Metagenome Family F038059

Basic Information
Family ID	F038059
Family Type	Metagenome
Number of Sequences	166
Average Sequence Length	40 residues
Representative Sequence	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVIQ
Number of Associated Samples	70
Number of Associated Scaffolds	165

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.84 %
% of genes near scaffold ends (potentially truncated)	63.86 %
% of genes from short scaffolds (< 2000 bps)	98.19 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.38

Most Common Taxonomy
Group	Unclassified (50.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.181 % of family members)
Environment Ontology (ENVO)	Unclassified (95.783 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (95.783 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 165 Family Scaffolds
PF13650	Asp_protease_2	9.09

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	48.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	48.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	48.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	48.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	48.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	39.16 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	9.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	39.16 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	9.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	39.16 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	9.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	39.16 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	9.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	39.16 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	9.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	39.16 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	4.82 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	39.16 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	4.22 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	1.20 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	39.16 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	4.22 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	1.20 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	39.16 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	4.22 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	1.20 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.61 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1.20 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.61 %
Oryza officinalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	0.60 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	2.41 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.60 %
Oryza officinalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	0.60 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	39.16 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.41 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.60 %
Oryza officinalis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	0.60 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.60 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009148\|Ga0105243_11626154	Not Available	673	Open in IMG/M
3300009148\|Ga0105243_12495426	Not Available	556	Open in IMG/M
3300013297\|Ga0157378_11767356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	666	Open in IMG/M
3300013297\|Ga0157378_11925699	Not Available	640	Open in IMG/M
3300013297\|Ga0157378_13076975	Not Available	518	Open in IMG/M
3300014969\|Ga0157376_11656720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	674	Open in IMG/M
3300015267\|Ga0182122_1038546	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600	Open in IMG/M
3300015267\|Ga0182122_1044580	Not Available	577	Open in IMG/M
3300015267\|Ga0182122_1062403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	524	Open in IMG/M
3300015268\|Ga0182154_1066093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	519	Open in IMG/M
3300015274\|Ga0182188_1023062	Not Available	652	Open in IMG/M
3300015274\|Ga0182188_1024163	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	644	Open in IMG/M
3300015274\|Ga0182188_1024212	Not Available	644	Open in IMG/M
3300015276\|Ga0182170_1017533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	763	Open in IMG/M
3300015277\|Ga0182128_1041032	Not Available	609	Open in IMG/M
3300015277\|Ga0182128_1067165	Not Available	529	Open in IMG/M
3300015281\|Ga0182160_1012411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	855	Open in IMG/M
3300015281\|Ga0182160_1025057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	708	Open in IMG/M
3300015281\|Ga0182160_1033182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	655	Open in IMG/M
3300015283\|Ga0182156_1069978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	539	Open in IMG/M
3300015285\|Ga0182186_1026330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	701	Open in IMG/M
3300015285\|Ga0182186_1028652	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	685	Open in IMG/M
3300015285\|Ga0182186_1058884	Not Available	558	Open in IMG/M
3300015285\|Ga0182186_1065580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540	Open in IMG/M
3300015285\|Ga0182186_1065580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540	Open in IMG/M
3300015286\|Ga0182176_1065760	Not Available	548	Open in IMG/M
3300015286\|Ga0182176_1071339	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	533	Open in IMG/M
3300015287\|Ga0182171_1063481	Not Available	556	Open in IMG/M
3300015288\|Ga0182173_1058707	Not Available	565	Open in IMG/M
3300015289\|Ga0182138_1009856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	931	Open in IMG/M
3300015289\|Ga0182138_1012231	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	878	Open in IMG/M
3300015291\|Ga0182125_1024748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	742	Open in IMG/M
3300015292\|Ga0182141_1032698	Not Available	685	Open in IMG/M
3300015292\|Ga0182141_1039008	Not Available	652	Open in IMG/M
3300015292\|Ga0182141_1045124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	625	Open in IMG/M
3300015292\|Ga0182141_1063063	Not Available	568	Open in IMG/M
3300015292\|Ga0182141_1069348	Not Available	552	Open in IMG/M
3300015292\|Ga0182141_1077814	Not Available	533	Open in IMG/M
3300015294\|Ga0182126_1066642	Not Available	562	Open in IMG/M
3300015294\|Ga0182126_1072953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547	Open in IMG/M
3300015294\|Ga0182126_1095450	Not Available	503	Open in IMG/M
3300015295\|Ga0182175_1033249	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	693	Open in IMG/M
3300015295\|Ga0182175_1057408	Not Available	593	Open in IMG/M
3300015295\|Ga0182175_1063192	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	576	Open in IMG/M
3300015295\|Ga0182175_1086693	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	523	Open in IMG/M
3300015295\|Ga0182175_1089632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	518	Open in IMG/M
3300015296\|Ga0182157_1015034	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	879	Open in IMG/M
3300015296\|Ga0182157_1082119	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	540	Open in IMG/M
3300015296\|Ga0182157_1088088	Not Available	528	Open in IMG/M
3300015298\|Ga0182106_1059657	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	595	Open in IMG/M
3300015298\|Ga0182106_1067176	Not Available	574	Open in IMG/M
3300015298\|Ga0182106_1072360	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	561	Open in IMG/M
3300015298\|Ga0182106_1100705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	505	Open in IMG/M
3300015299\|Ga0182107_1040212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	671	Open in IMG/M
3300015300\|Ga0182108_1068795	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	577	Open in IMG/M
3300015302\|Ga0182143_1047272	Not Available	639	Open in IMG/M
3300015302\|Ga0182143_1058820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	600	Open in IMG/M
3300015303\|Ga0182123_1031435	Not Available	698	Open in IMG/M
3300015303\|Ga0182123_1045605	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	630	Open in IMG/M
3300015303\|Ga0182123_1051395	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	609	Open in IMG/M
3300015303\|Ga0182123_1068058	Not Available	562	Open in IMG/M
3300015304\|Ga0182112_1014935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	886	Open in IMG/M
3300015304\|Ga0182112_1026714	Not Available	754	Open in IMG/M
3300015304\|Ga0182112_1070212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	571	Open in IMG/M
3300015305\|Ga0182158_1031823	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	714	Open in IMG/M
3300015305\|Ga0182158_1085966	Not Available	534	Open in IMG/M
3300015305\|Ga0182158_1087570	Not Available	531	Open in IMG/M
3300015307\|Ga0182144_1005685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1166	Open in IMG/M
3300015307\|Ga0182144_1063060	Not Available	595	Open in IMG/M
3300015307\|Ga0182144_1074361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	566	Open in IMG/M
3300015308\|Ga0182142_1073447	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	579	Open in IMG/M
3300015308\|Ga0182142_1080515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	563	Open in IMG/M
3300015314\|Ga0182140_1051911	Not Available	644	Open in IMG/M
3300015322\|Ga0182110_1046306	Not Available	682	Open in IMG/M
3300015322\|Ga0182110_1057023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	642	Open in IMG/M
3300015322\|Ga0182110_1058121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	638	Open in IMG/M
3300015322\|Ga0182110_1093141	Not Available	552	Open in IMG/M
3300015322\|Ga0182110_1094130	Not Available	550	Open in IMG/M
3300015322\|Ga0182110_1104218	Not Available	532	Open in IMG/M
3300015323\|Ga0182129_1062682	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	606	Open in IMG/M
3300015323\|Ga0182129_1075169	Not Available	575	Open in IMG/M
3300015323\|Ga0182129_1078887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	566	Open in IMG/M
3300015323\|Ga0182129_1088205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547	Open in IMG/M
3300015323\|Ga0182129_1088310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	547	Open in IMG/M
3300015323\|Ga0182129_1112830	Not Available	507	Open in IMG/M
3300015341\|Ga0182187_1147750	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	562	Open in IMG/M
3300015342\|Ga0182109_1160686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	571	Open in IMG/M
3300015342\|Ga0182109_1189473	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	535	Open in IMG/M
3300015342\|Ga0182109_1190439	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	534	Open in IMG/M
3300015343\|Ga0182155_1031105	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1002	Open in IMG/M
3300015343\|Ga0182155_1086916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	710	Open in IMG/M
3300015343\|Ga0182155_1119010	Not Available	636	Open in IMG/M
3300015343\|Ga0182155_1123131	Not Available	629	Open in IMG/M
3300015344\|Ga0182189_1230038	Not Available	500	Open in IMG/M
3300015345\|Ga0182111_1100691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	706	Open in IMG/M
3300015345\|Ga0182111_1108456	Not Available	687	Open in IMG/M
3300015345\|Ga0182111_1150811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	607	Open in IMG/M
3300015345\|Ga0182111_1162745	Not Available	590	Open in IMG/M
3300015345\|Ga0182111_1229589	Not Available	515	Open in IMG/M
3300015346\|Ga0182139_1186617	Not Available	560	Open in IMG/M
3300015346\|Ga0182139_1194022	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	551	Open in IMG/M
3300015346\|Ga0182139_1238729	Not Available	507	Open in IMG/M
3300015347\|Ga0182177_1093160	Not Available	730	Open in IMG/M
3300015351\|Ga0182161_1026622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1194	Open in IMG/M
3300015355\|Ga0182159_1243867	Not Available	590	Open in IMG/M
3300015355\|Ga0182159_1292206	Not Available	545	Open in IMG/M
3300015355\|Ga0182159_1328856	Not Available	517	Open in IMG/M
3300015361\|Ga0182145_1039561	Not Available	849	Open in IMG/M
3300015361\|Ga0182145_1174002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	522	Open in IMG/M
3300017404\|Ga0182203_1075631	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	647	Open in IMG/M
3300017404\|Ga0182203_1113942	Not Available	568	Open in IMG/M
3300017404\|Ga0182203_1124987	Not Available	550	Open in IMG/M
3300017404\|Ga0182203_1143424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	525	Open in IMG/M
3300017407\|Ga0182220_1048811	Not Available	630	Open in IMG/M
3300017407\|Ga0182220_1055163	Not Available	609	Open in IMG/M
3300017409\|Ga0182204_1082966	Not Available	564	Open in IMG/M
3300017410\|Ga0182207_1116372	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	580	Open in IMG/M
3300017410\|Ga0182207_1173402	Not Available	505	Open in IMG/M
3300017411\|Ga0182208_1040207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	719	Open in IMG/M
3300017411\|Ga0182208_1057927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza officinalis	646	Open in IMG/M
3300017411\|Ga0182208_1062756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	631	Open in IMG/M
3300017411\|Ga0182208_1103185	Not Available	540	Open in IMG/M
3300017411\|Ga0182208_1104146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	539	Open in IMG/M
3300017413\|Ga0182222_1051582	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	611	Open in IMG/M
3300017415\|Ga0182202_1076183	Not Available	611	Open in IMG/M
3300017417\|Ga0182230_1044046	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	782	Open in IMG/M
3300017417\|Ga0182230_1049059	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	741	Open in IMG/M
3300017417\|Ga0182230_1114544	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	506	Open in IMG/M
3300017420\|Ga0182228_1113408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	527	Open in IMG/M
3300017424\|Ga0182219_1033274	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	786	Open in IMG/M
3300017424\|Ga0182219_1060926	Not Available	651	Open in IMG/M
3300017424\|Ga0182219_1074149	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	613	Open in IMG/M
3300017424\|Ga0182219_1083087	Not Available	593	Open in IMG/M
3300017424\|Ga0182219_1093581	Not Available	571	Open in IMG/M
3300017425\|Ga0182224_1165422	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	502	Open in IMG/M
3300017427\|Ga0182190_1046861	Not Available	770	Open in IMG/M
3300017427\|Ga0182190_1112307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	574	Open in IMG/M
3300017427\|Ga0182190_1112929	Not Available	573	Open in IMG/M
3300017430\|Ga0182192_1059729	Not Available	726	Open in IMG/M
3300017430\|Ga0182192_1141585	Not Available	540	Open in IMG/M
3300017430\|Ga0182192_1148175	Not Available	531	Open in IMG/M
3300017433\|Ga0182206_1067467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	661	Open in IMG/M
3300017436\|Ga0182209_1149343	Not Available	528	Open in IMG/M
3300017436\|Ga0182209_1150243	Not Available	527	Open in IMG/M
3300017436\|Ga0182209_1155729	Not Available	521	Open in IMG/M
3300017438\|Ga0182191_1087138	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	645	Open in IMG/M
3300017442\|Ga0182221_1129113	Not Available	549	Open in IMG/M
3300017443\|Ga0182193_1071939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	709	Open in IMG/M
3300017443\|Ga0182193_1102276	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	631	Open in IMG/M
3300017443\|Ga0182193_1184511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	514	Open in IMG/M
3300017680\|Ga0182233_1102155	Not Available	531	Open in IMG/M
3300017681\|Ga0182226_1048126	Not Available	770	Open in IMG/M
3300017682\|Ga0182229_1084580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	554	Open in IMG/M
3300017683\|Ga0182218_1144557	Not Available	512	Open in IMG/M
3300017684\|Ga0182225_1060564	Not Available	658	Open in IMG/M
3300017684\|Ga0182225_1128091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	522	Open in IMG/M
3300017685\|Ga0182227_1071503	Not Available	641	Open in IMG/M
3300017686\|Ga0182205_1144001	Not Available	533	Open in IMG/M
3300017690\|Ga0182223_1043270	Not Available	672	Open in IMG/M
3300017690\|Ga0182223_1099543	Not Available	535	Open in IMG/M
3300017690\|Ga0182223_1109261	Not Available	521	Open in IMG/M
3300021060\|Ga0182232_1064028	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	603	Open in IMG/M
3300025940\|Ga0207691_11715535	Not Available	508	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.22%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.60%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.60%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	95.18%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.41%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.60%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.60%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105243_116261542	3300009148	Miscanthus Rhizosphere	MVFLLPSKFKAPADQEVYSNFDELEYEEMATQLTLIHQAIFDKPVK
Ga0105243_124954261	3300009148	Miscanthus Rhizosphere	NIQMAFLLPSEVRALADQEVYSDFDESEYEEIVAKLIVIQ*
Ga0157378_117673563	3300013297	Miscanthus Rhizosphere	MAFLLPSEFRAPVDQEVYSDFDESKYEEIVAKLTVIQQAIFDKL
Ga0157378_119256991	3300013297	Miscanthus Rhizosphere	PSANIQMDFLLPSKFKAPADQEVYSNFDESEYEKMAAQLTLI*
Ga0157378_130769751	3300013297	Miscanthus Rhizosphere	MGFLLPSEFRALADQEVYSDFNESEYEDMVAKLTVIQQVIFDK
Ga0157376_116567201	3300014969	Miscanthus Rhizosphere	MAFLLPFEFKAPADQEVYSDFDESEYEEIAAQLTLIQQATF
Ga0182122_10385461	3300015267	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESKYEEIVAKLTVI*
Ga0182122_10445803	3300015267	Miscanthus Phyllosphere	MAFLLPSEFRALVDQEVYSDFDESEYEEIVAKLMV
Ga0182122_10624031	3300015267	Miscanthus Phyllosphere	MAFLLLSEFRAPTDQEVYSDFDESEYEEIVAKLIV
Ga0182154_10660932	3300015268	Miscanthus Phyllosphere	MTFLFLSEFRALADQEVYSDVDESEYEEMVTKLIVIQQAIFDKAIKHRY
Ga0182188_10230623	3300015274	Miscanthus Phyllosphere	MAFLLPYEFKALADQEVYSDFDESEYEEMVAQLTLI
Ga0182188_10241633	3300015274	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDELEYEEMAAQLTMI*
Ga0182188_10242123	3300015274	Miscanthus Phyllosphere	MAFLLQSEFRAPADQEVYSDFDESEYEEIVAKLTMVQQA
Ga0182170_10175333	3300015276	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYLDFNESECEEIVAKLIVIRQVIFDKPVK
Ga0182170_10702801	3300015276	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDESEYEGMAAQLTLI*
Ga0182128_10410321	3300015277	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYLDFDELKYEEIVAKLMV
Ga0182128_10671651	3300015277	Miscanthus Phyllosphere	PLANIQMAFLLPSEFRAPADQGVYSDFDELEYEEIVAKLTVV*
Ga0182160_10124111	3300015281	Miscanthus Phyllosphere	VAFLLPSEFRAPVDQEVYSDFDESEYEEIVAKLIV
Ga0182160_10250572	3300015281	Miscanthus Phyllosphere	MAFLFPSEFRAPADQEVYSDFDESEYEEIIDKLTVV*
Ga0182160_10331822	3300015281	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYEEMVAKLTVIQQAICNTLGV*
Ga0182156_10699781	3300015283	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLMVIQQAIFDKPV
Ga0182186_10263302	3300015285	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESEYEKIVAKLTVI*
Ga0182186_10286521	3300015285	Miscanthus Phyllosphere	MAFRLPSEFKAPADKEVYSDFDELEYEQIVAKLTVIQQAI
Ga0182186_10588842	3300015285	Miscanthus Phyllosphere	MAFLLPLEFRALIDQEVYLNFDESEYEEIVAKLTVVQQAIFD
Ga0182186_10655801	3300015285	Miscanthus Phyllosphere	CLLPSEFRAPTDQEVYLDFDESEYEEIVVKLTVI*
Ga0182186_10655802	3300015285	Miscanthus Phyllosphere	MAFLLPLEFRALADQEAYLDFDESEYEEMVAKLTVIQQSIFDKSV
Ga0182176_10657601	3300015286	Miscanthus Phyllosphere	MAFLLPLEFRAPVDQEIYLDFEESEYEEIVAKLAVIQQAIF
Ga0182176_10713391	3300015286	Miscanthus Phyllosphere	MTFLLPSEFRALVDQEVYLDFDESDYEEIVAKLTVI*
Ga0182171_10634811	3300015287	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSNYDESEYEEMVAKLIVVQ*
Ga0182173_10587072	3300015288	Miscanthus Phyllosphere	MAFLLPSEFKAPVDQEVCLDFDQSEYEEMAARLTLI*
Ga0182138_10098562	3300015289	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVI*
Ga0182138_10122311	3300015289	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDESEYEMVAKLTVAQ
Ga0182125_10247483	3300015291	Miscanthus Phyllosphere	MAFLLPLEFRSTADQEVYLDFDESEYEEIVAKLMVVQQAIFDKS
Ga0182141_10326981	3300015292	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDELDYEEIVAKLMVI*
Ga0182141_10390082	3300015292	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDELEYEEIVAKLTVIQ*
Ga0182141_10451243	3300015292	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYGEIVAKLTVIQRAI
Ga0182141_10630632	3300015292	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSNFDESKYEEIVAKLVVIQ*
Ga0182141_10693481	3300015292	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDESECEEMVAKLTVTQQAIFDK
Ga0182141_10778142	3300015292	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYEEIVTKLTVIQQAIFDKPVKH*
Ga0182126_10666422	3300015294	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDESEYEEVVAKLTVV*
Ga0182126_10729531	3300015294	Miscanthus Phyllosphere	MAFLLLSEFRAPADQEVYSDFDESEYEEMVAKLIVIQQAIFDK
Ga0182126_10954502	3300015294	Miscanthus Phyllosphere	MAFLLPSEFRASVDQEVYSDFDESECEEMVAKLMVTHQAIFDKPVKHQHLK
Ga0182175_10332491	3300015295	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVVKLTMIQ*
Ga0182175_10574081	3300015295	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDEPEYEEIVAKLTVI*
Ga0182175_10631922	3300015295	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDESEYEEMVAKLMVVQ*
Ga0182175_10866932	3300015295	Miscanthus Phyllosphere	MSFLLPSEFKALVDQEVYSDFDESEYEEIVTKLTVVHQAIFDKPVKH
Ga0182175_10896321	3300015295	Miscanthus Phyllosphere	MAFLLPSEFRTPANQEVYSDFDESEYEEIIAKLIVVHQAKFDNPIK
Ga0182157_10150341	3300015296	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYSDFDESEYEEMVAKLTLI*
Ga0182157_10821192	3300015296	Miscanthus Phyllosphere	MAFLLASEFRAPADQEVYSDFDESEYEEIVAKLTVVQ
Ga0182157_10880883	3300015296	Miscanthus Phyllosphere	MAFLLPSKFRALVDQEVYSDFDESEYEEIVAKLTVI
Ga0182106_10596572	3300015298	Miscanthus Phyllosphere	MAFLLPSEFRASIDQKVYLDFDESKYQEIVAKLTVIHQAIFDKPVK
Ga0182106_10671761	3300015298	Miscanthus Phyllosphere	ANIQMDFLLPSEFRALADQEVYSYFDESEYEKIVAKLMVMQ*
Ga0182106_10723602	3300015298	Miscanthus Phyllosphere	MAFLLPLEFRAPVDQEVYSYFDESEYEEIVAKLTVIQQAIFD
Ga0182106_11007051	3300015298	Miscanthus Phyllosphere	MAFLLLSEFKSLADQEVYSYFDESEYEEIVAKLTVIQQAIF
Ga0182107_10402122	3300015299	Miscanthus Phyllosphere	MAFLLPSEFKALADQEVYSDFDESEYEEMATQLIL
Ga0182108_10687952	3300015300	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDESEYEEIVAKLTVV*
Ga0182143_10472722	3300015302	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDESEYEEMVAKLTVI*
Ga0182143_10588201	3300015302	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDESEYEEMVAKLTVVPQAIFDKPVKH
Ga0182123_10314352	3300015303	Miscanthus Phyllosphere	MAFLLPSKFKAPADQEVYLDFDESEYEEMVAKLIVIQ*
Ga0182123_10456051	3300015303	Miscanthus Phyllosphere	MVFLLTSEVRALADQEVYSDFDESKYEEIVAKLTVVQQAIFD
Ga0182123_10513952	3300015303	Miscanthus Phyllosphere	MAFLLSSEFRAPADQEIYLDFDESEYEEIVAKLTVVHEA
Ga0182123_10680582	3300015303	Miscanthus Phyllosphere	QMAFLLLSEFRAPTDPEVYSDFDESEYEDIVAKLTVIQQAIFDKLVKH*
Ga0182112_10149351	3300015304	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEAYLDFDELEYEEIVAKLTVIQHAI
Ga0182112_10267142	3300015304	Miscanthus Phyllosphere	IQMAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLTVI*
Ga0182112_10702122	3300015304	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYSDFDELEYEEIVAKLTVI*
Ga0182158_10318231	3300015305	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLMAVQQAIFDKPIKHRHLKALY
Ga0182158_10859661	3300015305	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYSDFEELEYEEIVAKLIVI*
Ga0182158_10875702	3300015305	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYVEIVAKLIVIQQTIFDKPMKLGT*
Ga0182144_10056853	3300015307	Miscanthus Phyllosphere	AFLLLSEFRAPVDQEVYLDFDELEYEEIVAKLTVV*
Ga0182144_10630601	3300015307	Miscanthus Phyllosphere	TFLLPYEFKAPADQEVYSDFDESEYEEMAAQLTFI*
Ga0182144_10743613	3300015307	Miscanthus Phyllosphere	MAFLLPSEFRALTDQEVYLDFDESEYEEIVAKLTVVHQAI
Ga0182142_10734472	3300015308	Miscanthus Phyllosphere	MAFLLLLEFRALADQEVYLDFDESEYEKIVAKLAIIQ*
Ga0182142_10805151	3300015308	Miscanthus Phyllosphere	MAFLLPLEFRAPVDQQVYLDFDELEYEEIVAKLMVI*
Ga0182140_10519112	3300015314	Miscanthus Phyllosphere	MAFLLLLEFRAPTDQEVYLDFDESEYEKIVANLIVIQQAIFDKP
Ga0182110_10463062	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEIYSDFDESEYKEIVAKLTVI*
Ga0182110_10570231	3300015322	Miscanthus Phyllosphere	IQIAFLLPSEFTALVDQEVYSDFDESEYEEIIAKLTVV*
Ga0182110_10581213	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYSDFDESKYEEIVAMLTVIQ
Ga0182110_10931411	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRALATQEVYSDFDESEYEEIVAKLMIVQQAIFHKPVKH
Ga0182110_10941302	3300015322	Miscanthus Phyllosphere	MAFLLLSEFRAPIDQEVYSDFDESKYEEIVAKLTVI*
Ga0182110_10943782	3300015322	Miscanthus Phyllosphere	MIFLLPSEFKAPADQEVYLDFDESEYEEMAAQLTLI
Ga0182110_11042181	3300015322	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDELEYEEIVAKLTVI*
Ga0182129_10626822	3300015323	Miscanthus Phyllosphere	MAFLLPFEFKALAYQEVYLDFDELEYEEMAAQLTLIQ*
Ga0182129_10751693	3300015323	Miscanthus Phyllosphere	QSSVNIQMAFLLPLEFRASADQEVYSYFDESEYEEMIAKLTVI*
Ga0182129_10788873	3300015323	Miscanthus Phyllosphere	MAFLLPSEFGAPEDQEVYSYFDESEYEEMAAKLTVVQQAIFDK
Ga0182129_10882053	3300015323	Miscanthus Phyllosphere	MVFLLPLEFRVPADQEVYSDFDESKYEEIVAKLTVIQQ
Ga0182129_10883101	3300015323	Miscanthus Phyllosphere	MTFLLPLEFRAPADQEVYSEFDELEYEEMVAKLTAIQQAI
Ga0182129_11128302	3300015323	Miscanthus Phyllosphere	MAFLLSLEFRAAADQEVYSDFDESEYEEMVAKLTMI*
Ga0182187_11477503	3300015341	Miscanthus Phyllosphere	MVFLLPSEFRALVDQEVYSNFDESEYEEIVAKLMVIQQAIFDK
Ga0182109_11606862	3300015342	Miscanthus Phyllosphere	MAFLLPSEFRALANQEVYSDFDESEYEEMVAKLMVV*
Ga0182109_11894731	3300015342	Miscanthus Phyllosphere	MAFLLLSEFRAPADQEVYSDFDKSEYEEIVAKLTVIQQAIF
Ga0182109_11904392	3300015342	Miscanthus Phyllosphere	LLPSEFRAPTYQEVYSDFDKSKYEEIVAKLIVIQ*
Ga0182155_10311052	3300015343	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDELEYEEIVAKLAVIQQAIFDKPVK
Ga0182155_10869162	3300015343	Miscanthus Phyllosphere	MAFLLPSEFRASVDQEVYSDFDESEYEEIVAKLTIVQQAIF
Ga0182155_11190102	3300015343	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEIYLDFDESEYEEIVAKLIVIHQAIFDKPV
Ga0182155_11231312	3300015343	Miscanthus Phyllosphere	IQMAFLLPSKFKAPADQQVYSDFDESKYEEMVAQLTLI*
Ga0182189_12300381	3300015344	Miscanthus Phyllosphere	MAFLLPSEFKALADQEVYSDFNESEYEEMVAQLTLIQQAIFD
Ga0182111_11006913	3300015345	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVIQ
Ga0182111_11084563	3300015345	Miscanthus Phyllosphere	MAFLLPSEFRVLADQEVYLDFDESEYEEIVSKLTIIQQ
Ga0182111_11508111	3300015345	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYSDFDESEYEEIVAKLMVIQ*
Ga0182111_11627452	3300015345	Miscanthus Phyllosphere	MAFLVPSQFRAPADQEVYLDFDELEYEEIVAKLIVI*
Ga0182111_12295891	3300015345	Miscanthus Phyllosphere	MDFLLPSEFRAPADQEVYSDFDESEYEEIVAKLMVIQQAIFDKPV
Ga0182139_11866171	3300015346	Miscanthus Phyllosphere	MAFLLPSKFRAPAVQEVYSDFDESEFEEIFAKLTVIQQAIF
Ga0182139_11940221	3300015346	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYSDFDESEYEEMVAKLTVIQ*
Ga0182139_12387291	3300015346	Miscanthus Phyllosphere	QMTFLLPSEFRAPADQEVYLDFDDSEYEEIVAKLMVIQ*
Ga0182177_10931602	3300015347	Miscanthus Phyllosphere	MTFLLPSEFRAPVDRDVYLDFGESEYEEMVAKLTVI
Ga0182161_10266221	3300015351	Miscanthus Phyllosphere	MAFLLPSEFRAPTDQEVYSDFDESEYEEIVAKLTVIQ*
Ga0182159_12438673	3300015355	Miscanthus Phyllosphere	LLSEFRAPTDQEVYLDFDESEYEEIVAKLTVIQQAIFDKPVK
Ga0182159_12922061	3300015355	Miscanthus Phyllosphere	MAFLLPSEFRALADQEVYSDFDEPEYEEIVAKLTVIQQ
Ga0182159_13288561	3300015355	Miscanthus Phyllosphere	QPSANIQMTFLLPSEFKAPADKEVYSDFNESEYEEIVAKLTVIQHAIFD*
Ga0182145_10395611	3300015361	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYSDFDESEYEEIVAKLTVIQ*
Ga0182145_11740022	3300015361	Miscanthus Phyllosphere	MVFLLPSEFRAPAYQEVYLDFDESEYDEIVAKLIVIQ
Ga0182203_10756312	3300017404	Miscanthus Phyllosphere	MAFLLPSEFRALADQEIYSDFDELEYEEIIAKLTVVQQAIFD
Ga0182203_11139421	3300017404	Miscanthus Phyllosphere	MAFLLLSEFRTPADKEVYSDFDESEYEEIVAKLIVIQ
Ga0182203_11249872	3300017404	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEDYLDFDESEYEEMVAKLIVI
Ga0182203_11434242	3300017404	Miscanthus Phyllosphere	MAFLLPLEFRAPTGQEVYSDFDELEYEEIVAKLTVVQQAIFDK
Ga0182220_10488112	3300017407	Miscanthus Phyllosphere	MAFLLPSKFRAPADQEVYLDFDESEYEEIVAKLMVV
Ga0182220_10551633	3300017407	Miscanthus Phyllosphere	LANIQMAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLT
Ga0182204_10829661	3300017409	Miscanthus Phyllosphere	MTFLLPSEFRAPADQEVYSYFDESEYEEIIAKLIVI
Ga0182207_11163722	3300017410	Miscanthus Phyllosphere	MAFLLPSEFRAPVDQEVYSDFDESEYEDMVAKLIVI
Ga0182207_11734021	3300017410	Miscanthus Phyllosphere	MVFLLLLEFRAPADQGVYSDFDELEYEEIVAKLTVIQ
Ga0182208_10402072	3300017411	Miscanthus Phyllosphere	MSFLLSSEFRASIDQEVYSDFDESKYVEIVAKLTVIQQAIFDKPVKHRH
Ga0182208_10579272	3300017411	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYLDFDESEYEEMATQLTLI
Ga0182208_10627561	3300017411	Miscanthus Phyllosphere	QMTFLLPSEFRAPTDQEIYSNFDASEYEEIVAKLTVI
Ga0182208_11031853	3300017411	Miscanthus Phyllosphere	QMAFLLPSEFRTPADQEVYSDFDESEYEEIVAKLTVIQ
Ga0182208_11041461	3300017411	Miscanthus Phyllosphere	MTFLLPSKFRAPTDQEVYSYFDESEYEEIIAKLSVIQQAIFNKPVKHRH
Ga0182222_10515822	3300017413	Miscanthus Phyllosphere	MTFLLPLEFRAPADQEVYSNFDESEYEEIIAKLTVI
Ga0182202_10761831	3300017415	Miscanthus Phyllosphere	MVFLLPSEFKAPADQEVYLDFDESEYEEMVAKLTLIQQAIFD
Ga0182230_10440463	3300017417	Miscanthus Phyllosphere	MTFLLLSEFRAPADQEVYSDFDESEYEEMVAKLIVIQQ
Ga0182230_10490592	3300017417	Miscanthus Phyllosphere	MVFLLPYEFKAPVDHEVYLDFDELEYEEMAAQLTLIQ
Ga0182230_11145441	3300017417	Miscanthus Phyllosphere	MTFLLPSEFRAPADQEVYSDFDESKYEEMVAKLAVIQQAIFD
Ga0182228_10401943	3300017420	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYLDFDESKYEKMVAELTLI
Ga0182228_11134081	3300017420	Miscanthus Phyllosphere	MAFLLPSEFRALVDQDVYSDFDVSEYEEMVAKLTVIQQTIFNKPD
Ga0182219_10332743	3300017424	Miscanthus Phyllosphere	MAFLLPSKFRALADQEVYSDFDESGYEEIVAKLTVIQQAIFDK
Ga0182219_10609261	3300017424	Miscanthus Phyllosphere	MAFLLPSEFKAPADQEVYSDFDESEYEEMAAQLTL
Ga0182219_10741492	3300017424	Miscanthus Phyllosphere	MAFLLLSEFRALVDQEVYSDFDESEYEEIVAKLTVI
Ga0182219_10830872	3300017424	Miscanthus Phyllosphere	MVFMLPSEFRALANQEVYSDFDESEYREIVAKLTVVQ
Ga0182219_10935812	3300017424	Miscanthus Phyllosphere	MVFVLPSELRAPTDQEVYSDFDESEYEEIVAKLIVI
Ga0182224_11654222	3300017425	Miscanthus Phyllosphere	MAFLLPSKFRAPVDQEVYSDFDESKYKEIVAKMMVIQQAIFDKPV
Ga0182190_10468612	3300017427	Miscanthus Phyllosphere	MDFLLPSEFRAPADQEVFSDFDESEYEEIVDKLTVI
Ga0182190_11123072	3300017427	Miscanthus Phyllosphere	MAFLLPYEFKALADQEVYLDFDESEYEEMATQLTLI
Ga0182190_11129291	3300017427	Miscanthus Phyllosphere	MAFLLPSEFKALADHEVYLDFNESEYEEMATQLIL
Ga0182192_10597292	3300017430	Miscanthus Phyllosphere	MAFLLPSEFRAPVNQEVYLDFDELEYEEIVAKLTVVHQAIFD
Ga0182192_11415852	3300017430	Miscanthus Phyllosphere	MAFLLPSKFRALVDQEVYYDFDESEYEEIVAKLTVVHQTIFNKPVK
Ga0182192_11481752	3300017430	Miscanthus Phyllosphere	MAFLLPLEFRALADQEVYSDFDESEHEEIVAKLTVIQQAIDR
Ga0182206_10674672	3300017433	Miscanthus Phyllosphere	MAFILPYEFKAPADQEVYLNFDESEYEEMAAQLTLI
Ga0182209_11493433	3300017436	Miscanthus Phyllosphere	MAFVLLLEFRAPTDQEIYSDFDESEYEEIVTKLIVIHQAIFN
Ga0182209_11502431	3300017436	Miscanthus Phyllosphere	PSEFRAPADQEIYSDFDESEYEGIVAKLTVVQQAIFDKPVKH
Ga0182209_11557291	3300017436	Miscanthus Phyllosphere	QPSANIQLAFLLPSEFKAPVDQEVYSDFDESEYEEIVAK
Ga0182191_10871382	3300017438	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLIVVHQDIFDKPVK
Ga0182221_11291132	3300017442	Miscanthus Phyllosphere	MTFLLPSEFRAPVDQEVYSDFDESECEEIVAKLTVVQQ
Ga0182193_10719391	3300017443	Miscanthus Phyllosphere	MAFLLLLEFRAPADQEVYSDFDESKYEEIVVKLTVTQQAIFDKPVNHQ
Ga0182193_11022761	3300017443	Miscanthus Phyllosphere	IQMAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLTVIQQAIFD
Ga0182193_11845111	3300017443	Miscanthus Phyllosphere	MAFPYPSEFRAPADQEVYSDFDESEYEEIVAKLMVVQQA
Ga0182233_11021551	3300017680	Miscanthus Phyllosphere	MAFLLLSEFRAPAYQEVYSDFDESEYEEIVAKLTVI
Ga0182226_10481262	3300017681	Miscanthus Phyllosphere	MVFLLPSEFRAPADQEVYSDFDESEYKEIVAKLAVVQQAIFE
Ga0182229_10845801	3300017682	Miscanthus Phyllosphere	MAFLLPLEFRPPADQEIYSNFDESEYEEIVAKLTVIQQAIFDK
Ga0182218_11445571	3300017683	Miscanthus Phyllosphere	MAFLLPLEFRAPADQEVYSDFDELEYEEIVAKLTVI
Ga0182225_10605641	3300017684	Miscanthus Phyllosphere	MAFLLPLEFRALADQKVYSDFDELEYEKIVAKLIVIQQDIFDKSVMH
Ga0182225_11280911	3300017684	Miscanthus Phyllosphere	MVFLLPSEFRALANQKVYSDFDESKYEEMVAKLTV
Ga0182227_10715031	3300017685	Miscanthus Phyllosphere	MAFLLPSEFRAPADQEVYLDFDESEYEEIVAKLIVIQ
Ga0182205_11440013	3300017686	Miscanthus Phyllosphere	MAFLLPLEFRAPTDQEVYSDFDESEYEEIVAKLIVIQ
Ga0182223_10432701	3300017690	Miscanthus Phyllosphere	MTFLLPSEFRASVDQEIYSDFDESEYKEIAAKLTVIQ
Ga0182223_10995432	3300017690	Miscanthus Phyllosphere	MTFLLPSEFRALADQEIYSDSDELEYEEIVSKLTVVQQAIFDKPVKHRH
Ga0182223_11092611	3300017690	Miscanthus Phyllosphere	QPSANIQMAFLLPSEFRAPADQEVYSDFDESEYEEIVAKLTVI
Ga0182232_10640281	3300021060	Phyllosphere	MALLLPSEFRALADQEVYSDFDELGYEEIVAKLIVI
Ga0207691_117155352	3300025940	Miscanthus Rhizosphere	MAFLLPSEFRASTDQEVYLDFDESEYEEIVAKLMV

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.38
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.38
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F038059

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign