Metagenome / Metatranscriptome Family F039183

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F039183
Family Type	Metagenome / Metatranscriptome
Number of Sequences	164
Average Sequence Length	38 residues
Representative Sequence	MKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG
Number of Associated Samples	110
Number of Associated Scaffolds	164

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	68.55 %
% of genes near scaffold ends (potentially truncated)	34.76 %
% of genes from short scaffolds (< 2000 bps)	82.32 %
Associated GOLD sequencing projects	101
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (50.000 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.415 % of family members)
Environment Ontology (ENVO)	Unclassified (25.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (54.268 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 164 Family Scaffolds
PF03734	YkuD	4.27
PF00106	adh_short	3.66
PF00990	GGDEF	3.05
PF03401	TctC	1.22
PF07729	FCD	1.22
PF04392	ABC_sub_bind	1.22
PF00149	Metallophos	1.22
PF13472	Lipase_GDSL_2	1.22
PF16576	HlyD_D23	1.22
PF12787	EcsC	1.22
PF02735	Ku	1.22
PF08241	Methyltransf_11	1.22
PF00198	2-oxoacid_dh	1.22
PF13458	Peripla_BP_6	0.61
PF11752	DUF3309	0.61
PF12071	DUF3551	0.61
PF13561	adh_short_C2	0.61
PF08546	ApbA_C	0.61
PF00383	dCMP_cyt_deam_1	0.61
PF09084	NMT1	0.61
PF01494	FAD_binding_3	0.61
PF03237	Terminase_6N	0.61
PF07750	GcrA	0.61
PF06032	DUF917	0.61
PF01323	DSBA	0.61
PF02798	GST_N	0.61
PF04140	ICMT	0.61
PF02776	TPP_enzyme_N	0.61
PF03989	DNA_gyraseA_C	0.61
PF01176	eIF-1a	0.61
PF01872	RibD_C	0.61
PF02687	FtsX	0.61
PF10397	ADSL_C	0.61
PF13437	HlyD_3	0.61
PF01068	DNA_ligase_A_M	0.61
PF01425	Amidase	0.61

COG ID	Name	Functional Category	% Frequency in 164 Family Scaffolds
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	4.27
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	4.27
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	1.22
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	1.22
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	1.22
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	1.22
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	1.22
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.22
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.22
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.61
COG0188	DNA gyrase/topoisomerase IV, subunit A	Replication, recombination and repair [L]	0.61
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.61
COG0361	Translation initiation factor IF-1	Translation, ribosomal structure and biogenesis [J]	0.61
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.61
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.61
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.61
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.61
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.61
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.61
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	0.61
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.61
COG3535	Uncharacterized conserved protein, DUF917 family	Function unknown [S]	0.61
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.61
COG5352	Uncharacterized conserved protein	Function unknown [S]	0.61

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	50.00 %
Unclassified	root	N/A	50.00 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	40.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	33.54 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.61 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	21.95 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	7.32 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.61 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	7.93 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	7.32 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	1.22 %
Desulfovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales	0.61 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.61 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	7.32 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	4.27 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.44 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.61 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.61 %
Oricola	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola	0.61 %
Desulfovibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae	0.61 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	7.32 %
Afipia birgiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	3.66 %
Oricola indica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola → Oricola indica	0.61 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.61 %
Mesorhizobium albiziae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae	0.61 %
Afipia broomeae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae	0.61 %
Fundidesulfovibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Fundidesulfovibrio	0.61 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.61 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.61 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.00 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	7.32 %
Afipia birgiae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	3.66 %
Fundidesulfovibrio magnetotacticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Fundidesulfovibrio → Fundidesulfovibrio magnetotacticus	0.61 %
Bradyrhizobium sp. WD16	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WD16	0.61 %
Oricola indica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola → Oricola indica	0.61 %
Mesorhizobium albiziae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae	0.61 %
Afipia broomeae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae	0.61 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.61 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.61 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2070309004\|prs_FIHLEPW02SOX2J	Not Available	515	Open in IMG/M
2228664022\|INPgaii200_c0426330	Not Available	569	Open in IMG/M
3300000955\|JGI1027J12803_101369845	Not Available	612	Open in IMG/M
3300000955\|JGI1027J12803_105852333	Not Available	1150	Open in IMG/M
3300001081\|JGI12662J13196_1003509	Not Available	1200	Open in IMG/M
3300002245\|JGIcombinedJ26739_100012289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7040	Open in IMG/M
3300002245\|JGIcombinedJ26739_101636962	Not Available	542	Open in IMG/M
3300004114\|Ga0062593_100639422	All Organisms → cellular organisms → Bacteria → Proteobacteria	1024	Open in IMG/M
3300004156\|Ga0062589_100866362	Not Available	827	Open in IMG/M
3300004479\|Ga0062595_101807458	Not Available	581	Open in IMG/M
3300005093\|Ga0062594_100447319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1068	Open in IMG/M
3300005332\|Ga0066388_103015802	All Organisms → cellular organisms → Bacteria	860	Open in IMG/M
3300005332\|Ga0066388_103806488	Not Available	770	Open in IMG/M
3300005529\|Ga0070741_11654303	Not Available	522	Open in IMG/M
3300005562\|Ga0058697_10606899	Not Available	572	Open in IMG/M
3300005564\|Ga0070664_102232833	Not Available	519	Open in IMG/M
3300005575\|Ga0066702_10906872	Not Available	526	Open in IMG/M
3300005587\|Ga0066654_10244788	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	944	Open in IMG/M
3300005764\|Ga0066903_100099224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3924	Open in IMG/M
3300005764\|Ga0066903_100159990	All Organisms → cellular organisms → Bacteria → Proteobacteria	3262	Open in IMG/M
3300005764\|Ga0066903_100272779	All Organisms → cellular organisms → Bacteria	2641	Open in IMG/M
3300005764\|Ga0066903_100356693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	2369	Open in IMG/M
3300005764\|Ga0066903_100385009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2295	Open in IMG/M
3300005764\|Ga0066903_100391086	All Organisms → cellular organisms → Bacteria	2280	Open in IMG/M
3300005764\|Ga0066903_100571633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1947	Open in IMG/M
3300005764\|Ga0066903_100677007	All Organisms → cellular organisms → Bacteria → Proteobacteria	1811	Open in IMG/M
3300005764\|Ga0066903_101092010	All Organisms → cellular organisms → Bacteria	1470	Open in IMG/M
3300005764\|Ga0066903_101267821	All Organisms → cellular organisms → Bacteria → Proteobacteria	1374	Open in IMG/M
3300005764\|Ga0066903_101611496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1231	Open in IMG/M
3300005764\|Ga0066903_101718690	Not Available	1195	Open in IMG/M
3300005764\|Ga0066903_101762116	Not Available	1181	Open in IMG/M
3300005764\|Ga0066903_103700159	Not Available	823	Open in IMG/M
3300005764\|Ga0066903_104287435	Not Available	762	Open in IMG/M
3300005764\|Ga0066903_105615836	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005764\|Ga0066903_108997610	Not Available	506	Open in IMG/M
3300006028\|Ga0070717_10355182	All Organisms → cellular organisms → Bacteria → Proteobacteria	1311	Open in IMG/M
3300006046\|Ga0066652_100007672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	6624	Open in IMG/M
3300006046\|Ga0066652_100215159	All Organisms → cellular organisms → Bacteria → Proteobacteria	1662	Open in IMG/M
3300006237\|Ga0097621_102244867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium albiziae	522	Open in IMG/M
3300006572\|Ga0074051_10526790	Not Available	516	Open in IMG/M
3300006791\|Ga0066653_10122628	All Organisms → cellular organisms → Bacteria	1222	Open in IMG/M
3300006800\|Ga0066660_11327686	Not Available	563	Open in IMG/M
3300006852\|Ga0075433_11702626	Not Available	543	Open in IMG/M
3300006871\|Ga0075434_100579657	All Organisms → cellular organisms → Bacteria	1141	Open in IMG/M
3300006893\|Ga0073928_10000307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	117262	Open in IMG/M
3300007258\|Ga0099793_10440835	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300009038\|Ga0099829_10830841	All Organisms → cellular organisms → Bacteria → Proteobacteria	767	Open in IMG/M
3300009038\|Ga0099829_11198618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	629	Open in IMG/M
3300009038\|Ga0099829_11588160	Not Available	540	Open in IMG/M
3300009088\|Ga0099830_10541504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	952	Open in IMG/M
3300009088\|Ga0099830_10585253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	915	Open in IMG/M
3300009088\|Ga0099830_11865213	Not Available	502	Open in IMG/M
3300009089\|Ga0099828_10430543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1190	Open in IMG/M
3300009089\|Ga0099828_10930414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	776	Open in IMG/M
3300009098\|Ga0105245_13153589	Not Available	511	Open in IMG/M
3300009100\|Ga0075418_11577577	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300009553\|Ga0105249_12979389	Not Available	544	Open in IMG/M
3300009792\|Ga0126374_11180516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	612	Open in IMG/M
3300010047\|Ga0126382_10565442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	928	Open in IMG/M
3300010146\|Ga0126320_1382452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1058	Open in IMG/M
3300010147\|Ga0126319_1617607	Not Available	1082	Open in IMG/M
3300010339\|Ga0074046_10433870	Not Available	790	Open in IMG/M
3300010339\|Ga0074046_10687336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WD16	602	Open in IMG/M
3300010358\|Ga0126370_10949311	Not Available	781	Open in IMG/M
3300010366\|Ga0126379_12225497	Not Available	649	Open in IMG/M
3300010400\|Ga0134122_12339905	Not Available	580	Open in IMG/M
3300010868\|Ga0124844_1214860	Not Available	697	Open in IMG/M
3300010868\|Ga0124844_1237469	Not Available	647	Open in IMG/M
3300011270\|Ga0137391_11301304	Not Available	574	Open in IMG/M
3300012096\|Ga0137389_10797334	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300012189\|Ga0137388_10775807	Not Available	889	Open in IMG/M
3300012189\|Ga0137388_11007910	Not Available	768	Open in IMG/M
3300012202\|Ga0137363_11352185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	601	Open in IMG/M
3300012212\|Ga0150985_103446473	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300012212\|Ga0150985_106179278	Not Available	883	Open in IMG/M
3300012212\|Ga0150985_106523321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1532	Open in IMG/M
3300012212\|Ga0150985_108496504	Not Available	661	Open in IMG/M
3300012212\|Ga0150985_111815692	Not Available	673	Open in IMG/M
3300012212\|Ga0150985_113777932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2888	Open in IMG/M
3300012363\|Ga0137390_10219086	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1890	Open in IMG/M
3300012469\|Ga0150984_112011313	Not Available	594	Open in IMG/M
3300012469\|Ga0150984_112297072	Not Available	542	Open in IMG/M
3300012469\|Ga0150984_112452368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2180	Open in IMG/M
3300012469\|Ga0150984_116080149	Not Available	2346	Open in IMG/M
3300012915\|Ga0157302_10215938	Not Available	698	Open in IMG/M
3300012971\|Ga0126369_12885569	Not Available	563	Open in IMG/M
3300015077\|Ga0173483_11000359	Not Available	501	Open in IMG/M
3300015371\|Ga0132258_10298346	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3962	Open in IMG/M
3300015371\|Ga0132258_11530488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1684	Open in IMG/M
3300015373\|Ga0132257_100031696	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae	5732	Open in IMG/M
3300015373\|Ga0132257_101333417	All Organisms → cellular organisms → Bacteria → Proteobacteria	912	Open in IMG/M
3300015374\|Ga0132255_102137299	Not Available	853	Open in IMG/M
3300015374\|Ga0132255_103369981	Not Available	681	Open in IMG/M
3300015374\|Ga0132255_104908116	Not Available	566	Open in IMG/M
3300016341\|Ga0182035_10478918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1060	Open in IMG/M
3300016341\|Ga0182035_12138220	Not Available	508	Open in IMG/M
3300016404\|Ga0182037_10263235	All Organisms → cellular organisms → Bacteria	1370	Open in IMG/M
3300016422\|Ga0182039_10176714	Not Available	1681	Open in IMG/M
3300016422\|Ga0182039_10819347	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Fundidesulfovibrio → Fundidesulfovibrio magnetotacticus	827	Open in IMG/M
3300016445\|Ga0182038_10310668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1293	Open in IMG/M
3300018058\|Ga0187766_11108335	Not Available	569	Open in IMG/M
3300018058\|Ga0187766_11275876	Not Available	534	Open in IMG/M
3300018058\|Ga0187766_11437952	Not Available	507	Open in IMG/M
3300018073\|Ga0184624_10441740	Not Available	572	Open in IMG/M
3300018433\|Ga0066667_11548478	Not Available	588	Open in IMG/M
3300018468\|Ga0066662_11927508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	618	Open in IMG/M
3300018468\|Ga0066662_12101785	Not Available	592	Open in IMG/M
3300018482\|Ga0066669_11576514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	599	Open in IMG/M
3300019361\|Ga0173482_10273371	Not Available	730	Open in IMG/M
3300021168\|Ga0210406_10918846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	657	Open in IMG/M
3300021560\|Ga0126371_13409934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	537	Open in IMG/M
3300022557\|Ga0212123_10006908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18462	Open in IMG/M
3300024330\|Ga0137417_1358042	All Organisms → cellular organisms → Bacteria → Proteobacteria	3686	Open in IMG/M
3300025320\|Ga0209171_10003090	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	23289	Open in IMG/M
3300025898\|Ga0207692_11082990	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300025928\|Ga0207700_11793089	Not Available	540	Open in IMG/M
3300025932\|Ga0207690_11516746	Not Available	560	Open in IMG/M
3300025960\|Ga0207651_10699964	Not Available	893	Open in IMG/M
3300026023\|Ga0207677_10624120	Not Available	948	Open in IMG/M
3300026300\|Ga0209027_1154285	Not Available	779	Open in IMG/M
3300027181\|Ga0208997_1016238	Not Available	1028	Open in IMG/M
3300027537\|Ga0209419_1129922	Not Available	503	Open in IMG/M
3300027635\|Ga0209625_1115094	All Organisms → cellular organisms → Bacteria → Proteobacteria	603	Open in IMG/M
3300027812\|Ga0209656_10377027	Not Available	640	Open in IMG/M
3300027824\|Ga0209040_10089092	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1768	Open in IMG/M
3300027862\|Ga0209701_10533934	Not Available	632	Open in IMG/M
3300027862\|Ga0209701_10544237	Not Available	624	Open in IMG/M
3300027875\|Ga0209283_10778973	Not Available	590	Open in IMG/M
3300028814\|Ga0307302_10098524	Not Available	1395	Open in IMG/M
3300031543\|Ga0318516_10043159	All Organisms → cellular organisms → Bacteria	2432	Open in IMG/M
3300031544\|Ga0318534_10361239	Not Available	835	Open in IMG/M
3300031682\|Ga0318560_10020709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3006	Open in IMG/M
3300031744\|Ga0306918_10026274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3614	Open in IMG/M
3300031744\|Ga0306918_10936893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	674	Open in IMG/M
3300031744\|Ga0306918_11251403	Not Available	572	Open in IMG/M
3300031768\|Ga0318509_10819875	Not Available	514	Open in IMG/M
3300031781\|Ga0318547_10236399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Oricola → Oricola indica	1099	Open in IMG/M
3300031793\|Ga0318548_10016889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3005	Open in IMG/M
3300031805\|Ga0318497_10051850	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2117	Open in IMG/M
3300031819\|Ga0318568_10236875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1129	Open in IMG/M
3300031833\|Ga0310917_10087323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1987	Open in IMG/M
3300031879\|Ga0306919_10253023	Not Available	1326	Open in IMG/M
3300031879\|Ga0306919_10371730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	1094	Open in IMG/M
3300031879\|Ga0306919_10997837	Not Available	640	Open in IMG/M
3300031890\|Ga0306925_10534765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1245	Open in IMG/M
3300031893\|Ga0318536_10012368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3703	Open in IMG/M
3300031910\|Ga0306923_10145334	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2704	Open in IMG/M
3300031912\|Ga0306921_12322659	Not Available	562	Open in IMG/M
3300031941\|Ga0310912_11033669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae	629	Open in IMG/M
3300031945\|Ga0310913_10627771	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	761	Open in IMG/M
3300031946\|Ga0310910_11269150	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	570	Open in IMG/M
3300032052\|Ga0318506_10279624	Not Available	740	Open in IMG/M
3300032055\|Ga0318575_10629125	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300032060\|Ga0318505_10409143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	641	Open in IMG/M
3300032066\|Ga0318514_10619906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	576	Open in IMG/M
3300032089\|Ga0318525_10305980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	816	Open in IMG/M
3300032261\|Ga0306920_101999240	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	812	Open in IMG/M
3300033290\|Ga0318519_11017249	Not Available	515	Open in IMG/M
3300033290\|Ga0318519_11074149	Not Available	502	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.93%
Host-Associated	Host-Associated	17.07%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.05%
Plants	Host-Associated → Plants	17.07%
Aquatic	Environmental → Aquatic	4.88%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.05%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.32%
Freshwater	Environmental → Aquatic → Freshwater	2.44%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.83%
Sediment	Environmental → Aquatic → Sediment	0.61%
Roots	Host-Associated → Plants → Roots	0.61%
Phylloplane	Host-Associated → Plants → Phylloplane	0.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	56.71%
Loam	Environmental → Terrestrial → Soil → Loam	18.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	7.93%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.27%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.05%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.05%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.83%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.22%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.61%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.61%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.61%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	25.61%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	19.51%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	16.46%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.54%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	7.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.27%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.05%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.05%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.44%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.83%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.22%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.61%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.61%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.61%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.61%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	13.41%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	12.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	12.20%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	11.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.49%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.27%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.66%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.66%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	3.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.05%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.44%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.44%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.44%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.83%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.83%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.83%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.83%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.22%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.22%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.22%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.22%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.61%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.61%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.61%
Green-Waste Compost	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.61%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.61%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.61%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2070309004	Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico	Environmental	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001081	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006572	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010146	Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025320	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300027181	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027537	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027635	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)	Environmental	Open in IMG/M
3300027812	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032052	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19	Environmental	Open in IMG/M
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental	Open in IMG/M
3300032060	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18	Environmental	Open in IMG/M
3300032066	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
prs_02171790	2070309004	Green-Waste Compost	MKKIFVALVATVVAVGMAGCVGVGKGKAPPVVTKG
INPgaii200_04263302	2228664022	Soil	MKKILVAMVATLVAISVSACVGPYGIGKGKGKAPPPIVTKG
JGI1027J12803_1013698451	3300000955	Soil	MKKIMIALVATLVAMSVGACAYGYGKGKAPPPRVVTTKG*
JGI1027J12803_1058523333	3300000955	Soil	MKKILVAMVATLVAISVSACVGPYGIGKGKGKAPPPIVTKG*
JGI12662J13196_10035091	3300001081	Forest Soil	MKKLVFALLATLVAVSVAGCAGGMGKGKARPAVVTKG*
JGIcombinedJ26739_1000122899	3300002245	Forest Soil	MKKLLFALIATIVAVSVSGCAGMGKGKAPPVVTKG*
JGIcombinedJ26739_1016369622	3300002245	Forest Soil	MKKVLVALVAILVAVSVSGCAGGFGKGKAPPPRVVTKG*
Ga0062593_1006394222	3300004114	Soil	REAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG*
Ga0062589_1008663621	3300004156	Soil	MKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG*
Ga0062595_1018074581	3300004479	Soil	KISPLIREAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG*
Ga0062594_1004473192	3300005093	Soil	MKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG*
Ga0066388_1030158022	3300005332	Tropical Forest Soil	MHLYGGPSMKKIMVAVVATLVAISVSACVGPYGIGKGKGKAPPPVVTKG*
Ga0066388_1038064882	3300005332	Tropical Forest Soil	MKKVLIALVATLVAVSVSGCAGYGLGKGKAPPPRVVTKG*
Ga0070741_116543031	3300005529	Surface Soil	MKKILVAAVATLIAVSVAGCAAVGFGKGKAPPPVVTKG*
Ga0058697_106068992	3300005562	Agave	MKKVLIAFVATLVAVSVAGCAGVGKGKGKAPAPVVTKG*
Ga0070664_1022328332	3300005564	Corn Rhizosphere	VKKGEPMKKVLIALVATLVAVSVAGCAGIGKGKGKPPPPIVTKG*
Ga0066702_109068721	3300005575	Soil	MKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0066654_102447882	3300005587	Soil	MKKVLTVLVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0066903_1000992246	3300005764	Tropical Forest Soil	KIMVALVATLVAISLSGCAYGFGKGKGVPPRVVTKG*
Ga0066903_1001599904	3300005764	Tropical Forest Soil	MKKIFVALVATIVAIGMAGCVGVGKGKAPPVVTKG*
Ga0066903_1002727792	3300005764	Tropical Forest Soil	MKKLLFALVATIVAVSVSGCVGGYGKGKAPPIVTKG*
Ga0066903_1003566932	3300005764	Tropical Forest Soil	MKKVFVALVATVVAVGMAGCVGIGKGKAPPVVTKG*
Ga0066903_1003850091	3300005764	Tropical Forest Soil	MGAPMKKLLVAMVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0066903_1003910863	3300005764	Tropical Forest Soil	MKKLLIALVATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0066903_1005716332	3300005764	Tropical Forest Soil	MKKLLIALVATLVAVSVSGCVGIGKGKGKAPPVVTKG*
Ga0066903_1006770073	3300005764	Tropical Forest Soil	MKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKG*
Ga0066903_1010920103	3300005764	Tropical Forest Soil	MKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0066903_1012678212	3300005764	Tropical Forest Soil	MKKFVIALVATLVAVSVSACVGIGKGKGKAPPLPPPPIMTKG*
Ga0066903_1016114964	3300005764	Tropical Forest Soil	MKKIMVAVVATLVAISVSACVGPYGIGKGKGKAPPPVVTKG*
Ga0066903_1017186903	3300005764	Tropical Forest Soil	MKKVLVALVATLVAVSVSGCVGFGKGKAPPPIVSKG*
Ga0066903_1017621163	3300005764	Tropical Forest Soil	MKKIMIALVATLVAMSVGACAYPYGYGKGKAPPPVVTKR*
Ga0066903_1037001592	3300005764	Tropical Forest Soil	MKKIFVALVATVVAVGMAGCVGVGKGKAPPVVTKG*
Ga0066903_1042874352	3300005764	Tropical Forest Soil	MKKIMVAMVATLVALSVGACAYGYGKGKAPPPRVVTKG*
Ga0066903_1056158362	3300005764	Tropical Forest Soil	MKKILVALVATFVAIGMVGCVGGYGKGKAPPIVTKG*
Ga0066903_1089976102	3300005764	Tropical Forest Soil	MKKLLFALVATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0070717_103551822	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MKKVVVAAAAVITLVSLAGCAGIGKGKGKAPPPIPVITKG*
Ga0066652_1000076729	3300006046	Soil	MKKIFVAMVATIVAIGMAGCVGVGKGKAPPVVTKG*
Ga0066652_1002151592	3300006046	Soil	MKKVLCALVATLVAVSVAGCVGIGKGKGKAPPIVTKG*
Ga0097621_1022448671	3300006237	Miscanthus Rhizosphere	EAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG*
Ga0074051_105267901	3300006572	Soil	LLIALVATLVAVSVSACAGIGKGKGKAPPPIITKG*
Ga0066653_101226282	3300006791	Soil	MKKLLFALVATVVAVSVAGCAGMGKGKAPPVVTKG*
Ga0066660_113276861	3300006800	Soil	MKKLLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG*
Ga0075433_117026262	3300006852	Populus Rhizosphere	VLIALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG*
Ga0075434_1005796573	3300006871	Populus Rhizosphere	RGTPMKKVLTALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG*
Ga0073928_1000030796	3300006893	Iron-Sulfur Acid Spring	MKKLVIALIATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0099793_104408352	3300007258	Vadose Zone Soil	MKKIFVALVATIVAVGMVGCVGVGKGKAPPIVTKG*
Ga0099829_108308411	3300009038	Vadose Zone Soil	MKKLLIALVATLVAVSVSGCVGVGKGKGKAPPIVTKG*
Ga0099829_111986181	3300009038	Vadose Zone Soil	MKKLLVALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0099829_115881602	3300009038	Vadose Zone Soil	IFVALVATLVAVSMAGCVGVGKGKGKAPPPIVTKG*
Ga0099830_105415042	3300009088	Vadose Zone Soil	MKKVLIALVATVVAVGMAGCVGVGKGKAPPIVTKG*
Ga0099830_105852532	3300009088	Vadose Zone Soil	MKKLLVALVATLVAVSVAGCVGVGKGKGKAPPPIVTKG*
Ga0099830_118652131	3300009088	Vadose Zone Soil	KKVLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG*
Ga0099828_104305431	3300009089	Vadose Zone Soil	MKKLFVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG*
Ga0099828_109304142	3300009089	Vadose Zone Soil	MKKVLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG*
Ga0105245_131535892	3300009098	Miscanthus Rhizosphere	MKKVLTALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG*
Ga0075418_115775772	3300009100	Populus Rhizosphere	MKKVLTVLVATLVAASVAGCAGIGKGKGKAPPPIVTKG*
Ga0105249_129793891	3300009553	Switchgrass Rhizosphere	MKKVLFALVATLVAVSVSGCAGLGKGKGKAPPPPPIVRKG*
Ga0126374_111805162	3300009792	Tropical Forest Soil	MKKVLFALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0126382_105654421	3300010047	Tropical Forest Soil	MKKVLIALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0126320_13824521	3300010146	Soil	YQHRGYPMKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0126319_16176072	3300010147	Soil	KKILVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG*
Ga0074046_104338701	3300010339	Bog Forest Soil	MKKVLFALIATLVAVSVSGCVGIGKGKAPPVVTKG*
Ga0074046_106873361	3300010339	Bog Forest Soil	APMKKIFVALVATVVAVGMAGCVGVGKGKAPPVVTKG*
Ga0126370_109493111	3300010358	Tropical Forest Soil	KVLFALVATLVAVSVSGCVGIGKGKAPPPIVTKG*
Ga0126379_122254972	3300010366	Tropical Forest Soil	MKKIMVAVVATLVAISVSACVGPYGIGKGKGKAPPPVVT
Ga0134122_123399051	3300010400	Terrestrial Soil	MKKVLFALVATLVAVSVSGCAGLGKGKGKAPPPPPIVRK
Ga0124844_12148602	3300010868	Tropical Forest Soil	LIALVATLVAVSVSACVGIGKGKGKAPPPIVTKG*
Ga0124844_12374692	3300010868	Tropical Forest Soil	VLIALVATLVAVSVSACVGIGKGKGKAPPPIVTKG*
Ga0137391_113013042	3300011270	Vadose Zone Soil	PMKKLLVALVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0137389_107973341	3300012096	Vadose Zone Soil	MKKIFVALVATVVAVGMVGCVGVGKGKAPPIVTKG*
Ga0137388_107758072	3300012189	Vadose Zone Soil	MKKIFVALVATLVAVSMAGCVGVGKGKGKAPPPIVTKG*
Ga0137388_110079102	3300012189	Vadose Zone Soil	MKKIFVALVATIVAVGMAGCVGVGKGKAPPVVTKG*
Ga0137363_113521851	3300012202	Vadose Zone Soil	MKKVLVALVATLVAVSVSGCVGVGKGKAPPVVTKG*
Ga0150985_1034464732	3300012212	Avena Fatua Rhizosphere	MNKIFVALVATVVAIGMSGCVGVGKGKAPPPIVTKG*
Ga0150985_1061792781	3300012212	Avena Fatua Rhizosphere	KKVLTVLVATLVAVSVAGCVGIGKGKGKAPPPVVTKG*
Ga0150985_1065233211	3300012212	Avena Fatua Rhizosphere	LTVLVATLVAVSVAGCVGIGKGKGKAPPPIVTKG*
Ga0150985_1084965041	3300012212	Avena Fatua Rhizosphere	MKKVLIAFVATLVAVSVAGCAGLGKGRGKAPAPVVTKG*
Ga0150985_1118156921	3300012212	Avena Fatua Rhizosphere	GQQHRGFQMKKLLFALVATLVAVSVAGCAGMGKGKAPPVVTKG*
Ga0150985_1137779324	3300012212	Avena Fatua Rhizosphere	KKVLTVLVATLVAVSVAGCVGIGKGKGKGKGKAPPPIVTKG*
Ga0137390_102190861	3300012363	Vadose Zone Soil	MKKVLVALVATLVAVSVSGCVGIGKGKGKAPPIVTKG*
Ga0150984_1120113132	3300012469	Avena Fatua Rhizosphere	KVLVALVATLVAVSVSGCVGIGKGKGKAPPPVVTKG*
Ga0150984_1122970722	3300012469	Avena Fatua Rhizosphere	MKKVLIAFVATLVAVSVAGCAGLGKGKGKAPAPVVTKG*
Ga0150984_1124523681	3300012469	Avena Fatua Rhizosphere	MKKVLCALVATLVAVTVAGCVGVGKGKGKAPPIVTKG*
Ga0150984_1160801493	3300012469	Avena Fatua Rhizosphere	MKKVLTVLVATLVAVSVAGCVGIGKGKGKGKAPPPIVTKG*
Ga0157302_102159381	3300012915	Soil	MKKVLIAFVATLVAVSVAGCAGIGKGKGKALPPVVTKG*
Ga0126369_128855691	3300012971	Tropical Forest Soil	MKKVLFALVATIVAVSVSGCVGIGKGKAPPVVTKG*
Ga0173483_110003593	3300015077	Soil	SKEAVMKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG*
Ga0132258_102983462	3300015371	Arabidopsis Rhizosphere	MKKLLIALVATLVAVSVSGCVGIGKGKAPPVVTKG*
Ga0132258_115304881	3300015371	Arabidopsis Rhizosphere	PMKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKA*
Ga0132257_1000316962	3300015373	Arabidopsis Rhizosphere	MKKVVVAAVTVITLVSLAGCAGIGKGKGKAPPPIPVITKG*
Ga0132257_1013334172	3300015373	Arabidopsis Rhizosphere	MKKLVIALVATLVAVSVSGCVGIGKGKAPPIVTKG*
Ga0132255_1021372991	3300015374	Arabidopsis Rhizosphere	LIALVATLVAVSVAGWAGIGKGKGKAPPPIVTKG*
Ga0132255_1033699811	3300015374	Arabidopsis Rhizosphere	IRGSKEAVMKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG*
Ga0132255_1049081161	3300015374	Arabidopsis Rhizosphere	KSASIRGSKEAVMKKVLIALVATLVAVSVSGCAGLGKGKAPPPRVVTKG*
Ga0182035_104789181	3300016341	Soil	MKKVFVVLVATVVAVGMAGCVGIGKGKAPPVVTKG
Ga0182035_115100462	3300016341	Soil	MKKLVVALLATLVAVSVAGCAGIGKGKARPAVLTKG
Ga0182035_121382201	3300016341	Soil	MKKLLIALVATLVAVSVSGCVGIGKGKAPPVVTKG
Ga0182037_102632352	3300016404	Soil	GTPMKKVLVALVATLVAVSVAGCVGIGKCKGPPPVVTKG
Ga0182039_101767141	3300016422	Soil	MKKIFVALVATMVAVGMAGCVGVGKGKAPPVVTKG
Ga0182039_108193471	3300016422	Soil	MKKVIFALIATIVAVSVAGCAGMGKGKAPPVVTKG
Ga0182038_103106683	3300016445	Soil	PMKKVLFAVLATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0187766_111083352	3300018058	Tropical Peatland	MKKLLFALVATLVAVSVSGCVGVGKGKAPPPPVVTK
Ga0187766_112758761	3300018058	Tropical Peatland	MKKIFVALVATVVAVGMVGCVGVGKGKAPPVVTKG
Ga0187766_114379522	3300018058	Tropical Peatland	MKKVLFALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0184624_104417401	3300018073	Groundwater Sediment	MKKVLFALVATLVAVSVSGCVGVGKGKAPPIVTKG
Ga0066667_115484781	3300018433	Grasslands Soil	MKKLLFALVATVVAVSVAGCAGMGKGKAPPVVTKG
Ga0066662_119275081	3300018468	Grasslands Soil	MKKLLVAMVATLVAVSVAGCVGIGKGKGKAPPPIVTKG
Ga0066662_121017851	3300018468	Grasslands Soil	MKKIFVALVATIVAVGMAGCVGVGKGKAPPVVTKG
Ga0066669_115765142	3300018482	Grasslands Soil	MKKVLIALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0173482_102733712	3300019361	Soil	MKKVLIALVATLVAVSVSGCAGYGFGKGKAPPPRVVTKG
Ga0210406_109188462	3300021168	Soil	MKKLLFALIATIVAVSVSGCAGMGKGKAPPVVTKG
Ga0126371_134099342	3300021560	Tropical Forest Soil	MKKLLIALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0212123_100069088	3300022557	Iron-Sulfur Acid Spring	MKKLVIALIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0137417_13580424	3300024330	Vadose Zone Soil	MKKILVALVATLVAVSVAGCAGIGKARAKAPPPIVTKG
Ga0209171_1000309011	3300025320	Iron-Sulfur Acid Spring	MKKLLFALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0207692_110829901	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	VLVALVATLVAVSVSGCVGIGKGKGKAPPPVVTKG
Ga0207700_117930892	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MKKVLTALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG
Ga0207690_115167461	3300025932	Corn Rhizosphere	MNKLLIALVATLVAVSVSGCAGVGKGKAPPPVAAPIVTKG
Ga0207651_106999642	3300025960	Switchgrass Rhizosphere	MKKALFALVATLVAVSVSGCAGIGKGKGKAPPPIVTKG
Ga0207677_106241201	3300026023	Miscanthus Rhizosphere	SPLIREAVMKKVLIALVASLVAISVSGCAGYGFGKGKAPPPRVVTKG
Ga0209027_11542851	3300026300	Grasslands Soil	MKKVLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG
Ga0208997_10162382	3300027181	Forest Soil	LLVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG
Ga0209419_11299221	3300027537	Forest Soil	MKKLLIALVATLVAVSVSGCVGVGKGKCKAPPIVTKG
Ga0209625_11150942	3300027635	Forest Soil	MKKILIALVATLVAVSVSACVGIGKGKGKAPPDVLP
Ga0209656_103770271	3300027812	Bog Forest Soil	MKKVLFALIATLVAVSVSGCVGIGKGKAPPVVTKG
Ga0209040_100890922	3300027824	Bog Forest Soil	MKKILFALIATVVAVSVSGCVGVGKGKAPPIVTKG
Ga0209701_105339342	3300027862	Vadose Zone Soil	MKKIFVALVATIVAVGMVGCVGVGKGKAPPIVTKG
Ga0209701_105442372	3300027862	Vadose Zone Soil	AEGIPMKKLLIALVATLVAVSVSGCVGIGKGKGKAPPIVTKG
Ga0209283_107789731	3300027875	Vadose Zone Soil	MKKVLVALVATLVAVSVSGCVGIGKGKGKAPPIVTKG
Ga0307302_100985243	3300028814	Soil	KILVALVATLVAVSVAGCAGIGKGKGKAPPPIVTKG
Ga0318516_100431592	3300031543	Soil	MKKVFVALVATVVAVGMAGCVGIGKGKAPPVVTKG
Ga0318534_103612392	3300031544	Soil	MKKVLFAVIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0318560_100207093	3300031682	Soil	MKKLLFALVATVVAVSVSGCVGVGKGKAPPVVTKG
Ga0306918_100262743	3300031744	Soil	MKKVLFALVATIVAVSVSGCVGIGKGKAPPVVTKG
Ga0306918_105400941	3300031744	Soil	MKKLVCALLATVLAFSVAGCAGVGKGKAPPVVTKG
Ga0306918_109368931	3300031744	Soil	GIPMKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKG
Ga0306918_112514031	3300031744	Soil	MKKIFVALVATIVAIGMAGCVGVGKGKAPPVVTKG
Ga0318509_108198752	3300031768	Soil	MKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKGLG
Ga0318547_102363992	3300031781	Soil	MKKLLFALVATLVAVSVSGCVGVGKGKAPPIVTKG
Ga0318548_100168892	3300031793	Soil	MKKVLFALVATLVAVSVSGCVGVGNGKAPPVVTKG
Ga0318497_100518503	3300031805	Soil	IPMKKLLFALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0318568_102368752	3300031819	Soil	PMKKVLFALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0318567_103852901	3300031821	Soil	MLLFDSRQVTEGVTMKKLVCALLATVLAFSVAGCAGVGKGKAPPVVTKG
Ga0310917_100873235	3300031833	Soil	MKKVLFALVATLVAVSVSGCVGIGKGKAPPAVVTKG
Ga0306919_102530232	3300031879	Soil	MKKIFVALVATLVAVGMVGCVGVGKGKAPPVVTKG
Ga0306919_102659451	3300031879	Soil	MKKLVVALLATLVAVSVAGCAGIGKGKARPAVVTKG
Ga0306919_103717302	3300031879	Soil	MKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0306919_109978372	3300031879	Soil	MKKLLFALVATLVAVSVSGCVGIGKGKAPPVVTKG
Ga0306925_105347652	3300031890	Soil	MKKVLIALVATLVAASVSGCVGYGLGKGKAPPPVVTKG
Ga0318536_100123681	3300031893	Soil	EGIPMKKVLFAVIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0306923_101453344	3300031910	Soil	MKKILFALVATLVAVSVSGCVGVGKGKAPPIVTKG
Ga0306921_123226592	3300031912	Soil	MKRVLIALVATLVAASVSGCVGYGLGKGKAPPPVVTKG
Ga0310912_110336692	3300031941	Soil	MKKVLIALIATLVAVSVSGCVGVGTGKAPPVVTKG
Ga0310913_106277711	3300031945	Soil	GYPMKKVLFALVATIVAVSVSGCVGIGKGKAPPVVTKG
Ga0310910_112691501	3300031946	Soil	RGYPMKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0306922_117059122	3300032001	Soil	RQVTEGVTMKKLVCALLATVLAFSVAGCAGVGKGKAPPVVTKG
Ga0318506_102796242	3300032052	Soil	AEGIPMKKVLFAVIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0318575_106291251	3300032055	Soil	PMKKIFVALVATLVAVGMVGCVGVGKGKAPPVVTKG
Ga0318505_104091431	3300032060	Soil	CSMKRVLIALVATLVAASVSGCVGYGLGKGKAPPPVVTKG
Ga0318514_106199062	3300032066	Soil	HRGYPMKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0318525_103059802	3300032089	Soil	RGYPMKKVLFALVATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0306920_1019992401	3300032261	Soil	PMKKVLIALIATLVAVSVSGCVGVGKGKAPPVVTKG
Ga0318519_110172491	3300033290	Soil	KERGIPMKKVLFALVATLVAVSVSGCVGIGKGKAPPPIVRKG
Ga0318519_110741492	3300033290	Soil	MKKVLVVLVATLVAVSVSGCAGIGKGKGKAPPAIVTKG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F039183

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences