Basic Information | |
---|---|
Family ID | F039163 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 164 |
Average Sequence Length | 41 residues |
Representative Sequence | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Number of Associated Samples | 139 |
Number of Associated Scaffolds | 164 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 5.49 % |
% of genes near scaffold ends (potentially truncated) | 87.80 % |
% of genes from short scaffolds (< 2000 bps) | 86.59 % |
Associated GOLD sequencing projects | 133 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (47.561 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (17.683 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.171 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.415 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.88% β-sheet: 0.00% Coil/Unstructured: 76.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 164 Family Scaffolds |
---|---|---|
PF00499 | Oxidored_q3 | 6.10 |
PF00510 | COX3 | 4.27 |
PF00361 | Proton_antipo_M | 0.61 |
PF00420 | Oxidored_q2 | 0.61 |
PF00119 | ATP-synt_A | 0.61 |
PF00507 | Oxidored_q4 | 0.61 |
COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
---|---|---|---|
COG0839 | NADH:ubiquinone oxidoreductase subunit 6 (chain J) | Energy production and conversion [C] | 6.10 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 4.27 |
COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.61 |
COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.44 % |
Unclassified | root | N/A | 47.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000904|JGI12053J12875_102681 | Not Available | 557 | Open in IMG/M |
3300001078|JGI12640J13246_100107 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1990 | Open in IMG/M |
3300001661|JGI12053J15887_10004521 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes | 7170 | Open in IMG/M |
3300001661|JGI12053J15887_10082860 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1762 | Open in IMG/M |
3300001867|JGI12627J18819_10090263 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1269 | Open in IMG/M |
3300002667|Ga0005492J37276_105404 | Not Available | 889 | Open in IMG/M |
3300002681|Ga0005471J37259_110616 | Not Available | 524 | Open in IMG/M |
3300003674|Ga0006876_103752 | Not Available | 640 | Open in IMG/M |
3300004133|Ga0058892_1323724 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1059 | Open in IMG/M |
3300004139|Ga0058897_11194467 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1344 | Open in IMG/M |
3300004401|Ga0068980_1003983 | Not Available | 597 | Open in IMG/M |
3300004482|Ga0068936_1057581 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1399 | Open in IMG/M |
3300004606|Ga0068962_1025277 | All Organisms → cellular organisms → Eukaryota | 1444 | Open in IMG/M |
3300004608|Ga0068924_1022974 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 942 | Open in IMG/M |
3300004619|Ga0068953_1024578 | Not Available | 593 | Open in IMG/M |
3300004634|Ga0066906_10965013 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 593 | Open in IMG/M |
3300004801|Ga0058860_11389198 | Not Available | 805 | Open in IMG/M |
3300004972|Ga0072325_1040830 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1398 | Open in IMG/M |
3300004972|Ga0072325_1050637 | Not Available | 514 | Open in IMG/M |
3300005165|Ga0066869_10090202 | Not Available | 600 | Open in IMG/M |
3300005171|Ga0066677_10249749 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1007 | Open in IMG/M |
3300005331|Ga0070670_100042876 | Not Available | 3891 | Open in IMG/M |
3300005454|Ga0066687_10274854 | Not Available | 947 | Open in IMG/M |
3300005459|Ga0068867_100443305 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1104 | Open in IMG/M |
3300005537|Ga0070730_10212937 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1285 | Open in IMG/M |
3300005537|Ga0070730_10694746 | Not Available | 645 | Open in IMG/M |
3300005541|Ga0070733_10131621 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1614 | Open in IMG/M |
3300005556|Ga0066707_10149798 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1478 | Open in IMG/M |
3300005576|Ga0066708_10540736 | Not Available | 750 | Open in IMG/M |
3300005591|Ga0070761_10696791 | Not Available | 636 | Open in IMG/M |
3300005841|Ga0068863_101892290 | Not Available | 606 | Open in IMG/M |
3300005950|Ga0066787_10059130 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 752 | Open in IMG/M |
3300006028|Ga0070717_10941726 | Not Available | 786 | Open in IMG/M |
3300006031|Ga0066651_10340042 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 806 | Open in IMG/M |
3300006358|Ga0068871_100081524 | Not Available | 2681 | Open in IMG/M |
3300006423|Ga0075039_1075985 | Not Available | 804 | Open in IMG/M |
3300006423|Ga0075039_1083462 | Not Available | 770 | Open in IMG/M |
3300006423|Ga0075039_1111502 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1236 | Open in IMG/M |
3300006423|Ga0075039_1116901 | Not Available | 1236 | Open in IMG/M |
3300006426|Ga0075037_1056569 | All Organisms → cellular organisms → Eukaryota | 1089 | Open in IMG/M |
3300006426|Ga0075037_1169110 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 764 | Open in IMG/M |
3300006893|Ga0073928_10002069 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 36046 | Open in IMG/M |
3300006893|Ga0073928_10518023 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 853 | Open in IMG/M |
3300007327|Ga0075016_1447099 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1070 | Open in IMG/M |
3300009500|Ga0116229_10028490 | Not Available | 6415 | Open in IMG/M |
3300009500|Ga0116229_10031445 | Not Available | 5924 | Open in IMG/M |
3300009500|Ga0116229_10046249 | Not Available | 4425 | Open in IMG/M |
3300009624|Ga0116105_1158545 | Not Available | 604 | Open in IMG/M |
3300009633|Ga0116129_1041153 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1473 | Open in IMG/M |
3300009633|Ga0116129_1056397 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1202 | Open in IMG/M |
3300009695|Ga0123337_10346657 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 730 | Open in IMG/M |
3300009709|Ga0116227_10536542 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 888 | Open in IMG/M |
3300009828|Ga0130087_1016538 | Not Available | 504 | Open in IMG/M |
3300009828|Ga0130087_1032451 | Not Available | 630 | Open in IMG/M |
3300010164|Ga0063827_128956 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 1526 | Open in IMG/M |
3300010343|Ga0074044_10686601 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 668 | Open in IMG/M |
3300010364|Ga0134066_10305046 | Not Available | 573 | Open in IMG/M |
3300010860|Ga0126351_1050824 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
3300011026|Ga0138566_122331 | Not Available | 654 | Open in IMG/M |
3300011074|Ga0138559_1062631 | Not Available | 697 | Open in IMG/M |
3300011120|Ga0150983_10237938 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 752 | Open in IMG/M |
3300011120|Ga0150983_11856405 | Not Available | 588 | Open in IMG/M |
3300011120|Ga0150983_12544556 | Not Available | 552 | Open in IMG/M |
3300011120|Ga0150983_12596907 | All Organisms → cellular organisms → Eukaryota | 1344 | Open in IMG/M |
3300011120|Ga0150983_13611864 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1186 | Open in IMG/M |
3300011120|Ga0150983_14225433 | Not Available | 557 | Open in IMG/M |
3300011120|Ga0150983_16082477 | Not Available | 590 | Open in IMG/M |
3300012161|Ga0137336_1078887 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 612 | Open in IMG/M |
3300012207|Ga0137381_11528922 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 559 | Open in IMG/M |
3300012212|Ga0150985_108581428 | Not Available | 545 | Open in IMG/M |
3300012371|Ga0134022_1154913 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
3300012924|Ga0137413_10297603 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1126 | Open in IMG/M |
3300013105|Ga0157369_12299708 | Not Available | 546 | Open in IMG/M |
3300014169|Ga0181531_10338616 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 922 | Open in IMG/M |
3300014495|Ga0182015_10033940 | Not Available | 3898 | Open in IMG/M |
3300014495|Ga0182015_10907572 | Not Available | 552 | Open in IMG/M |
3300014498|Ga0182019_10026316 | Not Available | 3229 | Open in IMG/M |
3300014501|Ga0182024_12659098 | Not Available | 536 | Open in IMG/M |
3300015076|Ga0167656_1000110 | Not Available | 9498 | Open in IMG/M |
3300016700|Ga0181513_1294793 | Not Available | 613 | Open in IMG/M |
3300016700|Ga0181513_1295592 | Not Available | 742 | Open in IMG/M |
3300017935|Ga0187848_10170681 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 948 | Open in IMG/M |
3300017946|Ga0187879_10397664 | Not Available | 763 | Open in IMG/M |
3300017948|Ga0187847_10323904 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 843 | Open in IMG/M |
3300018025|Ga0187885_10014571 | Not Available | 4803 | Open in IMG/M |
3300018414|Ga0194135_10972353 | Not Available | 539 | Open in IMG/M |
3300019162|Ga0184597_112331 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300019176|Ga0184596_123904 | Not Available | 592 | Open in IMG/M |
3300019192|Ga0184603_125639 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 735 | Open in IMG/M |
3300020382|Ga0211686_10369332 | Not Available | 583 | Open in IMG/M |
3300021170|Ga0210400_10142064 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1929 | Open in IMG/M |
3300021420|Ga0210394_10442005 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1144 | Open in IMG/M |
3300021479|Ga0210410_10632276 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 949 | Open in IMG/M |
3300022154|Ga0213929_1012158 | Not Available | 774 | Open in IMG/M |
3300022156|Ga0213934_1007487 | Not Available | 1375 | Open in IMG/M |
3300022501|Ga0242645_1008102 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 794 | Open in IMG/M |
3300022504|Ga0242642_1008592 | All Organisms → Viruses → Predicted Viral | 1220 | Open in IMG/M |
3300022533|Ga0242662_10042003 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
3300022557|Ga0212123_10002065 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 50549 | Open in IMG/M |
3300023063|Ga0233335_1078390 | Not Available | 584 | Open in IMG/M |
3300023074|Ga0247737_1064681 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
3300023562|Ga0247516_108348 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1131 | Open in IMG/M |
3300023563|Ga0247530_105028 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
3300023564|Ga0247515_111493 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 917 | Open in IMG/M |
3300024330|Ga0137417_1351333 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1958 | Open in IMG/M |
3300025404|Ga0208936_1006107 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1437 | Open in IMG/M |
3300025454|Ga0208039_1082372 | Not Available | 563 | Open in IMG/M |
3300026214|Ga0209838_1035901 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 713 | Open in IMG/M |
3300026322|Ga0209687_1113550 | Not Available | 875 | Open in IMG/M |
3300026542|Ga0209805_1274822 | Not Available | 646 | Open in IMG/M |
3300027058|Ga0209111_1044301 | Not Available | 571 | Open in IMG/M |
3300027303|Ga0208999_1000554 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 2813 | Open in IMG/M |
3300027303|Ga0208999_1010778 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1154 | Open in IMG/M |
3300027307|Ga0209327_1046210 | Not Available | 626 | Open in IMG/M |
3300027439|Ga0209332_1010255 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1882 | Open in IMG/M |
3300027496|Ga0208987_1055676 | Not Available | 712 | Open in IMG/M |
3300027524|Ga0208998_1042039 | Not Available | 739 | Open in IMG/M |
3300027574|Ga0208982_1096384 | Not Available | 601 | Open in IMG/M |
3300027587|Ga0209220_1000686 | Not Available | 10444 | Open in IMG/M |
3300027609|Ga0209221_1020336 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1756 | Open in IMG/M |
3300027651|Ga0209217_1211075 | Not Available | 518 | Open in IMG/M |
3300027663|Ga0208990_1107990 | Not Available | 766 | Open in IMG/M |
3300027698|Ga0209446_1006882 | Not Available | 2780 | Open in IMG/M |
3300027698|Ga0209446_1055859 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1000 | Open in IMG/M |
3300027701|Ga0209447_10000572 | Not Available | 10317 | Open in IMG/M |
3300027738|Ga0208989_10113845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 919 | Open in IMG/M |
3300027768|Ga0209772_10071644 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1046 | Open in IMG/M |
3300027867|Ga0209167_10108198 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1428 | Open in IMG/M |
3300028082|Ga0255352_1016672 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1423 | Open in IMG/M |
3300028536|Ga0137415_10843286 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 726 | Open in IMG/M |
3300028645|Ga0302158_1029823 | Not Available | 826 | Open in IMG/M |
3300028759|Ga0302224_10090210 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1173 | Open in IMG/M |
3300028769|Ga0302213_1030346 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1667 | Open in IMG/M |
3300028780|Ga0302225_10003686 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Mollisiaceae → Phialocephala | 8801 | Open in IMG/M |
3300028795|Ga0302227_10250262 | Not Available | 677 | Open in IMG/M |
3300029923|Ga0311347_10762675 | Not Available | 588 | Open in IMG/M |
3300029944|Ga0311352_10000420 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 53023 | Open in IMG/M |
3300030019|Ga0311348_10040006 | Not Available | 3442 | Open in IMG/M |
3300030053|Ga0302177_10029621 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Mollisiaceae → Phialocephala | 3435 | Open in IMG/M |
3300030114|Ga0311333_10025549 | Not Available | 4084 | Open in IMG/M |
3300030589|Ga0210255_10631821 | Not Available | 747 | Open in IMG/M |
3300030743|Ga0265461_10138233 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1320 | Open in IMG/M |
3300030799|Ga0074010_10085155 | Not Available | 751 | Open in IMG/M |
3300030846|Ga0075403_11557832 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 942 | Open in IMG/M |
3300030849|Ga0075393_10012968 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 807 | Open in IMG/M |
3300030887|Ga0265733_102946 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 611 | Open in IMG/M |
3300030891|Ga0315865_122387 | Not Available | 503 | Open in IMG/M |
3300030908|Ga0074005_10180781 | Not Available | 791 | Open in IMG/M |
3300030920|Ga0102762_1034464 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1241 | Open in IMG/M |
3300030920|Ga0102762_1036796 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 1356 | Open in IMG/M |
3300030931|Ga0074006_10067767 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1337 | Open in IMG/M |
3300030935|Ga0075401_10071214 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1059 | Open in IMG/M |
3300030937|Ga0138302_1782093 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 528 | Open in IMG/M |
3300031065|Ga0315807_110936 | Not Available | 630 | Open in IMG/M |
3300031232|Ga0302323_100564158 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 1229 | Open in IMG/M |
3300031240|Ga0265320_10237622 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 809 | Open in IMG/M |
3300031521|Ga0311364_11364857 | Not Available | 702 | Open in IMG/M |
3300031708|Ga0310686_103214036 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata | 761 | Open in IMG/M |
3300031708|Ga0310686_113173605 | Not Available | 515 | Open in IMG/M |
3300031809|Ga0316048_109634 | Not Available | 516 | Open in IMG/M |
3300032121|Ga0316040_101782 | All Organisms → Viruses → Predicted Viral | 1156 | Open in IMG/M |
3300032515|Ga0348332_12574167 | Not Available | 653 | Open in IMG/M |
3300032515|Ga0348332_13916498 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Rhipicephalinae → Rhipicephalus → Boophilus → Rhipicephalus microplus | 2135 | Open in IMG/M |
3300032896|Ga0335075_11675480 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 17.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.71% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.71% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.27% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.66% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 3.66% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.05% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.05% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.44% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.44% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.44% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.44% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.83% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.83% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.83% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.22% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.22% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.22% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.22% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.61% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.61% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.61% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.61% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.61% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.61% |
Leaf Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter | 0.61% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 0.61% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.61% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000904 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 | Environmental | Open in IMG/M |
3300001078 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002667 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF141 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300002681 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300003674 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300004133 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004401 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004482 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 24 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004606 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004608 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004619 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004634 | High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-1D-10D | Engineered | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006423 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009695 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG | Environmental | Open in IMG/M |
3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Host-Associated | Open in IMG/M |
3300010164 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011026 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 51 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011074 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015076 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6a, vegetation/snow interface) | Environmental | Open in IMG/M |
3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018414 | Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013 | Environmental | Open in IMG/M |
3300019162 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019176 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022156 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023063 | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-222 | Environmental | Open in IMG/M |
3300023074 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L028-104C-2 | Environmental | Open in IMG/M |
3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023563 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023564 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027303 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027524 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028082 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T0 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028645 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_1 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028769 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030589 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030799 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030846 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030849 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030887 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030891 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T26 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030908 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030920 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030931 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031065 | Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031809 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J12875_1026811 | 3300000904 | Forest Soil | MXVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS* |
JGI12640J13246_1001071 | 3300001078 | Forest Soil | MSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQC* |
JGI12053J15887_100045211 | 3300001661 | Forest Soil | IDHIGSEKTPIRIVQQWGILVNSLTAEPATWGKA* |
JGI12053J15887_100828605 | 3300001661 | Forest Soil | SIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV* |
JGI12627J18819_100902631 | 3300001867 | Forest Soil | RSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV* |
Ga0005492J37276_1054041 | 3300002667 | Forest Soil | VAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0005471J37259_1106161 | 3300002681 | Forest Soil | MYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY* |
Ga0006876_1037521 | 3300003674 | Peatlands Soil | EAERSIDHIGSEKNPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0058892_13237241 | 3300004133 | Forest Soil | VEAERLIDHIGSEKTPRQISTAVGILVNGLTAELATSENEDHNGTLN* |
Ga0058897_111944672 | 3300004139 | Forest Soil | MYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQY* |
Ga0068980_10039832 | 3300004401 | Peatlands Soil | SVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNAQLL* |
Ga0068936_10575812 | 3300004482 | Peatlands Soil | SVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0068962_10252771 | 3300004606 | Peatlands Soil | KFVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWENE* |
Ga0068924_10229743 | 3300004608 | Peatlands Soil | VVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0068953_10245781 | 3300004619 | Peatlands Soil | SVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNE* |
Ga0066906_109650131 | 3300004634 | Ionic Liquid And High Solid Enriched | ERFIDHIGSEKTPICTVQQWGILVNGLTAEPAIWRNVIV* |
Ga0058860_113891981 | 3300004801 | Host-Associated | VAERSIDHNGSEKTPTSNGQQWGILVNDLTVEPATRMNYGLEAT* |
Ga0072325_10408301 | 3300004972 | Peatlands Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0072325_10506371 | 3300004972 | Peatlands Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWRNV* |
Ga0066869_100902022 | 3300005165 | Soil | VEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0066677_102497493 | 3300005171 | Soil | VVETERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV* |
Ga0070670_1000428765 | 3300005331 | Switchgrass Rhizosphere | VAERSIDHIGSEKSPIRKVQQWGILVNSLTAEPATWRNE* |
Ga0066687_102748541 | 3300005454 | Soil | MIKLYQIYIYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY* |
Ga0068867_1004433051 | 3300005459 | Miscanthus Rhizosphere | NSVVEAERSIDHIGSEKTPIRFVQQWGILVNGLTAEPATWGNV* |
Ga0070730_102129371 | 3300005537 | Surface Soil | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV* |
Ga0070730_106947461 | 3300005537 | Surface Soil | MYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLRTEPA |
Ga0070733_101316211 | 3300005541 | Surface Soil | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0066707_101497981 | 3300005556 | Soil | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV* |
Ga0066708_105407362 | 3300005576 | Soil | IDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV* |
Ga0070761_106967911 | 3300005591 | Soil | ERLIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV* |
Ga0068863_1018922901 | 3300005841 | Switchgrass Rhizosphere | AERSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWGNV* |
Ga0066787_100591301 | 3300005950 | Soil | TERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV* |
Ga0070717_109417262 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV* |
Ga0066651_103400421 | 3300006031 | Soil | IDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0068871_1000815241 | 3300006358 | Miscanthus Rhizosphere | RSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV* |
Ga0075039_10759852 | 3300006423 | Permafrost Soil | RSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0075039_10834621 | 3300006423 | Permafrost Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENE* |
Ga0075039_11115021 | 3300006423 | Permafrost Soil | NSVIEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNV* |
Ga0075039_11169011 | 3300006423 | Permafrost Soil | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNE* |
Ga0075037_10565691 | 3300006426 | Permafrost Soil | PIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV* |
Ga0075037_11691101 | 3300006426 | Permafrost Soil | LAHVPAVETERSIDHIGSEKSPRQIVQQWGILVNSLMAEPATWKNV* |
Ga0073928_1000206932 | 3300006893 | Iron-Sulfur Acid Spring | MSYLAKPVIKAERSIDHIGSEKTPIRLVQQWGILVNGLTAEPAT*GNV* |
Ga0073928_105180231 | 3300006893 | Iron-Sulfur Acid Spring | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0075016_14470991 | 3300007327 | Watersheds | SVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA* |
Ga0116229_100284901 | 3300009500 | Host-Associated | VVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNV* |
Ga0116229_100314451 | 3300009500 | Host-Associated | VVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE* |
Ga0116229_100462491 | 3300009500 | Host-Associated | VVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNE* |
Ga0116105_11585451 | 3300009624 | Peatland | EAERSIDHIGSEKTPIRIVLQWGILVNSRQAEPAT* |
Ga0116129_10411531 | 3300009633 | Peatland | VVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA* |
Ga0116129_10563971 | 3300009633 | Peatland | NSVVEAERSIDHIGSEKTPIRVVQQWGILVNGLTAEPATWRNV* |
Ga0123337_103466571 | 3300009695 | Glacier Valley | AVATERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV* |
Ga0116227_105365421 | 3300009709 | Host-Associated | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWRNV* |
Ga0130087_10165381 | 3300009828 | Host-Associated | VEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV* |
Ga0130087_10324511 | 3300009828 | Host-Associated | EAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV* |
Ga0063827_1289561 | 3300010164 | Peatlands Soil | IDHIGSEKNPIRIVQQWGILVNSLTAEPATWGNV* |
Ga0074044_106866011 | 3300010343 | Bog Forest Soil | IDHIGSEKTPIRIVQQ*GILVNGLTAEPVT*KNV* |
Ga0134066_103050461 | 3300010364 | Grasslands Soil | YIYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY* |
Ga0126351_10508242 | 3300010860 | Boreal Forest Soil | SVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY* |
Ga0138566_1223311 | 3300011026 | Peatlands Soil | SIDHIGSEKNPIRIVQQWGILVYSLTAEPATWGNV* |
Ga0138559_10626311 | 3300011074 | Peatlands Soil | IGSEKTPIRLVQQWGILVISLTAEPATWGNAQLL* |
Ga0150983_102379381 | 3300011120 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWRNV* |
Ga0150983_118564051 | 3300011120 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE* |
Ga0150983_125445561 | 3300011120 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNEQPSN* |
Ga0150983_125969071 | 3300011120 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWENE* |
Ga0150983_136118641 | 3300011120 | Forest Soil | SIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWENV* |
Ga0150983_142254331 | 3300011120 | Forest Soil | IDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV* |
Ga0150983_160824771 | 3300011120 | Forest Soil | AERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNY* |
Ga0137336_10788871 | 3300012161 | Soil | SLGEDERSNEYNGSEKTPISIVQQWGILVNSLTAEPATWKN* |
Ga0137381_115289223 | 3300012207 | Vadose Zone Soil | HIGAEKIPIQYDVQQWGILVNGLRAELATWRNGLFN* |
Ga0150985_1085814281 | 3300012212 | Avena Fatua Rhizosphere | EAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV* |
Ga0134022_11549132 | 3300012371 | Grasslands Soil | MIKLYQIYIYISEIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY* |
Ga0137413_102976031 | 3300012924 | Vadose Zone Soil | DVSEVVTERLIDHTGPEKIPERTVQQWGILVNSRKAEPATWKNE* |
Ga0157369_122997081 | 3300013105 | Corn Rhizosphere | RSIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV* |
Ga0181531_103386161 | 3300014169 | Bog | RSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE* |
Ga0182015_100339401 | 3300014495 | Palsa | SVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNE* |
Ga0182015_109075721 | 3300014495 | Palsa | MPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSL |
Ga0182019_100263161 | 3300014498 | Fen | ERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNAQLLKCGWLPFF* |
Ga0182024_126590981 | 3300014501 | Permafrost | AERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA* |
Ga0167656_100011017 | 3300015076 | Glacier Forefield Soil | MAQLAKNSVIGAERSTDHIGSEKTPIRLVQQ*GILVNSLTAEPVT* |
Ga0181513_12947931 | 3300016700 | Peatland | VVEAERSIDHIGSDKTPIRIVQQWGILVNSLTSEPATWGNG |
Ga0181513_12955921 | 3300016700 | Peatland | VVEAERSIDHIGSDKTPIRIVQQWGILVNSLTAERATWGNV |
Ga0187848_101706811 | 3300017935 | Peatland | SVIETERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNG |
Ga0187879_103976641 | 3300017946 | Peatland | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNV |
Ga0187847_103239041 | 3300017948 | Peatland | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0187885_100145711 | 3300018025 | Peatland | VVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA |
Ga0194135_109723531 | 3300018414 | Watersheds | SVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0184597_1123311 | 3300019162 | Soil | EIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC |
Ga0184596_1239041 | 3300019176 | Soil | MYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC |
Ga0184603_1256391 | 3300019192 | Soil | MPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKM |
Ga0211686_103693321 | 3300020382 | Marine | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0210400_101420641 | 3300021170 | Soil | MSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC |
Ga0210394_104420051 | 3300021420 | Soil | AVETERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV |
Ga0210410_106322761 | 3300021479 | Soil | VIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQY |
Ga0213929_10121581 | 3300022154 | Freshwater | SIDHIGSEKTPIRLVQQWGILVNSLTAEPAIWVNV |
Ga0213934_10074871 | 3300022156 | Freshwater | LAHISVVETERLIDHIGSEKTPIRLVQQWGILVNSLTSEPAIWVNV |
Ga0242645_10081021 | 3300022501 | Soil | YMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC |
Ga0242642_10085921 | 3300022504 | Soil | TERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0242662_100420031 | 3300022533 | Soil | SVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0212123_1000206518 | 3300022557 | Iron-Sulfur Acid Spring | MSYLAKPVIKAERSIDHIGSEKTPIRLVQQWGILVNGLTAEPATXGNV |
Ga0233335_10783901 | 3300023063 | Leaf Litter | AERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNE |
Ga0247737_10646811 | 3300023074 | Plant Litter | QKPVVETERLIDHIGSEKTPIRIVQQWGILVNSLTAEPATWMNV |
Ga0247516_1083481 | 3300023562 | Soil | MYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS |
Ga0247530_1050281 | 3300023563 | Soil | IYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0247515_1114931 | 3300023564 | Soil | MYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0137417_13513332 | 3300024330 | Vadose Zone Soil | ATERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV |
Ga0208936_10061071 | 3300025404 | Peatland | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA |
Ga0208039_10823721 | 3300025454 | Peatland | AERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA |
Ga0209838_10359011 | 3300026214 | Soil | HVPAVETERSIDHIGSEKSPRQIVQQWGILVNSLMAEPATWKNV |
Ga0209687_11135501 | 3300026322 | Soil | MIKLYQIYIYISVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0209805_12748221 | 3300026542 | Soil | SIDHIGSEKTPIRIVQQWGILVNSLTAEPATWENV |
Ga0209111_10443011 | 3300027058 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNV |
Ga0208999_10005544 | 3300027303 | Forest Soil | VVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGKA |
Ga0208999_10107781 | 3300027303 | Forest Soil | VATERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV |
Ga0209327_10462101 | 3300027307 | Forest Soil | SIDHTGPEKIPGRIVQQWGILVNSRKAEPATWKNV |
Ga0209332_10102551 | 3300027439 | Forest Soil | ADYSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0208987_10556761 | 3300027496 | Forest Soil | VVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWRNV |
Ga0208998_10420391 | 3300027524 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWRNV |
Ga0208982_10963841 | 3300027574 | Forest Soil | ERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNVQPNLFG |
Ga0209220_10006864 | 3300027587 | Forest Soil | MAQLAKNSVVEAERSIDHIGSEKTPIRIVQQXGILVNSLPAEPVTXKNV |
Ga0209221_10203361 | 3300027609 | Forest Soil | MPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS |
Ga0209217_12110751 | 3300027651 | Forest Soil | VVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0208990_11079901 | 3300027663 | Forest Soil | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0209446_10068821 | 3300027698 | Bog Forest Soil | RSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNE |
Ga0209446_10558592 | 3300027698 | Bog Forest Soil | RSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV |
Ga0209447_100005721 | 3300027701 | Bog Forest Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWKNE |
Ga0208989_101138451 | 3300027738 | Forest Soil | AERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0209772_100716441 | 3300027768 | Bog Forest Soil | ERLIDHIGYEKNPRQIVQQWGILVNGLKAEPAIWKIK |
Ga0209167_101081981 | 3300027867 | Surface Soil | VVVAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0255352_10166721 | 3300028082 | Soil | VEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNG |
Ga0137415_108432861 | 3300028536 | Vadose Zone Soil | EAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAT |
Ga0302158_10298231 | 3300028645 | Fen | VEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNV |
Ga0302224_100902101 | 3300028759 | Palsa | VPAVETERSIDHIGSEKSPRQIVQQWGILVNSLTAEPATWKNV |
Ga0302213_10303461 | 3300028769 | Fen | AERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATRGNE |
Ga0302225_100036861 | 3300028780 | Palsa | VEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0302227_102502621 | 3300028795 | Palsa | YSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0311347_107626751 | 3300029923 | Fen | NSVVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNA |
Ga0311352_1000042071 | 3300029944 | Palsa | ERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE |
Ga0311348_100400061 | 3300030019 | Fen | VVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPATWGNV |
Ga0302177_100296215 | 3300030053 | Palsa | RSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNV |
Ga0311333_100255491 | 3300030114 | Fen | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE |
Ga0210255_106318211 | 3300030589 | Soil | MYIYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPA |
Ga0265461_101382331 | 3300030743 | Soil | MPMTVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC |
Ga0074010_100851551 | 3300030799 | Soil | EAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNGSIAFKVRV |
Ga0075403_115578321 | 3300030846 | Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNA |
Ga0075393_100129681 | 3300030849 | Soil | IPVVVTERSTDHIGPEKSPRQSAQQWGILVNGLTAEPAIWRNV |
Ga0265733_1029461 | 3300030887 | Soil | TERYIDHTGSEKTPVRIVQQXGILVNGLTAEPATWKNES |
Ga0315865_1223871 | 3300030891 | Plant Litter | MSVVKTERSIDHTGSEKTPVRVVQQXGILVNGLTAEP |
Ga0074005_101807811 | 3300030908 | Soil | AERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWGNV |
Ga0102762_10344641 | 3300030920 | Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWRNV |
Ga0102762_10367961 | 3300030920 | Soil | NSVVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPATWENV |
Ga0074006_100677671 | 3300030931 | Soil | VVEAERSIDHIGSEKTPIRIVQQWGILVNGLTAEPAIWGNV |
Ga0075401_100712142 | 3300030935 | Soil | VVEAERSIDHIGSEKTPIRLVQQWGILVNSLTAEPAT |
Ga0138302_17820931 | 3300030937 | Soil | VIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0315807_1109361 | 3300031065 | Plant Litter | ISLVENERSIEHTGSEKTQESILQHLGILVNGLTAETATWRNES |
Ga0302323_1005641581 | 3300031232 | Fen | AERSIDHIGSEKTPIRIVQQWGILVNSLTAEPATWGNE |
Ga0265320_102376221 | 3300031240 | Rhizosphere | YIEICMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKTQY |
Ga0311364_113648571 | 3300031521 | Fen | EAERSIDHIGSEKTPIRIVQQWGILVNSLPAEPATWGNE |
Ga0310686_1032140361 | 3300031708 | Soil | RSIDHIGSEKTPIRIVQQWGILVNSLTAEPAIWENV |
Ga0310686_1131736051 | 3300031708 | Soil | MSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAI |
Ga0316048_1096341 | 3300031809 | Soil | RSYAYYMPMTVIVTERYTGHIGSDKTPIRTVPPCGILVNSLTTEPAIWKMQC |
Ga0316040_1017821 | 3300032121 | Soil | IYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKMQC |
Ga0348332_125741671 | 3300032515 | Plant Litter | MSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIW |
Ga0348332_139164981 | 3300032515 | Plant Litter | VIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKKQYLFS |
Ga0335075_116754801 | 3300032896 | Soil | MKKLYRIIYYMSVIVTERFIGHIGSEKTPIRIVQQCGILVNSLTTEPAIWKT |
⦗Top⦘ |