFGKTGRGLAVAAAILAAVGLATAPRPALA |
Ga0306923_104970991 | 3300031910 | Soil | MRVGRFFFAKTGRGLAVAAVILAAIGLTTVPRPADAGGGWGGG |
Ga0306923_108062581 | 3300031910 | Soil | MIVGKFFGKTGRGLTITAAILAAIGLTAVPRPADAGGGWG |
Ga0306921_105474461 | 3300031912 | Soil | MTVGRFFGKTSRVLAVAAAILAAVGLTAVPRPADAGGGWG |
Ga0306921_108723953 | 3300031912 | Soil | MTVNTSFRKTGRGLAVAAAILAAIGLTTVPRPADAGGGWGG |
Ga0310912_104559871 | 3300031941 | Soil | MTVNTSFRKTGRGLAVAAAILAAIGLTTVPRPADAGG |
Ga0310916_1001035210 | 3300031942 | Soil | MAVDRFFRKTGRGLAVAAAILAAIGLTTAPRPADAGGWGGDQTSELVS |
Ga0310916_102995581 | 3300031942 | Soil | MKVGRFFFGKTGKALAVAVAILAAIGLTTVPRPADA |
Ga0310913_105609933 | 3300031945 | Soil | MTVDRFFGKTGRRLAIAAAILAVIGLTTAPRPADAGGGW |
Ga0310909_102070323 | 3300031947 | Soil | MIVARFFGKTGRGLAVAASILAAIGLTTVPRPADA |
Ga0310909_102187601 | 3300031947 | Soil | MKVGRFFFGKTGRALAVTAAILAGIGLTTVPRSATA |
Ga0310909_110421021 | 3300031947 | Soil | MTVSRFFRKTGRGLAMATAILAAIGLTTVPRSADAGGGGISPGAA |
Ga0306926_105836911 | 3300031954 | Soil | MIVSRLFGKAGRGLAVAAAILAVIGLATVPRPADA |
Ga0306926_115933501 | 3300031954 | Soil | MVVSRFFGKAGRVLATAAAILAAIGLTTLPRPADAG |
Ga0306926_121722302 | 3300031954 | Soil | VGRLFGKTSRGLAVAAAIFAAIGLTTLPRPAHAGGGWG |
Ga0318530_100600332 | 3300031959 | Soil | MIVSRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGWGGVE |
Ga0307479_112647312 | 3300031962 | Hardwood Forest Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRPADAG |
Ga0318531_102901631 | 3300031981 | Soil | VGRLFGKSSRGLAVAIAMLAAIGLTTIPRPADAGGGWGG |
Ga0318563_100963883 | 3300032009 | Soil | MIVGRFFGKTGRGLAATAAILTAIGLTTVPRPADAGG |
Ga0318569_104622671 | 3300032010 | Soil | MTVNRFFRKIGRGLAVAAAILAAIGLTTVPRPADAGGGWGGG |
Ga0318549_100500132 | 3300032041 | Soil | MIVSRFFGKTGRGLAVAAAILAAIGLTAVPRPADAGGGWGG |
Ga0318549_100927661 | 3300032041 | Soil | MIVGRFFGKTVRGVAATAAILTAIGLTTVPRPADAGGGWG |
Ga0318549_103899102 | 3300032041 | Soil | MKVGRFFFGKTGRGLAVTAAILAAIGLTTVPRPATAGGGWSG |
Ga0318558_101603051 | 3300032044 | Soil | MKVGRFFFGKTGRGLAVTAAILAGIGLTTVPRPATAGGGW |
Ga0318558_102815553 | 3300032044 | Soil | MIVGRFFGKTVRGVAATAAILTAIGLTTVPRPADAGG |
Ga0318506_104222673 | 3300032052 | Soil | MIARFIGKIGRPLATAAAILAVIGLATVPRPADAGG |
Ga0318575_102417251 | 3300032055 | Soil | MIVGRFFGKTVRGVAATAAILTAIGLTTVPRPADA |
Ga0318575_103480141 | 3300032055 | Soil | MIARFIGKIGRPLATAAAILAVIGLATVPRPADAGGGWG |
Ga0318575_105133392 | 3300032055 | Soil | MFVGRFFGKTGRGLAVAAAILAAIGLTTVPRPADAGGGW |
Ga0318533_100335991 | 3300032059 | Soil | MTVNRFFRKTGRGLAVAAAILAAIGLTTLPRPADAGGGWGG |
Ga0318533_100377273 | 3300032059 | Soil | MTICRFFGKTVRGLAVAAAILAIIGLTTTPRPAHAGGGWGG |
Ga0318533_101148293 | 3300032059 | Soil | MTVVRFLERTGRGLAVAGAILAAIGVTTVPRPADAGGGWGG |
Ga0318533_101459991 | 3300032059 | Soil | MTVGRFFRKTSRALAVAAAILAAIGLTAVPRPADAGGG |
Ga0318533_102377921 | 3300032059 | Soil | MIVGKYFGKTGRGLAVAVAILAAIGLTTVPRPADAGGGWGGG |
Ga0318533_106932122 | 3300032059 | Soil | MTVDRFLGKTGRGLAVAAAILAVIGLTTTPRPAHAG |
Ga0318533_108258693 | 3300032059 | Soil | MTVGRFFVKTGRGLAIAAAILVAIGLTTAPRPADAGGGWGG |
Ga0318533_110023021 | 3300032059 | Soil | MTSGRFFGKTRRTLAVAAAILAAVGLTTLPEPADAGGGGISPGA |
Ga0318533_114549962 | 3300032059 | Soil | MTVVSFFETTGRGLAVAAAIFAAVGLTTLPRPADAGGGW |
Ga0318513_102832972 | 3300032065 | Soil | MTVRRFFGRTSRKLAVAATILAAIGLTTAPRPADAGGGWGGG |
Ga0318514_103096721 | 3300032066 | Soil | MKVGRFFFGKTGRALAVTAAILAGIGLTTVPRSATAGG |
Ga0318553_102722082 | 3300032068 | Soil | MIVGRFFGKTGRGLATAAAILAAIGLTTVPRPADAGGGWG |
Ga0306924_104618911 | 3300032076 | Soil | MTIGRFFGKTGRGLAVAAAILAAIGSTTVPRPADAGGWG |
Ga0306924_119893781 | 3300032076 | Soil | MIVAKFFGKTGRGFAAAAAILAAIGLTTVPRPADAGGG |
Ga0318577_101487551 | 3300032091 | Soil | MTVDRFFGKTGRRLAIAAAILAVIGLTTAPRPADA |
Ga0318540_106446892 | 3300032094 | Soil | MTVCKFFGRTGRGLAVAAAILAAIGLTTVPRPADAGEGWHGGG |
Ga0306920_1018354123 | 3300032261 | Soil | VTVQGFFGKTGRGLAAAAILAAVGLTTVPRPAHAGGGWGGG |
Ga0310914_102676423 | 3300033289 | Soil | MVDRFFGKAGRGLTLAATIVAAIGLTTVPHPANAGGGG |
Ga0310914_111744022 | 3300033289 | Soil | MTVNTSFRKTGRGLAVAAAILAAIGLTTVPRPADAGGGWGGG |
Ga0318519_108094091 | 3300033290 | Soil | MTVNRFFRKTGRGLGVAAAILAAIGLTTVPRPADAGGG |
⦗Top⦘ |