Basic Information | |
---|---|
Family ID | F039104 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 164 |
Average Sequence Length | 44 residues |
Representative Sequence | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAIDYANFIDRQ |
Number of Associated Samples | 126 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 26.83 % |
% of genes near scaffold ends (potentially truncated) | 50.00 % |
% of genes from short scaffolds (< 2000 bps) | 78.05 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.75 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.878 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (15.244 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.488 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.927 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.81% β-sheet: 28.77% Coil/Unstructured: 53.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.75 |
Powered by PDBe Molstar |
SCOP family | SCOP domain | Representative PDB | TM-score |
---|---|---|---|
c.119.1.0: automated matches | d3pl5a_ | 3pl5 | 0.7579 |
c.119.1.1: DegV-like | d1mgpa1 | 1mgp | 0.72823 |
d.381.1.1: ATP12-like | d2r6ia1 | 2r6i | 0.71136 |
d.54.1.0: automated matches | d3toya1 | 3toy | 0.70679 |
c.119.1.0: automated matches | d6alwa_ | 6alw | 0.70231 |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF13392 | HNH_3 | 7.93 |
PF09588 | YqaJ | 7.32 |
PF04404 | ERF | 4.27 |
PF03796 | DnaB_C | 3.05 |
PF00772 | DnaB | 1.83 |
PF07463 | NUMOD4 | 1.83 |
PF07120 | DUF1376 | 1.83 |
PF12684 | DUF3799 | 1.22 |
PF00356 | LacI | 1.22 |
PF01510 | Amidase_2 | 1.22 |
PF01507 | PAPS_reduct | 0.61 |
PF13248 | zf-ribbon_3 | 0.61 |
PF12851 | Tet_JBP | 0.61 |
PF10571 | UPF0547 | 0.61 |
PF01844 | HNH | 0.61 |
PF11367 | DUF3168 | 0.61 |
PF08299 | Bac_DnaA_C | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 4.88 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 3.05 |
COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 1.83 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.88 % |
All Organisms | root | All Organisms | 45.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000241|BS_KBA_SWE21_205mDRAFT_10023963 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
3300000882|FwDRAFT_10205232 | Not Available | 908 | Open in IMG/M |
3300002397|B570J29612_1000111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6593 | Open in IMG/M |
3300002408|B570J29032_109628534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → Twortvirinae → Sepunavirus → unclassified Sepunavirus → Staphylococcus phage Quidividi | 959 | Open in IMG/M |
3300002835|B570J40625_100024646 | All Organisms → Viruses | 9877 | Open in IMG/M |
3300002835|B570J40625_100185194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2289 | Open in IMG/M |
3300002835|B570J40625_100312275 | Not Available | 1585 | Open in IMG/M |
3300003277|JGI25908J49247_10021047 | All Organisms → Viruses → Predicted Viral | 1939 | Open in IMG/M |
3300003277|JGI25908J49247_10080263 | Not Available | 805 | Open in IMG/M |
3300005069|Ga0071350_1023805 | All Organisms → Viruses → Predicted Viral | 1569 | Open in IMG/M |
3300005527|Ga0068876_10263309 | Not Available | 986 | Open in IMG/M |
3300005581|Ga0049081_10017797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → unclassified Acholeplasmataceae → Acholeplasmataceae bacterium | 2693 | Open in IMG/M |
3300005581|Ga0049081_10024744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2280 | Open in IMG/M |
3300005585|Ga0049084_10304592 | Not Available | 528 | Open in IMG/M |
3300005758|Ga0078117_1054556 | All Organisms → Viruses → Predicted Viral | 3180 | Open in IMG/M |
3300005758|Ga0078117_1054557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4525 | Open in IMG/M |
3300005758|Ga0078117_1117567 | All Organisms → Viruses → Predicted Viral | 2243 | Open in IMG/M |
3300006030|Ga0075470_10092970 | Not Available | 905 | Open in IMG/M |
3300006637|Ga0075461_10242019 | Not Available | 531 | Open in IMG/M |
3300006802|Ga0070749_10015692 | All Organisms → cellular organisms → Bacteria | 4819 | Open in IMG/M |
3300006875|Ga0075473_10030446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2075 | Open in IMG/M |
3300007169|Ga0102976_1113647 | Not Available | 2666 | Open in IMG/M |
3300007734|Ga0104986_1395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14599 | Open in IMG/M |
3300008107|Ga0114340_1001757 | All Organisms → Viruses | 14250 | Open in IMG/M |
3300008116|Ga0114350_1134916 | Not Available | 717 | Open in IMG/M |
3300008121|Ga0114356_1151976 | Not Available | 1864 | Open in IMG/M |
3300008263|Ga0114349_1103989 | Not Available | 1232 | Open in IMG/M |
3300008263|Ga0114349_1148560 | Not Available | 934 | Open in IMG/M |
3300008267|Ga0114364_1042648 | All Organisms → Viruses → Predicted Viral | 2804 | Open in IMG/M |
3300008450|Ga0114880_1262681 | Not Available | 529 | Open in IMG/M |
3300009085|Ga0105103_10482316 | Not Available | 694 | Open in IMG/M |
3300009085|Ga0105103_10940717 | Not Available | 508 | Open in IMG/M |
3300009152|Ga0114980_10787678 | Not Available | 529 | Open in IMG/M |
3300009155|Ga0114968_10133594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1486 | Open in IMG/M |
3300009159|Ga0114978_10767812 | Not Available | 545 | Open in IMG/M |
3300009165|Ga0105102_10631904 | Not Available | 594 | Open in IMG/M |
3300009169|Ga0105097_10559620 | Not Available | 642 | Open in IMG/M |
3300009170|Ga0105096_10363100 | Not Available | 743 | Open in IMG/M |
3300009183|Ga0114974_10209611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1185 | Open in IMG/M |
3300009183|Ga0114974_10633239 | Not Available | 587 | Open in IMG/M |
3300009419|Ga0114982_1048693 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Mesonia → unclassified Mesonia → Mesonia sp. JHPTF-M18 | 1340 | Open in IMG/M |
3300010354|Ga0129333_10659210 | Not Available | 903 | Open in IMG/M |
3300010354|Ga0129333_11544713 | Not Available | 543 | Open in IMG/M |
3300011010|Ga0139557_1016145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300011114|Ga0151515_10176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29954 | Open in IMG/M |
3300011337|Ga0153702_1525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12978 | Open in IMG/M |
3300012017|Ga0153801_1028466 | Not Available | 989 | Open in IMG/M |
3300012347|Ga0157142_1037186 | Not Available | 708 | Open in IMG/M |
3300012663|Ga0157203_1002865 | All Organisms → Viruses → Predicted Viral | 3725 | Open in IMG/M |
3300013372|Ga0177922_10013269 | Not Available | 568 | Open in IMG/M |
3300013372|Ga0177922_11128393 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
3300014711|Ga0134314_112402 | Not Available | 562 | Open in IMG/M |
3300017701|Ga0181364_1020533 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300017701|Ga0181364_1023865 | Not Available | 1002 | Open in IMG/M |
3300017701|Ga0181364_1023955 | Not Available | 1000 | Open in IMG/M |
3300017701|Ga0181364_1060068 | Not Available | 588 | Open in IMG/M |
3300017707|Ga0181363_1034762 | Not Available | 940 | Open in IMG/M |
3300017736|Ga0181365_1164905 | Not Available | 521 | Open in IMG/M |
3300017761|Ga0181356_1079669 | Not Available | 1090 | Open in IMG/M |
3300017774|Ga0181358_1061076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1407 | Open in IMG/M |
3300017785|Ga0181355_1155175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → Twortvirinae → Sepunavirus → unclassified Sepunavirus → Staphylococcus phage Quidividi | 922 | Open in IMG/M |
3300019784|Ga0181359_1010341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3310 | Open in IMG/M |
3300019784|Ga0181359_1027770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Priestia → Priestia aryabhattai | 2174 | Open in IMG/M |
3300019784|Ga0181359_1095934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300019784|Ga0181359_1192120 | Not Available | 664 | Open in IMG/M |
3300020151|Ga0211736_10147682 | Not Available | 949 | Open in IMG/M |
3300020162|Ga0211735_10358247 | Not Available | 1554 | Open in IMG/M |
3300020498|Ga0208050_1009287 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300020505|Ga0208088_1032348 | Not Available | 652 | Open in IMG/M |
3300020527|Ga0208232_1005094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2180 | Open in IMG/M |
3300020527|Ga0208232_1049153 | Not Available | 535 | Open in IMG/M |
3300020530|Ga0208235_1005233 | Not Available | 1786 | Open in IMG/M |
3300020532|Ga0208601_1002115 | All Organisms → Viruses → Predicted Viral | 3173 | Open in IMG/M |
3300020539|Ga0207941_1041384 | Not Available | 613 | Open in IMG/M |
3300020542|Ga0208857_1071587 | Not Available | 502 | Open in IMG/M |
3300020547|Ga0208361_1033529 | Not Available | 687 | Open in IMG/M |
3300020555|Ga0208358_1064349 | Not Available | 521 | Open in IMG/M |
3300020556|Ga0208486_1065210 | Not Available | 516 | Open in IMG/M |
3300020560|Ga0208852_1009371 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. | 2069 | Open in IMG/M |
3300021956|Ga0213922_1022822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
3300021961|Ga0222714_10100651 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium | 1830 | Open in IMG/M |
3300021962|Ga0222713_10067138 | All Organisms → Viruses → Predicted Viral | 2667 | Open in IMG/M |
3300021963|Ga0222712_10116417 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium | 1846 | Open in IMG/M |
3300021963|Ga0222712_10393675 | Not Available | 844 | Open in IMG/M |
3300022190|Ga0181354_1047650 | All Organisms → Viruses → Predicted Viral | 1425 | Open in IMG/M |
3300022543|Ga0212119_1011529 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
3300024853|Ga0255252_1027569 | Not Available | 1062 | Open in IMG/M |
3300025889|Ga0208644_1367590 | Not Available | 542 | Open in IMG/M |
3300026902|Ga0209851_1034420 | Not Available | 503 | Open in IMG/M |
3300026919|Ga0209892_1006746 | Not Available | 834 | Open in IMG/M |
3300027143|Ga0255105_1010081 | Not Available | 1916 | Open in IMG/M |
3300027147|Ga0255113_1039612 | Not Available | 937 | Open in IMG/M |
3300027160|Ga0255198_1051671 | Not Available | 729 | Open in IMG/M |
3300027286|Ga0255129_1058751 | Not Available | 583 | Open in IMG/M |
3300027596|Ga0255119_1099334 | Not Available | 520 | Open in IMG/M |
3300027679|Ga0209769_1214688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300027683|Ga0209392_1023017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
3300027697|Ga0209033_1101903 | Not Available | 942 | Open in IMG/M |
3300027697|Ga0209033_1107910 | Not Available | 907 | Open in IMG/M |
3300027697|Ga0209033_1127249 | Not Available | 812 | Open in IMG/M |
3300027732|Ga0209442_1334256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → unclassified Corallococcus → Corallococcus sp. EGB | 512 | Open in IMG/M |
3300027736|Ga0209190_1000329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34677 | Open in IMG/M |
3300027746|Ga0209597_1203809 | Not Available | 808 | Open in IMG/M |
3300027754|Ga0209596_1000706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30814 | Open in IMG/M |
3300027754|Ga0209596_1003985 | Not Available | 11392 | Open in IMG/M |
3300027759|Ga0209296_1057416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2004 | Open in IMG/M |
3300027759|Ga0209296_1060930 | All Organisms → Viruses → Predicted Viral | 1930 | Open in IMG/M |
3300027759|Ga0209296_1079428 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium | 1620 | Open in IMG/M |
3300027759|Ga0209296_1109620 | Not Available | 1303 | Open in IMG/M |
3300027759|Ga0209296_1361004 | Not Available | 556 | Open in IMG/M |
3300027759|Ga0209296_1376434 | Not Available | 539 | Open in IMG/M |
3300027764|Ga0209134_10185038 | Not Available | 717 | Open in IMG/M |
3300027764|Ga0209134_10331940 | Not Available | 514 | Open in IMG/M |
3300027785|Ga0209246_10179976 | Not Available | 829 | Open in IMG/M |
3300027963|Ga0209400_1356285 | Not Available | 540 | Open in IMG/M |
3300027969|Ga0209191_1049483 | All Organisms → Viruses → Predicted Viral | 1928 | Open in IMG/M |
3300027973|Ga0209298_10103922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1237 | Open in IMG/M |
3300027974|Ga0209299_1024322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2692 | Open in IMG/M |
3300028025|Ga0247723_1033615 | All Organisms → Viruses → Predicted Viral | 1589 | Open in IMG/M |
3300029302|Ga0135227_1028785 | Not Available | 604 | Open in IMG/M |
3300031707|Ga0315291_10446114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
3300031746|Ga0315293_10509133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300031772|Ga0315288_10212051 | All Organisms → Viruses → Predicted Viral | 2094 | Open in IMG/M |
3300031772|Ga0315288_10301954 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
3300031787|Ga0315900_10173162 | All Organisms → Viruses → Predicted Viral | 1957 | Open in IMG/M |
3300031951|Ga0315904_11265025 | Not Available | 561 | Open in IMG/M |
3300031952|Ga0315294_10092762 | All Organisms → Viruses → Predicted Viral | 3138 | Open in IMG/M |
3300031952|Ga0315294_10316239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1494 | Open in IMG/M |
3300031952|Ga0315294_11496132 | Not Available | 528 | Open in IMG/M |
3300031997|Ga0315278_11751314 | Not Available | 589 | Open in IMG/M |
3300031999|Ga0315274_10096950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Inhavirus → Nonlabens virus P12024L | 3843 | Open in IMG/M |
3300031999|Ga0315274_11757758 | Not Available | 572 | Open in IMG/M |
3300032046|Ga0315289_10807917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300032046|Ga0315289_10978248 | Not Available | 714 | Open in IMG/M |
3300032053|Ga0315284_10402264 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
3300032092|Ga0315905_11209550 | Not Available | 616 | Open in IMG/M |
3300032116|Ga0315903_11147872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300032116|Ga0315903_11233377 | Not Available | 501 | Open in IMG/M |
3300032177|Ga0315276_11422198 | Not Available | 724 | Open in IMG/M |
3300032397|Ga0315287_10178265 | All Organisms → Viruses → Predicted Viral | 2470 | Open in IMG/M |
3300032516|Ga0315273_13103563 | Not Available | 517 | Open in IMG/M |
3300033233|Ga0334722_10574379 | Not Available | 806 | Open in IMG/M |
3300033981|Ga0334982_0248687 | Not Available | 856 | Open in IMG/M |
3300033984|Ga0334989_0072902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1897 | Open in IMG/M |
3300033993|Ga0334994_0000679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24971 | Open in IMG/M |
3300033993|Ga0334994_0107906 | Not Available | 1624 | Open in IMG/M |
3300033994|Ga0334996_0344788 | Not Available | 721 | Open in IMG/M |
3300033995|Ga0335003_0334541 | Not Available | 668 | Open in IMG/M |
3300033996|Ga0334979_0615005 | Not Available | 575 | Open in IMG/M |
3300034013|Ga0334991_0429026 | Not Available | 502 | Open in IMG/M |
3300034018|Ga0334985_0225541 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
3300034018|Ga0334985_0524408 | Not Available | 677 | Open in IMG/M |
3300034020|Ga0335002_0275611 | Not Available | 996 | Open in IMG/M |
3300034061|Ga0334987_0005542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12021 | Open in IMG/M |
3300034062|Ga0334995_0220888 | All Organisms → Viruses → Predicted Viral | 1300 | Open in IMG/M |
3300034062|Ga0334995_0566243 | Not Available | 667 | Open in IMG/M |
3300034104|Ga0335031_0363521 | Not Available | 921 | Open in IMG/M |
3300034105|Ga0335035_0678182 | Not Available | 532 | Open in IMG/M |
3300034106|Ga0335036_0001111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24323 | Open in IMG/M |
3300034106|Ga0335036_0550480 | Not Available | 709 | Open in IMG/M |
3300034111|Ga0335063_0012352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5479 | Open in IMG/M |
3300034279|Ga0335052_0549803 | Not Available | 588 | Open in IMG/M |
3300034284|Ga0335013_0197366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1337 | Open in IMG/M |
3300034356|Ga0335048_0156092 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.41% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.59% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.66% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.66% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.66% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.05% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.05% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.44% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.44% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.83% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 1.83% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.83% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.22% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.22% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.22% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.61% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.61% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.61% |
Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.61% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.61% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300002397 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012347 | Freshwater microbial communities from Fish Creek, Ontario, Canada - S48 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026902 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 (SPAdes) | Environmental | Open in IMG/M |
3300026919 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027160 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepC_8h | Environmental | Open in IMG/M |
3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029302 | Marine harbor viral communities from the Indian Ocean - SRB3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBA_SWE21_205mDRAFT_100239633 | 3300000241 | Marine | MKATIVKATINFISKWRVYYAGELLATFENEKXARDYAAFIDSQ* |
FwDRAFT_102052324 | 3300000882 | Freshwater And Marine | MTKLKALVVKASINEIIKWRVYFAGELLATFENETDAIYYANFIDRQ* |
B570J29612_100011114 | 3300002397 | Freshwater | MLKALVVKASINFIIKWRVYYAGELLATFENEQDAIEYANFIDRQ* |
B570J29032_1096285341 | 3300002408 | Freshwater | VEKMLKALVVKASINFIIKWRVYFAGELLATFENEKDAMEYAEFIDRQ* |
B570J40625_1000246469 | 3300002835 | Freshwater | MWDISMKATVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ* |
B570J40625_1001851947 | 3300002835 | Freshwater | KMLKALVVKASINFIIKWRVYYAGELLATFENEQDAIEYANFIDRQ* |
B570J40625_1003122754 | 3300002835 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAIDYANFIDRQ* |
JGI25908J49247_100210472 | 3300003277 | Freshwater Lake | MTKIKALVVRASINEIIKWRVYFAGELLATFENETDAIYYANFIDRQ* |
JGI25908J49247_100802632 | 3300003277 | Freshwater Lake | MTNLKALVVKASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0071350_10238055 | 3300005069 | Freshwater | MKAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ* |
Ga0068876_102633094 | 3300005527 | Freshwater Lake | MKAIVIRATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ* |
Ga0049081_100177972 | 3300005581 | Freshwater Lentic | MTNLKALVVRATINNIVKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0049081_100247441 | 3300005581 | Freshwater Lentic | MKATVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ* |
Ga0049084_103045921 | 3300005585 | Freshwater Lentic | VKATINNVVKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0078117_10545563 | 3300005758 | Lake Water | MKAIVIKATINFICKWRVYFAGELLATFENEQDAHDYAKFINEQ* |
Ga0078117_10545575 | 3300005758 | Lake Water | MLKAQVVKARINQVIKFRVYYAGELLATFENKKDADDYAKFINEQ* |
Ga0078117_11175672 | 3300005758 | Lake Water | MKAQVIKATINFLVKWRVYYGGELIATFETEQGAKDYAEWIDEQK* |
Ga0075470_100929701 | 3300006030 | Aqueous | MKARVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ* |
Ga0075461_102420192 | 3300006637 | Aqueous | MKAIVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ* |
Ga0070749_100156927 | 3300006802 | Aqueous | MLKAKVVKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ* |
Ga0075473_100304466 | 3300006875 | Aqueous | MKARVVKATINFISKWRVYYAGELLATFENEKDARDYAAFID |
Ga0102976_11136474 | 3300007169 | Freshwater Lake | MKAQVIKATINFLVKWRVYYGGELIATFETEQSAKAYADWIDEQK* |
Ga0104986_13959 | 3300007734 | Freshwater | MKAIVIRATINHICKWRVYFGGELLATFETEQDAHDYAKFINDQQ* |
Ga0114340_100175720 | 3300008107 | Freshwater, Plankton | MKAIVIRASINFITKWRVYFAGELLATFENESDAQDYADFINAQGL* |
Ga0114350_11349161 | 3300008116 | Freshwater, Plankton | VKATINFISKWRVYYAGELLATFENEKDARDYAAFIDS |
Ga0114356_11519761 | 3300008121 | Freshwater, Plankton | SRMKAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ* |
Ga0114349_11039891 | 3300008263 | Freshwater, Plankton | ATVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ* |
Ga0114349_11485601 | 3300008263 | Freshwater, Plankton | VKATINFISKWRVYYAGELLATFENEKDARDYAAF |
Ga0114364_10426489 | 3300008267 | Freshwater, Plankton | MKAVVIKATINFITKWRVYFAGELLATFETEKDARDYAEFIDRQ* |
Ga0114880_12626811 | 3300008450 | Freshwater Lake | RTSITLSRMKAVVIKATINFITKWRVYFAGELLATFESKQDAHDYAKFINEQ* |
Ga0105103_104823164 | 3300009085 | Freshwater Sediment | ATINSICKWRVYFAGELLATFETEKDARDYAEFIDRQ* |
Ga0105103_109407171 | 3300009085 | Freshwater Sediment | MLKARVVKATINSICKWRVYFAGELLATFESEKDARDYAEFIDRQ* |
Ga0114980_107876782 | 3300009152 | Freshwater Lake | MTKIKALVVRASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0114968_101335943 | 3300009155 | Freshwater Lake | MIKALVVRATINNIVKWRVYFAGELLATFENEGDARDYAEFIDQ* |
Ga0114978_107678121 | 3300009159 | Freshwater Lake | VVRASINEIIKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0105102_106319042 | 3300009165 | Freshwater Sediment | MLKARVVKATINSIEKWRVYFAGELLATFETEKDARDYAEFIDRQ* |
Ga0105097_105596204 | 3300009169 | Freshwater Sediment | VKATINSICKWRVYFAGELLATFETEKDARDYAEFIDRQ* |
Ga0105096_103631003 | 3300009170 | Freshwater Sediment | VVKATINSICKWRVYFAGELLATFESEKDARDYAEFIDRQ* |
Ga0114974_102096111 | 3300009183 | Freshwater Lake | KALVVRASINEIIKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0114974_106332391 | 3300009183 | Freshwater Lake | MTKIKALVVRASINNIVKWRVYFAGELLATFENETDAIYYANFIDRQ* |
Ga0114982_10486936 | 3300009419 | Deep Subsurface | MLKARVVKATINFIEKWRVYFAGELLATFETEKDARDYAEFIDRQ* |
Ga0129333_106592103 | 3300010354 | Freshwater To Marine Saline Gradient | MKAIVIKATINFICKWRVYFGGELLATFENEQDAHDYAKFINDQQ* |
Ga0129333_115447132 | 3300010354 | Freshwater To Marine Saline Gradient | MKAIVIKATINFICKWRVYFGGELLATFENEQDANDYAKFINDQQ* |
Ga0139557_10161455 | 3300011010 | Freshwater | MKAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFIDEQ |
Ga0151515_1017649 | 3300011114 | Freshwater | VVKATINFIVKWRVYFAGELLATFETEQDAKDYANLIDQQDNN* |
Ga0153702_152529 | 3300011337 | Freshwater | MKAIVIKATINFICKWRVYFAGELLATFENEQDAHDYAKFINDQQ* |
Ga0153801_10284665 | 3300012017 | Freshwater | MKAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFIN |
Ga0157142_10371861 | 3300012347 | Freshwater | LSRMKAIVIRASINFITKWRVYFAGELLATFENESDAQDYADFINAQGL* |
Ga0157203_10028657 | 3300012663 | Freshwater | MLKARVVKATINSICKWRVYFAGELLATFETEKDARDYAEFIDRQ* |
Ga0177922_100132691 | 3300013372 | Freshwater | MKAVVIKATINFITKWRVYFAGELLATFESKQDAHDYAKFINEQ* |
Ga0177922_111283931 | 3300013372 | Freshwater | INEIIKWRVYFAGQLLATFENETDAIYYANFIDRQ* |
Ga0134314_1124023 | 3300014711 | Surface Water | MRAQVIKATINFLVKWRVYYGGELIATFETEQSAKAYADWIDKQ |
Ga0181364_10205331 | 3300017701 | Freshwater Lake | ALVVRASINEIIKWRVYFAGELLATFENEGDARDYAEFIDRQ |
Ga0181364_10238655 | 3300017701 | Freshwater Lake | MTNLKALVVRASINEIIKWRVYFAGELLATFENEGDAR |
Ga0181364_10239554 | 3300017701 | Freshwater Lake | MTNLKALVVRASINEIIKWRVYFAGELLATFENEGD |
Ga0181364_10600681 | 3300017701 | Freshwater Lake | MTNLKALVVRASINEIIKWRVYFAGELLATFENEGDARDYAQFIDQQ |
Ga0181363_10347623 | 3300017707 | Freshwater Lake | QSRMKAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0181365_11649051 | 3300017736 | Freshwater Lake | INNIVKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0181356_10796695 | 3300017761 | Freshwater Lake | MTNLKALVVRATINNIVKWRVYFAGQLLATFENEQDAMEYAEFIDRQ |
Ga0181358_10610765 | 3300017774 | Freshwater Lake | MTNLKALVVRASINEIIKWRVYFAGELLATFENEGDARDYAEFID |
Ga0181355_11551751 | 3300017785 | Freshwater Lake | INEIIKWRVYFAGELLATFENEGDARDYAEFIDRQ |
Ga0181359_10103417 | 3300019784 | Freshwater Lake | MTNLKALVVKASINNIIKWRVYFAGQLLATFENEQDAMEYAEFIDRQ |
Ga0181359_10277705 | 3300019784 | Freshwater Lake | MTNLKALVIRASINEIVKWRVYFAGQLLATFENEQDAMEYAEFIDRQ |
Ga0181359_10959341 | 3300019784 | Freshwater Lake | KNFKMTNLKALVVRASINEIIKWRVYFAGELLATFENEGDARDYAEFIDRQ |
Ga0181359_11921202 | 3300019784 | Freshwater Lake | MLKARVIKATINSIEKWRVYFAGELLATFETEKDARDYAEFIDRQ |
Ga0211736_101476822 | 3300020151 | Freshwater | MLKALVVKATINFIVKWRVYFAGELLATFENEQDAKDYANFIDQQDNN |
Ga0211735_103582474 | 3300020162 | Freshwater | MLKALVVKATINFIVKWRVYYAGELLATFENEQDAKDYANFIDQQDNN |
Ga0208050_10092875 | 3300020498 | Freshwater | VVKATINSICKWRVYFAGELLATFETEKDARDYAEFIDRQ |
Ga0208088_10323482 | 3300020505 | Freshwater | MLKARVVKATINSIEKWRVYFAGELLATFECEKDARDYAEFIDGQ |
Ga0208232_10050945 | 3300020527 | Freshwater | MLKALVVKASINFIIKWRVYYAGELLATFENEQDAIDYANFIDRQ |
Ga0208232_10491533 | 3300020527 | Freshwater | KASINFIIKWRVYFAGELLATFENEQDAIDYANFIDRQ |
Ga0208235_10052333 | 3300020530 | Freshwater | MLKARVVKATINSIEKWRVYFAGELLATFETEKDARDYAAFIDRQ |
Ga0208601_10021159 | 3300020532 | Freshwater | MLKARVVKATINSICKWRVYFAGELLATFESEKDARDYAAFIDRQ |
Ga0207941_10413842 | 3300020539 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAKDYAEFIDQQEDSN |
Ga0208857_10715873 | 3300020542 | Freshwater | TVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ |
Ga0208361_10335291 | 3300020547 | Freshwater | KMLKARVVKATINSIEKWRVYFAGELLATFECEKDARDYAEFIDGQ |
Ga0208358_10643493 | 3300020555 | Freshwater | VVKATINSIEKWRVYFAGELLATFETEKDARDYAAFIDRQ |
Ga0208486_10652101 | 3300020556 | Freshwater | MTKIKALVVRASINEIIKWRVYFAGELLATFENETDAIYYANF |
Ga0208852_10093715 | 3300020560 | Freshwater | ALVVKASINFIIKWRVYFAGELLATFENEQDAIEYANFIDRQ |
Ga0213922_10228224 | 3300021956 | Freshwater | MLKALVVKATINFIVKWRVYYAGELLATFENEQDANDYAKFIDQQEDNN |
Ga0222714_101006511 | 3300021961 | Estuarine Water | GRTSTTLSRMKAIVIKATINFICKWRVYFGGELLATFETEQDAHDYAKFINDQQ |
Ga0222713_100671385 | 3300021962 | Estuarine Water | MKAIVIKATINFICKWRVYFGGELLATFENEQDAHDYAKFVNEQ |
Ga0222712_101164175 | 3300021963 | Estuarine Water | FGRTSTTLSRMKAIVIKATINFICKWRVYFGGELLATFETEQDAHDYAKFINDQQ |
Ga0222712_103936751 | 3300021963 | Estuarine Water | INFISKWRVYYAGELLATFENEKDARDYAAFIDSQ |
Ga0181354_10476501 | 3300022190 | Freshwater Lake | MTNLKALVVRASINEIIKWRVYFAGELLATFENEGDARDYAEFIDSQ |
Ga0212119_10115291 | 3300022543 | Freshwater | MLQARVVKATINSICKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0255252_10275693 | 3300024853 | Freshwater | MKATVVKATINFISKWRVYYAGELLATFENEKDARYYAAFIDSQ |
Ga0208644_13675903 | 3300025889 | Aqueous | MINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ |
Ga0209851_10344201 | 3300026902 | Sand | TNLKALVVKASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209892_10067464 | 3300026919 | Sand | MTNLKALVVKASINNIIKWRVYFAGELLATFENET |
Ga0255105_10100811 | 3300027143 | Freshwater | TINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ |
Ga0255113_10396125 | 3300027147 | Freshwater | KAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0255198_10516713 | 3300027160 | Freshwater | MKARVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ |
Ga0255129_10587511 | 3300027286 | Freshwater | MKATVVKATINFISKWRVYYAGELLATFENEKDARDYAAFI |
Ga0255119_10993341 | 3300027596 | Freshwater | VVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0209769_12146883 | 3300027679 | Freshwater Lake | VVRASINEIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209392_10230176 | 3300027683 | Freshwater Sediment | MLKARVVKATINSICKWRVYFAGELLATFETEKDARDYAEFI |
Ga0209033_11019033 | 3300027697 | Freshwater Lake | TSITQSRMKAIVIRATINHICKWRVYFAGELLATFETEQDAHDYAKFINEQ |
Ga0209033_11079103 | 3300027697 | Freshwater Lake | IKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0209033_11272491 | 3300027697 | Freshwater Lake | MKAVVIKATINFITKWRVYFAGELLATFESEQDAHDY |
Ga0209442_13342563 | 3300027732 | Freshwater Lake | ASINDIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209190_100032927 | 3300027736 | Freshwater Lake | MTKIKALVVRASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209597_12038093 | 3300027746 | Freshwater Lake | INNIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209596_100070645 | 3300027754 | Freshwater Lake | MIKALVVRATINNIVKWRVYFAGELLATFENEGDARDYAEFIDQ |
Ga0209596_10039854 | 3300027754 | Freshwater Lake | MTKIKALVVRATINNIVKWRVYFAGELLATFENENDAIYYANFIDRQ |
Ga0209296_10574165 | 3300027759 | Freshwater Lake | MTNLKALVVKASINNIIKWRVYFAGELLATFENEGDARDYAEFIDGQ |
Ga0209296_10609306 | 3300027759 | Freshwater Lake | MTKIKALVVRASINNIVKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209296_10794281 | 3300027759 | Freshwater Lake | IKALVVRASINEIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209296_11096202 | 3300027759 | Freshwater Lake | MTKIKALVVRASINEIIKWRVYFAGQLLATFENEKDAMEYAEFIDRQ |
Ga0209296_13610041 | 3300027759 | Freshwater Lake | LKALVVRASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209296_13764342 | 3300027759 | Freshwater Lake | MTKLKALVVRASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209134_101850383 | 3300027764 | Freshwater Lake | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAI |
Ga0209134_103319403 | 3300027764 | Freshwater Lake | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAIEYANFIDRQ |
Ga0209246_101799761 | 3300027785 | Freshwater Lake | MLKALVVKATINFIVKWRVYWAGELLATFENEQDAKDYANFIDQQDNN |
Ga0209400_13562853 | 3300027963 | Freshwater Lake | TKIKALVVRASINNIIKWRVYFAGELLATFENETDAIYYANFIDRQ |
Ga0209191_10494831 | 3300027969 | Freshwater Lake | ASINNIIKWRVYFAGELLATFENEGDARDYAEFIDGQ |
Ga0209298_101039221 | 3300027973 | Freshwater Lake | MTNLRALVVRASINNIIKWRVYFAGQLLATFENEKDAMEYANFIDRQXANDT |
Ga0209299_10243221 | 3300027974 | Freshwater Lake | IKALVVRASINEIIKWRVYFAGQLLATFENEKDAMEYAEFIDRQ |
Ga0247723_10336157 | 3300028025 | Deep Subsurface Sediment | RVVKATINFIEKWRVYFAGELLATFETEKDARDYAEFIDRQ |
Ga0135227_10287852 | 3300029302 | Marine Harbor | MKAIVIKATINFICKWRVYFAGELLATFENEQDAHDYAKFINDQQ |
Ga0315291_104461141 | 3300031707 | Sediment | MIKALVVRATINNIVKWRVYFAGELLATFENETDAQQYAEFIDRQ |
Ga0315293_105091331 | 3300031746 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAMEYAEFID |
Ga0315288_102120512 | 3300031772 | Sediment | MIKALVVRATINNIVKWRVYFAGELLATFETETDAQQYAEFIDRQ |
Ga0315288_103019544 | 3300031772 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAKDYAEFIDQQDGN |
Ga0315900_101731625 | 3300031787 | Freshwater | MLKARVVKATINFIEKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0315904_112650251 | 3300031951 | Freshwater | MLKARVVKATINFIEKWRVYFAGELLATFESEQDAHDYAKFI |
Ga0315294_100927625 | 3300031952 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAMEYAEFIDRQ |
Ga0315294_103162395 | 3300031952 | Sediment | MLKALVVRATINEIIKWRVYYAGELLATFENEQDAIEYANFIDRQ |
Ga0315294_114961321 | 3300031952 | Sediment | RQKMIKALVVKASINFIIKWRVYFAGQLLATFENEQDAKDYAEFIDQQDGN |
Ga0315278_117513143 | 3300031997 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAKDYAEFIDQQD |
Ga0315274_100969501 | 3300031999 | Sediment | IKALVVKASINFIIKWRVYFAGQLLATFENEQDAMEYAEFIDRQ |
Ga0315274_117577581 | 3300031999 | Sediment | RATINEIIKWRVYYAGELLATFENEQDAIEYANFIDRQ |
Ga0315289_108079173 | 3300032046 | Sediment | MTNLKALVVKATINNVVKWRVYFAGELLATFENEGDARDYAEFIDQQ |
Ga0315289_109782483 | 3300032046 | Sediment | FIIKWRVYFAGQLLATFENEQDAKDYAEFIDQQDGN |
Ga0315284_104022642 | 3300032053 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAKDYAEFIDQQ |
Ga0315905_112095501 | 3300032092 | Freshwater | MTKIKALVVRASINDIIKWRVYFAGQLLATFENEQDAMGYAEFIDRQ |
Ga0315903_111478723 | 3300032116 | Freshwater | ITQSRMKAVVIKATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0315903_112333773 | 3300032116 | Freshwater | RGLGRTSITLSRMKAIVIRATINFITKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0315276_114221981 | 3300032177 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAMEYAE |
Ga0315287_101782651 | 3300032397 | Sediment | MIKALVVRATINNIVKWRVYFAGELLATFETETDAQQYAE |
Ga0315273_131035633 | 3300032516 | Sediment | MIKALVVKASINFIIKWRVYFAGQLLATFENEQDAKDYAEFIDQQDGNXIY |
Ga0334722_105743791 | 3300033233 | Sediment | MIKALVVRATINNIVKWRVYFAGELLATFEMETDAQQYAEFIDRQ |
Ga0334982_0248687_647_784 | 3300033981 | Freshwater | MLKARVVKATINSIEKWRVYFAGELLATFECEKDARDYAAFIDRQ |
Ga0334989_0072902_331_468 | 3300033984 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEKDAMEYAEFIDRQ |
Ga0334994_0000679_20242_20391 | 3300033993 | Freshwater | MWDISMKATVVKATINFISKWRVYYAGELLATFENEKDARDYAAFIDSQ |
Ga0334994_0107906_21_158 | 3300033993 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAIDYANFIDRQ |
Ga0334996_0344788_38_175 | 3300033994 | Freshwater | MLKARVVKATINSICKWRVYFAGELLATFENEKDARDYAEFIDRQ |
Ga0335003_0334541_3_122 | 3300033995 | Freshwater | VKASINFIIKWRVYFAGELLATFENEKDAMEYAEFIDRQ |
Ga0334979_0615005_1_132 | 3300033996 | Freshwater | KARVVKATINSIEKWRVYFAGELLATFETEKDARDYAEFIDRQ |
Ga0334991_0429026_393_500 | 3300034013 | Freshwater | INSIEKWRVYFAGELLATFETEKDARDYAEFIDRQ |
Ga0334985_0225541_803_940 | 3300034018 | Freshwater | MLKARVVKATINSIEKWRVYFAGELLATFECEKDARDYAEFIDRQ |
Ga0334985_0524408_553_675 | 3300034018 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAIEYANF |
Ga0335002_0275611_888_995 | 3300034020 | Freshwater | MLKARVVKATINSIEKWRVYFAGELLATFETEKDAR |
Ga0334987_0005542_635_772 | 3300034061 | Freshwater | MLKARVVKATINSIEKWRVYFAGELLATFENEKDARDYAEFIDRQ |
Ga0334995_0220888_268_405 | 3300034062 | Freshwater | MLKARVVKATINSICKWRVYFAGELLATFECEKDARDYAEFIDRQ |
Ga0334995_0566243_554_667 | 3300034062 | Freshwater | ATINSICKWRVYFAGELLATFENEKDARDYAEFIDRQ |
Ga0335031_0363521_2_127 | 3300034104 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAKDYAEFI |
Ga0335035_0678182_379_531 | 3300034105 | Freshwater | FKVGKMLKALVVKASINFIIKWRVYFAGELLATFENEKDAMEYAEFIDRQ |
Ga0335036_0001111_22274_22408 | 3300034106 | Freshwater | MKAVVIKATINFITKWRVYFAGELLATFETEKDARDYAEFIDRQ |
Ga0335036_0550480_1_126 | 3300034106 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEQDAIDYANFI |
Ga0335063_0012352_3945_4079 | 3300034111 | Freshwater | MKAVVIKATINFICKWRVYFAGELLATFESEQDAHDYAKFINEQ |
Ga0335052_0549803_460_588 | 3300034279 | Freshwater | MLKALVVKASINFIIKWRVYFAGELLATFENEKDAMEYAEFID |
Ga0335013_0197366_2_148 | 3300034284 | Freshwater | MLKALVVKASINFIIKWRVYYAGELLATFENEQDAIEYANFIDRQWRQL |
Ga0335048_0156092_2_127 | 3300034356 | Freshwater | LVVKASINFIIKWRVYFAGELLATFENEKDAMEYAEFIDRQ |
⦗Top⦘ |