NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039163

Metagenome / Metatranscriptome Family F039163

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039163
Family Type Metagenome / Metatranscriptome
Number of Sequences 164
Average Sequence Length 41 residues
Representative Sequence EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Number of Associated Samples 139
Number of Associated Scaffolds 164

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 5.49 %
% of genes near scaffold ends (potentially truncated) 87.80 %
% of genes from short scaffolds (< 2000 bps) 86.59 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (47.561 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(17.683 % of family members)
Environment Ontology (ENVO) Unclassified
(23.171 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.415 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.88%    β-sheet: 0.00%    Coil/Unstructured: 76.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 164 Family Scaffolds
PF00499Oxidored_q3 6.10
PF00510COX3 4.27
PF00361Proton_antipo_M 0.61
PF00420Oxidored_q2 0.61
PF00119ATP-synt_A 0.61
PF00507Oxidored_q4 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 164 Family Scaffolds
COG0839NADH:ubiquinone oxidoreductase subunit 6 (chain J)Energy production and conversion [C] 6.10
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 4.27
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 0.61
COG0838NADH:ubiquinone oxidoreductase subunit 3 (chain A)Energy production and conversion [C] 0.61


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.44 %
UnclassifiedrootN/A47.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000904|JGI12053J12875_102681Not Available557Open in IMG/M
3300001078|JGI12640J13246_100107All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1990Open in IMG/M
3300001661|JGI12053J15887_10004521All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes7170Open in IMG/M
3300001661|JGI12053J15887_10082860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1762Open in IMG/M
3300001867|JGI12627J18819_10090263All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1269Open in IMG/M
3300002667|Ga0005492J37276_105404Not Available889Open in IMG/M
3300002681|Ga0005471J37259_110616Not Available524Open in IMG/M
3300003674|Ga0006876_103752Not Available640Open in IMG/M
3300004133|Ga0058892_1323724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi1059Open in IMG/M
3300004139|Ga0058897_11194467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1344Open in IMG/M
3300004401|Ga0068980_1003983Not Available597Open in IMG/M
3300004482|Ga0068936_1057581All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1399Open in IMG/M
3300004606|Ga0068962_1025277All Organisms → cellular organisms → Eukaryota1444Open in IMG/M
3300004608|Ga0068924_1022974All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus942Open in IMG/M
3300004619|Ga0068953_1024578Not Available593Open in IMG/M
3300004634|Ga0066906_10965013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata593Open in IMG/M
3300004801|Ga0058860_11389198Not Available805Open in IMG/M
3300004972|Ga0072325_1040830All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1398Open in IMG/M
3300004972|Ga0072325_1050637Not Available514Open in IMG/M
3300005165|Ga0066869_10090202Not Available600Open in IMG/M
3300005171|Ga0066677_10249749All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1007Open in IMG/M
3300005331|Ga0070670_100042876Not Available3891Open in IMG/M
3300005454|Ga0066687_10274854Not Available947Open in IMG/M
3300005459|Ga0068867_100443305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1104Open in IMG/M
3300005537|Ga0070730_10212937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1285Open in IMG/M
3300005537|Ga0070730_10694746Not Available645Open in IMG/M
3300005541|Ga0070733_10131621All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1614Open in IMG/M
3300005556|Ga0066707_10149798All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1478Open in IMG/M
3300005576|Ga0066708_10540736Not Available750Open in IMG/M
3300005591|Ga0070761_10696791Not Available636Open in IMG/M
3300005841|Ga0068863_101892290Not Available606Open in IMG/M
3300005950|Ga0066787_10059130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus752Open in IMG/M
3300006028|Ga0070717_10941726Not Available786Open in IMG/M
3300006031|Ga0066651_10340042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus806Open in IMG/M
3300006358|Ga0068871_100081524Not Available2681Open in IMG/M
3300006423|Ga0075039_1075985Not Available804Open in IMG/M
3300006423|Ga0075039_1083462Not Available770Open in IMG/M
3300006423|Ga0075039_1111502All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1236Open in IMG/M
3300006423|Ga0075039_1116901Not Available1236Open in IMG/M
3300006426|Ga0075037_1056569All Organisms → cellular organisms → Eukaryota1089Open in IMG/M
3300006426|Ga0075037_1169110All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus764Open in IMG/M
3300006893|Ga0073928_10002069All Organisms → cellular organisms → Eukaryota → Opisthokonta36046Open in IMG/M
3300006893|Ga0073928_10518023All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus853Open in IMG/M
3300007327|Ga0075016_1447099All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1070Open in IMG/M
3300009500|Ga0116229_10028490Not Available6415Open in IMG/M
3300009500|Ga0116229_10031445Not Available5924Open in IMG/M
3300009500|Ga0116229_10046249Not Available4425Open in IMG/M
3300009624|Ga0116105_1158545Not Available604Open in IMG/M
3300009633|Ga0116129_1041153All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1473Open in IMG/M
3300009633|Ga0116129_1056397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1202Open in IMG/M
3300009695|Ga0123337_10346657All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus730Open in IMG/M
3300009709|Ga0116227_10536542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus888Open in IMG/M
3300009828|Ga0130087_1016538Not Available504Open in IMG/M
3300009828|Ga0130087_1032451Not Available630Open in IMG/M
3300010164|Ga0063827_128956All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi1526Open in IMG/M
3300010343|Ga0074044_10686601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus668Open in IMG/M
3300010364|Ga0134066_10305046Not Available573Open in IMG/M
3300010860|Ga0126351_1050824All Organisms → Viruses → Predicted Viral1125Open in IMG/M
3300011026|Ga0138566_122331Not Available654Open in IMG/M
3300011074|Ga0138559_1062631Not Available697Open in IMG/M
3300011120|Ga0150983_10237938All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus752Open in IMG/M
3300011120|Ga0150983_11856405Not Available588Open in IMG/M
3300011120|Ga0150983_12544556Not Available552Open in IMG/M
3300011120|Ga0150983_12596907All Organisms → cellular organisms → Eukaryota1344Open in IMG/M
3300011120|Ga0150983_13611864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1186Open in IMG/M
3300011120|Ga0150983_14225433Not Available557Open in IMG/M
3300011120|Ga0150983_16082477Not Available590Open in IMG/M
3300012161|Ga0137336_1078887All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus612Open in IMG/M
3300012207|Ga0137381_11528922All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus559Open in IMG/M
3300012212|Ga0150985_108581428Not Available545Open in IMG/M
3300012371|Ga0134022_1154913All Organisms → Viruses → Predicted Viral1326Open in IMG/M
3300012924|Ga0137413_10297603All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1126Open in IMG/M
3300013105|Ga0157369_12299708Not Available546Open in IMG/M
3300014169|Ga0181531_10338616All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus922Open in IMG/M
3300014495|Ga0182015_10033940Not Available3898Open in IMG/M
3300014495|Ga0182015_10907572Not Available552Open in IMG/M
3300014498|Ga0182019_10026316Not Available3229Open in IMG/M
3300014501|Ga0182024_12659098Not Available536Open in IMG/M
3300015076|Ga0167656_1000110Not Available9498Open in IMG/M
3300016700|Ga0181513_1294793Not Available613Open in IMG/M
3300016700|Ga0181513_1295592Not Available742Open in IMG/M
3300017935|Ga0187848_10170681All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus948Open in IMG/M
3300017946|Ga0187879_10397664Not Available763Open in IMG/M
3300017948|Ga0187847_10323904All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus843Open in IMG/M
3300018025|Ga0187885_10014571Not Available4803Open in IMG/M
3300018414|Ga0194135_10972353Not Available539Open in IMG/M
3300019162|Ga0184597_112331All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300019176|Ga0184596_123904Not Available592Open in IMG/M
3300019192|Ga0184603_125639All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus735Open in IMG/M
3300020382|Ga0211686_10369332Not Available583Open in IMG/M
3300021170|Ga0210400_10142064All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1929Open in IMG/M
3300021420|Ga0210394_10442005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1144Open in IMG/M
3300021479|Ga0210410_10632276All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus949Open in IMG/M
3300022154|Ga0213929_1012158Not Available774Open in IMG/M
3300022156|Ga0213934_1007487Not Available1375Open in IMG/M
3300022501|Ga0242645_1008102All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus794Open in IMG/M
3300022504|Ga0242642_1008592All Organisms → Viruses → Predicted Viral1220Open in IMG/M
3300022533|Ga0242662_10042003All Organisms → Viruses → Predicted Viral1148Open in IMG/M
3300022557|Ga0212123_10002065All Organisms → cellular organisms → Eukaryota → Opisthokonta50549Open in IMG/M
3300023063|Ga0233335_1078390Not Available584Open in IMG/M
3300023074|Ga0247737_1064681All Organisms → Viruses → Predicted Viral1084Open in IMG/M
3300023562|Ga0247516_108348All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1131Open in IMG/M
3300023563|Ga0247530_105028All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300023564|Ga0247515_111493All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus917Open in IMG/M
3300024330|Ga0137417_1351333All Organisms → cellular organisms → Eukaryota → Opisthokonta1958Open in IMG/M
3300025404|Ga0208936_1006107All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1437Open in IMG/M
3300025454|Ga0208039_1082372Not Available563Open in IMG/M
3300026214|Ga0209838_1035901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus713Open in IMG/M
3300026322|Ga0209687_1113550Not Available875Open in IMG/M
3300026542|Ga0209805_1274822Not Available646Open in IMG/M
3300027058|Ga0209111_1044301Not Available571Open in IMG/M
3300027303|Ga0208999_1000554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus2813Open in IMG/M
3300027303|Ga0208999_1010778All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1154Open in IMG/M
3300027307|Ga0209327_1046210Not Available626Open in IMG/M
3300027439|Ga0209332_1010255All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1882Open in IMG/M
3300027496|Ga0208987_1055676Not Available712Open in IMG/M
3300027524|Ga0208998_1042039Not Available739Open in IMG/M
3300027574|Ga0208982_1096384Not Available601Open in IMG/M
3300027587|Ga0209220_1000686Not Available10444Open in IMG/M
3300027609|Ga0209221_1020336All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1756Open in IMG/M
3300027651|Ga0209217_1211075Not Available518Open in IMG/M
3300027663|Ga0208990_1107990Not Available766Open in IMG/M
3300027698|Ga0209446_1006882Not Available2780Open in IMG/M
3300027698|Ga0209446_1055859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1000Open in IMG/M
3300027701|Ga0209447_10000572Not Available10317Open in IMG/M
3300027738|Ga0208989_10113845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus919Open in IMG/M
3300027768|Ga0209772_10071644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1046Open in IMG/M
3300027867|Ga0209167_10108198All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1428Open in IMG/M
3300028082|Ga0255352_1016672All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1423Open in IMG/M
3300028536|Ga0137415_10843286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus726Open in IMG/M
3300028645|Ga0302158_1029823Not Available826Open in IMG/M
3300028759|Ga0302224_10090210All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1173Open in IMG/M
3300028769|Ga0302213_1030346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1667Open in IMG/M
3300028780|Ga0302225_10003686All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Mollisiaceae → Phialocephala8801Open in IMG/M
3300028795|Ga0302227_10250262Not Available677Open in IMG/M
3300029923|Ga0311347_10762675Not Available588Open in IMG/M
3300029944|Ga0311352_10000420All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya53023Open in IMG/M
3300030019|Ga0311348_10040006Not Available3442Open in IMG/M
3300030053|Ga0302177_10029621All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Mollisiaceae → Phialocephala3435Open in IMG/M
3300030114|Ga0311333_10025549Not Available4084Open in IMG/M
3300030589|Ga0210255_10631821Not Available747Open in IMG/M
3300030743|Ga0265461_10138233All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1320Open in IMG/M
3300030799|Ga0074010_10085155Not Available751Open in IMG/M
3300030846|Ga0075403_11557832All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus942Open in IMG/M
3300030849|Ga0075393_10012968All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus807Open in IMG/M
3300030887|Ga0265733_102946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata611Open in IMG/M
3300030891|Ga0315865_122387Not Available503Open in IMG/M
3300030908|Ga0074005_10180781Not Available791Open in IMG/M
3300030920|Ga0102762_1034464All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1241Open in IMG/M
3300030920|Ga0102762_1036796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1356Open in IMG/M
3300030931|Ga0074006_10067767All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1337Open in IMG/M
3300030935|Ga0075401_10071214All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1059Open in IMG/M
3300030937|Ga0138302_1782093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata528Open in IMG/M
3300031065|Ga0315807_110936Not Available630Open in IMG/M
3300031232|Ga0302323_100564158All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus1229Open in IMG/M
3300031240|Ga0265320_10237622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus809Open in IMG/M
3300031521|Ga0311364_11364857Not Available702Open in IMG/M
3300031708|Ga0310686_103214036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata761Open in IMG/M
3300031708|Ga0310686_113173605Not Available515Open in IMG/M
3300031809|Ga0316048_109634Not Available516Open in IMG/M
3300032121|Ga0316040_101782All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300032515|Ga0348332_12574167Not Available653Open in IMG/M
3300032515|Ga0348332_13916498All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus2135Open in IMG/M
3300032896|Ga0335075_11675480Not Available518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil17.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.71%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.66%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil3.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.05%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.05%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.44%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.44%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.44%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.83%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.83%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.83%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.22%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.22%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.22%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.61%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.61%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.61%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.61%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.61%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.61%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.61%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.61%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.61%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.61%
Leaf LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter0.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.61%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.61%
Ionic Liquid And High Solid EnrichedEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched0.61%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000904Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3EnvironmentalOpen in IMG/M
3300001078Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002667Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF141 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002681Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300003674Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004133Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004401Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004482Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 24 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004606Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004608Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004619Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004634High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10DEngineeredOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004972Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005165Soil and rhizosphere microbial communities from Laval, Canada - mgHMCEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006423Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006426Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007327Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009695Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaGEnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009828Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample EHost-AssociatedOpen in IMG/M
3300010164Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011026Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 51 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011074Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012161Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012371Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015076Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6a, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300016700Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018414Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013EnvironmentalOpen in IMG/M
3300019162Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019176Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019192Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022154Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022156Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022501Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023063Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-222EnvironmentalOpen in IMG/M
3300023074Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L028-104C-2EnvironmentalOpen in IMG/M
3300023562Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023563Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023564Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025404Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026214Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300027058Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027303Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027496Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027574Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028082Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028645Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_1EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028769Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030799Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030846Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030849Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030887Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030891Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T26 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030908Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030920Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030931Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031065Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031809Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032121Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12053J12875_10268113300000904Forest SoilMXVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS*
JGI12640J13246_10010713300001078Forest SoilMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQC*
JGI12053J15887_1000452113300001661Forest SoilIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGKA*
JGI12053J15887_1008286053300001661Forest SoilSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV*
JGI12627J18819_1009026313300001867Forest SoilRSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV*
Ga0005492J37276_10540413300002667Forest SoilVAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0005471J37259_11061613300002681Forest SoilMYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY*
Ga0006876_10375213300003674Peatlands SoilEAERSIDHIGSEKNPIRIVQQWGILVNSLTAEPATWGNV*
Ga0058892_132372413300004133Forest SoilVEAERLIDHIGSEKTPRQISTAVGILVNGLTAELATSENEDHNGTLN*
Ga0058897_1119446723300004139Forest SoilMYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQY*
Ga0068980_100398323300004401Peatlands SoilSVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNAQLL*
Ga0068936_105758123300004482Peatlands SoilSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0068962_102527713300004606Peatlands SoilKFVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWENE*
Ga0068924_102297433300004608Peatlands SoilVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0068953_102457813300004619Peatlands SoilSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNE*
Ga0066906_1096501313300004634Ionic Liquid And High Solid EnrichedERFIDHIGSEKTPICTVQQWGILVNGLTAEPAIWRNVIV*
Ga0058860_1138919813300004801Host-AssociatedVAERSIDHNGSEKTPTSNGQQWGILVNDLTVEPATRMNYGLEAT*
Ga0072325_104083013300004972Peatlands SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0072325_105063713300004972Peatlands SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWRNV*
Ga0066869_1009020223300005165SoilVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0066677_1024974933300005171SoilVVETERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV*
Ga0070670_10004287653300005331Switchgrass RhizosphereVAERSIDHIGSEKSPIRKVQQWGILVNSLTAEPATWRNE*
Ga0066687_1027485413300005454SoilMIKLYQIYIYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY*
Ga0068867_10044330513300005459Miscanthus RhizosphereNSVVEAERSIDHIGSEKTPIRFVQQWGILVNGLTAEPATWGNV*
Ga0070730_1021293713300005537Surface SoilEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV*
Ga0070730_1069474613300005537Surface SoilMYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLRTEPA
Ga0070733_1013162113300005541Surface SoilERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0066707_1014979813300005556SoilERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV*
Ga0066708_1054073623300005576SoilIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV*
Ga0070761_1069679113300005591SoilERLIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV*
Ga0068863_10189229013300005841Switchgrass RhizosphereAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWGNV*
Ga0066787_1005913013300005950SoilTERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV*
Ga0070717_1094172623300006028Corn, Switchgrass And Miscanthus RhizosphereSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV*
Ga0066651_1034004213300006031SoilIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0068871_10008152413300006358Miscanthus RhizosphereRSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV*
Ga0075039_107598523300006423Permafrost SoilRSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0075039_108346213300006423Permafrost SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENE*
Ga0075039_111150213300006423Permafrost SoilNSVIEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNV*
Ga0075039_111690113300006423Permafrost SoilERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNE*
Ga0075037_105656913300006426Permafrost SoilPIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV*
Ga0075037_116911013300006426Permafrost SoilLAHVPAVETERSIDHIGSEKSPRQIVQQWGILVNSLMAEPATWKNV*
Ga0073928_10002069323300006893Iron-Sulfur Acid SpringMSYLAKPVIKAERSIDHIGSEKTPIRLVQQWGILVNGLTAEPAT*GNV*
Ga0073928_1051802313300006893Iron-Sulfur Acid SpringEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV*
Ga0075016_144709913300007327WatershedsSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA*
Ga0116229_1002849013300009500Host-AssociatedVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNV*
Ga0116229_1003144513300009500Host-AssociatedVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE*
Ga0116229_1004624913300009500Host-AssociatedVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNE*
Ga0116105_115854513300009624PeatlandEAERSIDHIGSEKTPIRIVLQWGILVNSRQAEPAT*
Ga0116129_104115313300009633PeatlandVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA*
Ga0116129_105639713300009633PeatlandNSVVEAERSIDHIGSEKTPIRVVQQWGILVNGLTAEPATWRNV*
Ga0123337_1034665713300009695Glacier ValleyAVATERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV*
Ga0116227_1053654213300009709Host-AssociatedNSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWRNV*
Ga0130087_101653813300009828Host-AssociatedVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV*
Ga0130087_103245113300009828Host-AssociatedEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV*
Ga0063827_12895613300010164Peatlands SoilIDHIGSEKNPIRIVQQWGILVNSLTAEPATWGNV*
Ga0074044_1068660113300010343Bog Forest SoilIDHIGSEKTPIRIVQQ*GILVNGLTAEPVT*KNV*
Ga0134066_1030504613300010364Grasslands SoilYIYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY*
Ga0126351_105082423300010860Boreal Forest SoilSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY*
Ga0138566_12233113300011026Peatlands SoilSIDHIGSEKNPIRIVQQWGILVYSLTAEPATWGNV*
Ga0138559_106263113300011074Peatlands SoilIGSEKTPIRLVQQWGILVISLTAEPATWGNAQLL*
Ga0150983_1023793813300011120Forest SoilERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWRNV*
Ga0150983_1185640513300011120Forest SoilERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE*
Ga0150983_1254455613300011120Forest SoilERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNEQPSN*
Ga0150983_1259690713300011120Forest SoilERSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWENE*
Ga0150983_1361186413300011120Forest SoilSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWENV*
Ga0150983_1422543313300011120Forest SoilIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV*
Ga0150983_1608247713300011120Forest SoilAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNY*
Ga0137336_107888713300012161SoilSLGEDERSNEYNGSEKTPISIVQQWGILVNSLTAEPATWKN*
Ga0137381_1152892233300012207Vadose Zone SoilHIGAEKIPIQYDVQQWGILVNGLRAELATWRNGLFN*
Ga0150985_10858142813300012212Avena Fatua RhizosphereEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV*
Ga0134022_115491323300012371Grasslands SoilMIKLYQIYIYISEIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY*
Ga0137413_1029760313300012924Vadose Zone SoilDVSEVVTERLIDHTGPEKIPERTVQQWGILVNSRKAEPATWKNE*
Ga0157369_1229970813300013105Corn RhizosphereRSIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV*
Ga0181531_1033861613300014169BogRSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE*
Ga0182015_1003394013300014495PalsaSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNE*
Ga0182015_1090757213300014495PalsaMPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSL
Ga0182019_1002631613300014498FenERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNAQLLKCGWLPFF*
Ga0182024_1265909813300014501PermafrostAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA*
Ga0167656_1000110173300015076Glacier Forefield SoilMAQLAKNSVIGAERSTDHIGSEKTPIRLVQQ*GILVNSLTAEPVT*
Ga0181513_129479313300016700PeatlandVVEAERSIDHIGSDKTPIRIVQQWGILVNSLTSEPATWGNG
Ga0181513_129559213300016700PeatlandVVEAERSIDHIGSDKTPIRIVQQWGILVNSLTAERATWGNV
Ga0187848_1017068113300017935PeatlandSVIETERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNG
Ga0187879_1039766413300017946PeatlandEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNV
Ga0187847_1032390413300017948PeatlandERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0187885_1001457113300018025PeatlandVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA
Ga0194135_1097235313300018414WatershedsSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0184597_11233113300019162SoilEIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC
Ga0184596_12390413300019176SoilMYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC
Ga0184603_12563913300019192SoilMPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKM
Ga0211686_1036933213300020382MarineNSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0210400_1014206413300021170SoilMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC
Ga0210394_1044200513300021420SoilAVETERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV
Ga0210410_1063227613300021479SoilVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQY
Ga0213929_101215813300022154FreshwaterSIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV
Ga0213934_100748713300022156FreshwaterLAHISVVETERLIDHIGSEKTPIRLVQQWGILVNSLTSEPAIWVNV
Ga0242645_100810213300022501SoilYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC
Ga0242642_100859213300022504SoilTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0242662_1004200313300022533SoilSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0212123_10002065183300022557Iron-Sulfur Acid SpringMSYLAKPVIKAERSIDHIGSEKTPIRLVQQWGILVNGLTAEPATXGNV
Ga0233335_107839013300023063Leaf LitterAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNE
Ga0247737_106468113300023074Plant LitterQKPVVETERLIDHIGSEKTPIRIVQQWGILVNSLTAEPATWMNV
Ga0247516_10834813300023562SoilMYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS
Ga0247530_10502813300023563SoilIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0247515_11149313300023564SoilMYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0137417_135133323300024330Vadose Zone SoilATERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV
Ga0208936_100610713300025404PeatlandEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA
Ga0208039_108237213300025454PeatlandAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA
Ga0209838_103590113300026214SoilHVPAVETERSIDHIGSEKSPRQIVQQWGILVNSLMAEPATWKNV
Ga0209687_111355013300026322SoilMIKLYQIYIYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0209805_127482213300026542SoilSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV
Ga0209111_104430113300027058Forest SoilERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV
Ga0208999_100055443300027303Forest SoilVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGKA
Ga0208999_101077813300027303Forest SoilVATERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV
Ga0209327_104621013300027307Forest SoilSIDHTGPEKIPGRIVQQWGILVNSRKAEPATWKNV
Ga0209332_101025513300027439Forest SoilADYSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0208987_105567613300027496Forest SoilVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWRNV
Ga0208998_104203913300027524Forest SoilERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWRNV
Ga0208982_109638413300027574Forest SoilERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNVQPNLFG
Ga0209220_100068643300027587Forest SoilMAQLAKNSVVEAERSIDHIGSEKTPIRIVQQXGILVNSLPAEPVTXKNV
Ga0209221_102033613300027609Forest SoilMPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS
Ga0209217_121107513300027651Forest SoilVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0208990_110799013300027663Forest SoilEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0209446_100688213300027698Bog Forest SoilRSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNE
Ga0209446_105585923300027698Bog Forest SoilRSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV
Ga0209447_1000057213300027701Bog Forest SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNE
Ga0208989_1011384513300027738Forest SoilAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0209772_1007164413300027768Bog Forest SoilERLIDHIGYEKNPRQIVQQWGILVNGLKAEPAIWKIK
Ga0209167_1010819813300027867Surface SoilVVVAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0255352_101667213300028082SoilVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNG
Ga0137415_1084328613300028536Vadose Zone SoilEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAT
Ga0302158_102982313300028645FenVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNV
Ga0302224_1009021013300028759PalsaVPAVETERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV
Ga0302213_103034613300028769FenAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNE
Ga0302225_1000368613300028780PalsaVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0302227_1025026213300028795PalsaYSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0311347_1076267513300029923FenNSVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNA
Ga0311352_10000420713300029944PalsaERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE
Ga0311348_1004000613300030019FenVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNV
Ga0302177_1002962153300030053PalsaRSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV
Ga0311333_1002554913300030114FenNSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE
Ga0210255_1063182113300030589SoilMYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPA
Ga0265461_1013823313300030743SoilMPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC
Ga0074010_1008515513300030799SoilEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNGSIAFKVRV
Ga0075403_1155783213300030846SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA
Ga0075393_1001296813300030849SoilIPVVVTERSTDHIGPEKSPRQSAQQWGILVNGLTAEPAIWRNV
Ga0265733_10294613300030887SoilTERYIDHTGSEKTPVRIVQQXGILVNGLTAEPATWKNES
Ga0315865_12238713300030891Plant LitterMSVVKTERSIDHTGSEKTPVRVVQQXGILVNGLTAEP
Ga0074005_1018078113300030908SoilAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV
Ga0102762_103446413300030920SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWRNV
Ga0102762_103679613300030920SoilNSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWENV
Ga0074006_1006776713300030931SoilVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNV
Ga0075401_1007121423300030935SoilVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPAT
Ga0138302_178209313300030937SoilVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0315807_11093613300031065Plant LitterISLVENERSIEHTGSEKTQESILQHLGILVNGLTAETATWRNES
Ga0302323_10056415813300031232FenAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE
Ga0265320_1023762213300031240RhizosphereYIEICMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY
Ga0311364_1136485713300031521FenEAERSIDHIGSEKTPIRIVQQWGILVNSLPAEPATWGNE
Ga0310686_10321403613300031708SoilRSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWENV
Ga0310686_11317360513300031708SoilMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAI
Ga0316048_10963413300031809SoilRSYAYYMPMTVIVTERYTGHIGSDKTPIRTVPPCGILVNSLTTEPAIWKMQC
Ga0316040_10178213300032121SoilIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC
Ga0348332_1257416713300032515Plant LitterMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIW
Ga0348332_1391649813300032515Plant LitterVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS
Ga0335075_1167548013300032896SoilMKKLYRIIYYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.